Calpain 5a

Overview
NameCalpain 5a
Smed IDSMED30023857
Length (bp)2338
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Calpain 5a (SMED30023857) t-SNE clustered cells

Violin plots show distribution of expression levels for Calpain 5a (SMED30023857) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023857

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30023857SMESG000009459.1 dd_Smed_v4_101944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023857SMESG000009459.1 dd_Smed_v4_101944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023857SMESG000009459.1 dd_Smed_v4_101944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023857SMESG000009459.1 dd_Smed_v4_101944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023857SMESG000009459.1 dd_Smed_v4_101944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023857SMESG000009459.1 dd_Smed_v4_101944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30023857SMESG000009459.1 dd_Smed_v4_101944_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
reproductive organSMED30023857SMESG000009459.1 Contig44807newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30023857SMESG000009459.1 Contig44807uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Calpain 5a vs. Ensembl Human
Match: CAPN5 (calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482])

HSP 1 Score: 336.265 bits (861), Expect = 1.539e-104
Identity = 204/622 (32.80%), Postives = 324/622 (52.09%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLMCATI-ASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALA-------EIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSN-CTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNM 1882
            + +QNY ++R++ ++   LF D  F A D S+   G      ++ WKRP  +C +P LF+ G S HD+ QG +GNCW V+A + LA      +KVIP+  +QEW   +P++Y G+F    WR+GEW++VVIDDRLP+ N +L++ HS  +NEFW AL+EKAYAK+ G Y++L GG T +++VDFTGG+ E I DL +  ++  +T+   LF+ +      G L+ A+I A  + +ME +LA GL+  HAY++T V K+R+    +   ++   L  IRLRNPWG++EWNG  SD SEEW  +S  ++  MG  V++DGEFWM  +DV   F +I   R I T     +  W  +   G WT     RQ+             Q  Q+  E+  P+ ++ +C         ++  +G   A+G  I  VE NR + +H+ +       Y    SRS+ LR     G Y++ P       + +F    LLR +T   +N      E+ + E    C S+ C        +         +     N +  I CE   +R+ V   TS   ++   + +R K+ +PI +++++     +  +G      D  +L   + + TL++
Sbjct:    8 YEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPG--PAVRWKRPKGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGIFHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI-DLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVINTSHLSIHKTWEEARLHGAWTLHEDPRQNRGGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYI--NSRSVFLRTDQPEGRYVIIPTTFEPGHTGEF----LLRVFTDVPSNC----RELRLDEPPHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKADPDNL---QALHTLHL 612          
BLAST of Calpain 5a vs. Ensembl Human
Match: CAPN5 (calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482])

HSP 1 Score: 336.265 bits (861), Expect = 1.539e-104
Identity = 204/622 (32.80%), Postives = 324/622 (52.09%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLMCATI-ASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALA-------EIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSN-CTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNM 1882
            + +QNY ++R++ ++   LF D  F A D S+   G      ++ WKRP  +C +P LF+ G S HD+ QG +GNCW V+A + LA      +KVIP+  +QEW   +P++Y G+F    WR+GEW++VVIDDRLP+ N +L++ HS  +NEFW AL+EKAYAK+ G Y++L GG T +++VDFTGG+ E I DL +  ++  +T+   LF+ +      G L+ A+I A  + +ME +LA GL+  HAY++T V K+R+    +   ++   L  IRLRNPWG++EWNG  SD SEEW  +S  ++  MG  V++DGEFWM  +DV   F +I   R I T     +  W  +   G WT     RQ+             Q  Q+  E+  P+ ++ +C         ++  +G   A+G  I  VE NR + +H+ +       Y    SRS+ LR     G Y++ P       + +F    LLR +T   +N      E+ + E    C S+ C        +         +     N +  I CE   +R+ V   TS   ++   + +R K+ +PI +++++     +  +G      D  +L   + + TL++
Sbjct:    8 YEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPG--PAVRWKRPKGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGIFHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI-DLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVINTSHLSIHKTWEEARLHGAWTLHEDPRQNRGGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYI--NSRSVFLRTDQPEGRYVIIPTTFEPGHTGEF----LLRVFTDVPSNC----RELRLDEPPHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKADPDNL---QALHTLHL 612          
BLAST of Calpain 5a vs. Ensembl Human
Match: CAPN5 (calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482])

HSP 1 Score: 336.265 bits (861), Expect = 1.539e-104
Identity = 204/622 (32.80%), Postives = 324/622 (52.09%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLMCATI-ASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALA-------EIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSN-CTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNM 1882
            + +QNY ++R++ ++   LF D  F A D S+   G      ++ WKRP  +C +P LF+ G S HD+ QG +GNCW V+A + LA      +KVIP+  +QEW   +P++Y G+F    WR+GEW++VVIDDRLP+ N +L++ HS  +NEFW AL+EKAYAK+ G Y++L GG T +++VDFTGG+ E I DL +  ++  +T+   LF+ +      G L+ A+I A  + +ME +LA GL+  HAY++T V K+R+    +   ++   L  IRLRNPWG++EWNG  SD SEEW  +S  ++  MG  V++DGEFWM  +DV   F +I   R I T     +  W  +   G WT     RQ+             Q  Q+  E+  P+ ++ +C         ++  +G   A+G  I  VE NR + +H+ +       Y    SRS+ LR     G Y++ P       + +F    LLR +T   +N      E+ + E    C S+ C        +         +     N +  I CE   +R+ V   TS   ++   + +R K+ +PI +++++     +  +G      D  +L   + + TL++
Sbjct:    8 YEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPG--PAVRWKRPKGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGIFHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI-DLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVINTSHLSIHKTWEEARLHGAWTLHEDPRQNRGGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYI--NSRSVFLRTDQPEGRYVIIPTTFEPGHTGEF----LLRVFTDVPSNC----RELRLDEPPHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKADPDNL---QALHTLHL 612          
BLAST of Calpain 5a vs. Ensembl Human
Match: CAPN5 (calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482])

HSP 1 Score: 316.62 bits (810), Expect = 1.102e-96
Identity = 204/662 (30.82%), Postives = 324/662 (48.94%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPS----------------------------------------ELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLMCATI-ASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALA-------EIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSN-CTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNM 1882
            + +QNY ++R++ ++   LF D  F A D S+   G      ++ WKRP                                          +C +P LF+ G S HD+ QG +GNCW V+A + LA      +KVIP+  +QEW   +P++Y G+F    WR+GEW++VVIDDRLP+ N +L++ HS  +NEFW AL+EKAYAK+ G Y++L GG T +++VDFTGG+ E I DL +  ++  +T+   LF+ +      G L+ A+I A  + +ME +LA GL+  HAY++T V K+R+    +   ++   L  IRLRNPWG++EWNG  SD SEEW  +S  ++  MG  V++DGEFWM  +DV   F +I   R I T     +  W  +   G WT     RQ+             Q  Q+  E+  P+ ++ +C         ++  +G   A+G  I  VE NR + +H+ +       Y    SRS+ LR     G Y++ P       + +F    LLR +T   +N      E+ + E    C S+ C        +         +     N +  I CE   +R+ V   TS   ++   + +R K+ +PI +++++     +  +G      D  +L   + + TL++
Sbjct:    8 YEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPG--PAVRWKRPKYSGHSLAPHRPGWGDARRMENVPRPGSSGCPSSSLRARDLGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGIFHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI-DLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVINTSHLSIHKTWEEARLHGAWTLHEDPRQNRGGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYI--NSRSVFLRTDQPEGRYVIIPTTFEPGHTGEF----LLRVFTDVPSNC----RELRLDEPPHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKADPDNL---QALHTLHL 652          
BLAST of Calpain 5a vs. Ensembl Human
Match: CAPN8 (calpain 8 [Source:HGNC Symbol;Acc:HGNC:1485])

HSP 1 Score: 254.603 bits (649), Expect = 7.765e-77
Identity = 143/345 (41.45%), Postives = 207/345 (60.00%), Query Frame = 2
Query:   50 SRNFVFFNNQNYVSMRQEHQKNLTLFCDDTFGA-----DDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLM-CATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI 1066
            ++N + +  Q++ ++RQ+   +  LF D  F A       K + P   Q     I WKRP+ELC +P   + G++  D+CQG LG+CWL++A+A L  + E L +V+P   DQ++  N    Y G+F    W+YGEW+EVVIDDRLP++NG+L+F+HS+  NEFWSAL+EKAYAK+ G YE+L GG T E   DFTGGI E  +DLKK         NL++++      GSL+ C+   S + E E   +  L+ +HAYS+TGV ++  +  P            IRLRNPWG+ EW+G+ SD + EW+ I  + K  +  KVE DGEFWM + D +  F+ + I
Sbjct:   21 NQNALKYLGQDFKTLRQQCLDSGVLFKDPEFPACPSALGYKDLGPGSPQ--TQGIIWKRPTELCPSPQFIVGGATRTDICQGGLGDCWLLAAIASLTLNEELLYRVVPR--DQDFQEN----YAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEQGNEFWSALLEKAYAKLNGCYEALAGGSTVEGFEDFTGGISE-FYDLKKPPA------NLYQIIRKALCAGSLLGCSIDVSSAAEAEAITSQKLVKSHAYSVTGVEEVNFQGHPE---------KLIRLRNPWGEVEWSGAWSDDAPEWNHIDPRRKEELDKKVE-DGEFWMSLSDFVRQFSRLEI 340          
BLAST of Calpain 5a vs. Ensembl Celegans
Match: tra-3 (Calpain-5 [Source:UniProtKB/Swiss-Prot;Acc:Q22036])

HSP 1 Score: 316.62 bits (810), Expect = 1.916e-97
Identity = 204/600 (34.00%), Postives = 314/600 (52.33%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLK--KYSKSDTEMENLFKLLHFDWKDGSLMCATIASRS-DEMEEKLANGLITTHAYSITGVCKLRI-----KSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVEN----DGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT------GVAGDRQSA----LAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSE-----AALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYR-LTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIF 1783
            F NQNY  +R+   K    F D  F   ++S+    +Q   S I WKRP EL  +P LF+ G+S +DV QG LGNCW VSA + L  + + L +VIP+ DDQEW  +  H+Y G+FR   WR+G+W+EVVIDD LP+R+GKL+F  SK  NEFWSAL+EKA+AK+ G YE+LVGG   +++ D +GG+ E +   K  K   +DTE++ LF  L   +  G+L+ A IA+R+ +E+EE L  GL+  HAY+++ VC + +     +S   +    K     IRL+NPWG+KEWNG+ SD S EW ++S      MG +  N    DG+FWM  +  +  F +I++ +   T +F ++ ++   +    WT      G   DR        A      Q+  +I +P   +    +    + G +       +G+ ++ VE NR + VHT        +Y  G  RS+ L  + L  G Y++ P  T  +P  K    ++LR Y+ +  + + L    P L     CKS  ++    +H +  +           N++  +    +S RT        + WDE FL H+SK  +   I+++
Sbjct:   10 FGNQNYEKLRKICIKKKQPFVDTLFPPTNQSLFLEQRQS--SDIVWKRPGELHPDPHLFVEGASPNDVTQGILGNCWFVSACSALTHNFKLLAQVIPDADDQEW--STKHAYAGIFRFRFWRFGKWVEVVIDDLLPTRDGKLLFARSKTPNEFWSALLEKAFAKLYGCYENLVGGHLSDALQDVSGGVAETLHVRKFLKDDPNDTELK-LFNDLKTAFDKGALVVAAIAARTKEEIEESLDCGLVKGHAYAVSAVCTIDVTNPNERSFTSFIMGSKRKQNLIRLQNPWGEKEWNGAWSDDSPEWQNVSASQLSTMGVQPANSDSDDGDFWMPWESFVHYFTDISLCQLFNTSVFSFSRSYDEQIVFSEWTTNGKKSGAPDDRAGGCHNFKATFCNNPQYIFDIPSPNCSVMFALIQNDPSEGLKKREPFVTIGMHVMKVENNRQYRVHTAMHPIAISDYASG--RSVYLHLQSLPRGRYLLIP--TTFAP--KEQTLFMLRVYSDEHIHFSPLTKHAPKLGL-LKCKSAQSVTRLTIHGVDFNSASTGTH----NVYAILKDSRKSFRTKTLSGVKSIQWDEQFLFHKSKNRQQYKIEVW 593          
BLAST of Calpain 5a vs. Ensembl Celegans
Match: clp-6 (CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q9N4B2])

HSP 1 Score: 244.202 bits (622), Expect = 1.110e-70
Identity = 145/371 (39.08%), Postives = 202/371 (54.45%), Query Frame = 2
Query:   98 QEHQKNLT---LFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNF-------------NEITIIRPIKTGIFKYNSNWFGSMCKGYW---TGVAG 1153
            +E QK L    LF D  F A++ SI    K+   S I W RP+++  NP L + G S  DV QGSLGNCW ++A A LAQ  E   +V+P   DQ +  N    Y G+F    WRYGEW++VVIDDRLP+ NGKL+++ S+  +E W  L+EKAYAK+ G+YE L GG T E++ DFTGG+ E  +DL     + T+   +  ++    + GSL   +I     E E +LANGL+  HAYS+TGV  +            K  +  +R+RNPWG  EWNG  SD S  W  +  + +  M ++++ DGEFWM +DD +  F             +EIT +  I+  + K +  W      G W    G AG
Sbjct:  146 EERQKCLDENRLFEDPQFPANNSSIY--YKKPPKSHIVWLRPAKIFANPRLIVNGKSRFDVRQGSLGNCWFLAAAATLAQRDELFYRVVP--PDQSFTEN----YAGIFHFQFWRYGEWVDVVIDDRLPTVNGKLIYMSSQDGDECWGPLLEKAYAKLYGTYEHLDGGTTTEALEDFTGGLTE-FYDL-----TSTDKTMILAMIMKGMQMGSLFACSIDPDPREKEAQLANGLVRGHAYSVTGVHTVET---------DKEKVALLRIRNPWGDTEWNGDWSDKSSLWEQVDQEQREKMEFRIKEDGEFWMCLDDFMAQFANLDCCNLSADVMHEITEMTEIEV-MEKQSKQWIQKSADGEWCSRKGTAG 492          
BLAST of Calpain 5a vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 245.743 bits (626), Expect = 3.580e-70
Identity = 176/502 (35.06%), Postives = 253/502 (50.40%), Query Frame = 2
Query:   77 QNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCI-RLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRP-------IKTGIFKYNSNWFGSMCKGYWT--GVAGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARG------SEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGS---RSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTT 1498
            Q++  +R +  ++  LF D  F A+D S+  S +      +EW RP E+   P L   G S  DV QG LG+CWL++A A L    E   +V+P   DQ +  N    Y G+F    W+YG+W++VVIDDRLP+ NG+L+++HS   NEFWSAL+EKAYAK+ GSYE+L GG T E++ D TGG+ E I DLK   +      NL +++   ++ GSL   +I +  +  E K++NGL+  HAYSITG    RI   P       N   CI R+RNPWG ++EWNG  SD S EW S+    K  MG K ++DGEFWM  DD + NF ++ I  + P         TG+      W  +   G W     AG  ++ +       QF++++ +   D        +  +LQK  R           +G  +     NR   +    F   K   R       R +  R+R+  G Y+V P     +   +F    +LR YT 
Sbjct:  280 QDFYELRDQCLESKRLFEDPQFLANDSSLFFSKRPP--KRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVP--PDQSFTEN----YAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFI-DLKNPPR------NLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGC---RIVDGP-------NGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGNNRG-RLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEF----MLRVYTN 751          
BLAST of Calpain 5a vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 245.743 bits (626), Expect = 5.391e-70
Identity = 176/502 (35.06%), Postives = 253/502 (50.40%), Query Frame = 2
Query:   77 QNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCI-RLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRP-------IKTGIFKYNSNWFGSMCKGYW--TGVAGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARG------SEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGS---RSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTT 1498
            Q++  +R +  ++  LF D  F A+D S+  S +      +EW RP E+   P L   G S  DV QG LG+CWL++A A L    E   +V+P   DQ +  N    Y G+F    W+YG+W++VVIDDRLP+ NG+L+++HS   NEFWSAL+EKAYAK+ GSYE+L GG T E++ D TGG+ E I DLK   +      NL +++   ++ GSL   +I +  +  E K++NGL+  HAYSITG    RI   P       N   CI R+RNPWG ++EWNG  SD S EW S+    K  MG K ++DGEFWM  DD + NF ++ I  + P         TG+      W  +   G W     AG  ++ +       QF++++ +   D        +  +LQK  R           +G  +     NR   +    F   K   R       R +  R+R+  G Y+V P     +   +F    +LR YT 
Sbjct:  301 QDFYELRDQCLESKRLFEDPQFLANDSSLFFSKRPP--KRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVP--PDQSFTEN----YAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFI-DLKNPPR------NLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGC---RIVDGP-------NGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGNNRG-RLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEF----MLRVYTN 772          
BLAST of Calpain 5a vs. Ensembl Celegans
Match: clp-1 (Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P34308])

HSP 1 Score: 245.743 bits (626), Expect = 5.391e-70
Identity = 176/502 (35.06%), Postives = 253/502 (50.40%), Query Frame = 2
Query:   77 QNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCI-RLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRP-------IKTGIFKYNSNWFGSMCKGYW--TGVAGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARG------SEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGS---RSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTT 1498
            Q++  +R +  ++  LF D  F A+D S+  S +      +EW RP E+   P L   G S  DV QG LG+CWL++A A L    E   +V+P   DQ +  N    Y G+F    W+YG+W++VVIDDRLP+ NG+L+++HS   NEFWSAL+EKAYAK+ GSYE+L GG T E++ D TGG+ E I DLK   +      NL +++   ++ GSL   +I +  +  E K++NGL+  HAYSITG    RI   P       N   CI R+RNPWG ++EWNG  SD S EW S+    K  MG K ++DGEFWM  DD + NF ++ I  + P         TG+      W  +   G W     AG  ++ +       QF++++ +   D        +  +LQK  R           +G  +     NR   +    F   K   R       R +  R+R+  G Y+V P     +   +F    +LR YT 
Sbjct:  301 QDFYELRDQCLESKRLFEDPQFLANDSSLFFSKRPP--KRVEWLRPGEITREPQLITEGHSRFDVIQGELGDCWLLAAAANLTLKDELFYRVVP--PDQSFTEN----YAGIFHFQFWQYGKWVDVVIDDRLPTSNGELLYMHSASNNEFWSALLEKAYAKLFGSYEALKGGTTSEALEDMTGGLTEFI-DLKNPPR------NLMQMMMRGFEMGSLFGCSIEADPNVWEAKMSNGLVKGHAYSITGC---RIVDGP-------NGQTCILRIRNPWGNEQEWNGPWSDNSREWRSVPDSVKQDMGLKFDHDGEFWMSFDDFMRNFEKMEICNLGPDVMDEVYQMTGVKAAGMVWAANTHDGAWVRNQTAGGCRNYINTFANNPQFRVQLTDSDPDDDDELCTVIFAVLQKYRRNLKQDGLDNVPIGFAVYDAGNNRG-RLSKQFFAANKSAMRSAAFINLREMTGRFRVPPGNYVVVPSTFEPNEEAEF----MLRVYTN 772          
BLAST of Calpain 5a vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086530)

HSP 1 Score: 266.159 bits (679), Expect = 2.311e-79
Identity = 181/505 (35.84%), Postives = 268/505 (53.07%), Query Frame = 2
Query:   77 QNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRPIKTGIFKYNSN---WFGSMCKGYWT-GV-AGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARGSEA------ALGILIIAVERNRDFMVHTPKFCN-VKLEYRLGGS------RSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNN 1510
            Q+Y ++      + +LF D  F A ++S+  S + +    IEW RP E+  NP  F+ G S  DV QG LG+CWL++A A L Q      +VIP   +Q +  N    Y G+F    W+YG+W++V+IDDRLP+ NG+L+++HS  KNEFWSAL+EKAYAK+ GSYE+L GG TCE+M DFTGG+ E  +DLK+         NLF +L    +  S+M  +I    +  E +   GLI  HAYSIT VC + I  TP     ++  +  IR+RNPWG + EWNG  SD+S EW  I  + K  +G   + DGEFWM   D L +F+ + I  + P      + NS    W  SM +G WT GV AG  ++ L       Q+ I + +P  +        +  L+QK  R           +G  I ++  N   + + P+  N  + +  +G S      R +C R++L  G Y++ P     +   +F    ++R ++  +NN
Sbjct:   73 QDYETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPA--EQSFEEN----YAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSE-WYDLKEAPG------NLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDI-VTPN----RQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSL--NDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEF----IIRVFSETQNN 551          
BLAST of Calpain 5a vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0112869)

HSP 1 Score: 265.774 bits (678), Expect = 8.358e-77
Identity = 181/505 (35.84%), Postives = 268/505 (53.07%), Query Frame = 2
Query:   77 QNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRPIKTGIFKYNSN---WFGSMCKGYWT-GV-AGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARGSEA------ALGILIIAVERNRDFMVHTPKFCN-VKLEYRLGGS------RSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNN 1510
            Q+Y ++      + +LF D  F A ++S+  S + +    IEW RP E+  NP  F+ G S  DV QG LG+CWL++A A L Q      +VIP   +Q +  N    Y G+F    W+YG+W++V+IDDRLP+ NG+L+++HS  KNEFWSAL+EKAYAK+ GSYE+L GG TCE+M DFTGG+ E  +DLK+         NLF +L    +  S+M  +I    +  E +   GLI  HAYSIT VC + I  TP     ++  +  IR+RNPWG + EWNG  SD+S EW  I  + K  +G   + DGEFWM   D L +F+ + I  + P      + NS    W  SM +G WT GV AG  ++ L       Q+ I + +P  +        +  L+QK  R           +G  I ++  N   + + P+  N  + +  +G S      R +C R++L  G Y++ P     +   +F    ++R ++  +NN
Sbjct:   73 QDYETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPA--EQSFEEN----YAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSE-WYDLKEAPG------NLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDI-VTP----NRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSL--NDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEF----IIRVFSETQNN 551          
BLAST of Calpain 5a vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0086529)

HSP 1 Score: 265.774 bits (678), Expect = 8.358e-77
Identity = 181/505 (35.84%), Postives = 268/505 (53.07%), Query Frame = 2
Query:   77 QNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRPIKTGIFKYNSN---WFGSMCKGYWT-GV-AGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARGSEA------ALGILIIAVERNRDFMVHTPKFCN-VKLEYRLGGS------RSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNN 1510
            Q+Y ++      + +LF D  F A ++S+  S + +    IEW RP E+  NP  F+ G S  DV QG LG+CWL++A A L Q      +VIP   +Q +  N    Y G+F    W+YG+W++V+IDDRLP+ NG+L+++HS  KNEFWSAL+EKAYAK+ GSYE+L GG TCE+M DFTGG+ E  +DLK+         NLF +L    +  S+M  +I    +  E +   GLI  HAYSIT VC + I  TP     ++  +  IR+RNPWG + EWNG  SD+S EW  I  + K  +G   + DGEFWM   D L +F+ + I  + P      + NS    W  SM +G WT GV AG  ++ L       Q+ I + +P  +        +  L+QK  R           +G  I ++  N   + + P+  N  + +  +G S      R +C R++L  G Y++ P     +   +F    ++R ++  +NN
Sbjct:   73 QDYETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPA--EQSFEEN----YAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSE-WYDLKEAPG------NLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDI-VTP----NRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSL--NDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEF----IIRVFSETQNN 551          
BLAST of Calpain 5a vs. Ensembl Fly
Match: CalpA (gene:FBgn0012051 transcript:FBtr0340532)

HSP 1 Score: 265.774 bits (678), Expect = 1.085e-76
Identity = 181/505 (35.84%), Postives = 268/505 (53.07%), Query Frame = 2
Query:   77 QNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRPIKTGIFKYNSN---WFGSMCKGYWT-GV-AGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARGSEA------ALGILIIAVERNRDFMVHTPKFCN-VKLEYRLGGS------RSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNN 1510
            Q+Y ++      + +LF D  F A ++S+  S + +    IEW RP E+  NP  F+ G S  DV QG LG+CWL++A A L Q      +VIP   +Q +  N    Y G+F    W+YG+W++V+IDDRLP+ NG+L+++HS  KNEFWSAL+EKAYAK+ GSYE+L GG TCE+M DFTGG+ E  +DLK+         NLF +L    +  S+M  +I    +  E +   GLI  HAYSIT VC + I  TP     ++  +  IR+RNPWG + EWNG  SD+S EW  I  + K  +G   + DGEFWM   D L +F+ + I  + P      + NS    W  SM +G WT GV AG  ++ L       Q+ I + +P  +        +  L+QK  R           +G  I ++  N   + + P+  N  + +  +G S      R +C R++L  G Y++ P     +   +F    ++R ++  +NN
Sbjct:   88 QDYETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPA--EQSFEEN----YAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSE-WYDLKEAPG------NLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDI-VTP----NRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSL--NDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEF----IIRVFSETQNN 566          
BLAST of Calpain 5a vs. Ensembl Fly
Match: CalpB (gene:FBgn0025866 transcript:FBtr0076343)

HSP 1 Score: 266.544 bits (680), Expect = 1.538e-76
Identity = 182/505 (36.04%), Postives = 269/505 (53.27%), Query Frame = 2
Query:   80 NYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRPIKTGIFKYNSN---WFGSMCKGYWTG--VAGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARGSEAALGILIIAVE------RNRDFMVHTPKFCNVKLEYRLGGSRS--------ICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNN 1510
            ++ S+R     N T+F D  F A + S+  S + +     EW RP ++  +P  F+ G S  DV QG LG+CWL++A A L Q      +VIP   DQ++  N    Y G+F    W+YG+W+EVVIDDRLP+ NG+L+++HS  KNEFWSAL+EKAYAK+ GSYE+L GG TCE+M DFTGG+ E  +D+K+         NLF ++    + GS+M  ++      +E +   GLI  HAYSIT VC + I STP     ++  L  IR+RNPWG   EW+G  SD+S EW  I    K  +G   + DGEFWM   D L +F+ + I  + P      + +S+   W  SM +G WT    AG  ++ L       Q+ I + +P  +        +  L+QK  R S+  +GI  + +        +RD  V  P+  N   +YR   +RS        +C R++L  G Y++ P     +   +F    ++R ++  +NN
Sbjct:  245 DFQSLRDSCLANGTMFEDPDFPATNASLMYSRRPDRY--YEWLRPGDIADDPQFFVEGYSRFDVQQGELGDCWLLAAAANLTQDSTLFFRVIP--PDQDFQEN----YAGIFHFKFWQYGKWVEVVIDDRLPTYNGELIYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGTTCEAMEDFTGGVTE-WYDIKEAPP------NLFSIMMKAAERGSMMGCSLEPDPHVLEAETPQGLIRGHAYSITKVCLMDI-STPN----RQGKLPMIRMRNPWGNDAEWSGPWSDSSPEWRFIPEHTKEEIGLNFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQHSSRRKWEMSMFEGEWTSGVTAGGCRNFLETFWHNPQYIISLEDPDDEDDDGKCTAIVALMQKNRR-SKRNVGIDCLTIGFAIYHLTDRDMQVK-PQGLNF-FKYRASVARSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEF----IIRVFSETRNN 722          
BLAST of Calpain 5a vs. Ensembl Zebrafish
Match: capn5a (calpain 5a [Source:ZFIN;Acc:ZDB-GENE-061103-214])

HSP 1 Score: 360.918 bits (925), Expect = 3.486e-114
Identity = 213/606 (35.15%), Postives = 343/606 (56.60%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLK-KYSKSDTEMENLF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKC---ARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPS---EMPILERNCICKSNC---TIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            F  Q + ++R++ Q+N TLF D  F A+D+S+   G +  L  + WKRP +LC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  DQEW  N+P SY G+F    WR+G+W++VVIDDRLP+ NGKL++ HS   NEFWSAL+EKAYAK+CG YE+L GG T +++VDFTGG+ E +  L+ K+++ +     LF ++L    + G + C+  A+   +ME +L  GL+  HAY++T V K+R+ S  +   ++   L  IR+RNPWGQ+EWNG+ SD+SEEW  +S  ++  +G  VE+DGEFWM  DD   +F ++ + R I T     +  W   + +G W+         +G   +      Q  Q+  ++   + ++ +C   Q     A+G   A+G  I  VE NR + +H+       ++  +G      SRS+ LR  L  G Y++ P  +   P +  P  +LLR +T        +PS   E+ + E    C ++C     ++ ++H+I+AD ++A +     + +  I CE + + + V+ +T    +D   + +R K  +PI I+I+++    ++ +G
Sbjct:    8 FEGQEFSALRKQCQQNHTLFEDPVFRAEDQSLFLQGNR--LGKVTWKRPKDLCEDPHLFVNGISAHDLNQGQLGNCWFVAACSSLASREALWQKVIPDWKDQEWDKNKPESYAGIFHFRFWRFGDWVDVVIDDRLPTANGKLIYCHSNDSNEFWSALVEKAYAKMCGCYEALDGGNTADALVDFTGGVSEPMDLLEGKFAQDEEARHQLFDRVLKVHNRGGLISCSIRATTQADMEARLDCGLVKGHAYAVTDVRKVRLGSG-LLAFFKSEKLSMIRMRNPWGQREWNGAWSDSSEEWKRVSKGERERLGVTVEDDGEFWMDFDDFCKHFTDLILCRLINTSYLSIHKTWEEEVMRGCWSRHDDPLRNRSGGCINHKTTFLQNPQYVFDVTKAEDEVLICLQQQDKRARAKGENMAIGFDIQRVELNRIYRMHS-------IQKSVGSSIYINSRSVFLRKDLKEGRYVIVP--STFDPGM--PGDFLLRIFTD-------VPSDCKELTVDEPPQTCWTSCCGYPKLVTQVHVIRADGLKALDGDGSSDPYIIISCEGEKVCSPVHKDTQSPDFDVKAVFYRKKPKQPIRIQIYNKNLLSDSFMG 592          
BLAST of Calpain 5a vs. Ensembl Zebrafish
Match: capn5a (calpain 5a [Source:ZFIN;Acc:ZDB-GENE-061103-214])

HSP 1 Score: 360.918 bits (925), Expect = 3.486e-114
Identity = 213/606 (35.15%), Postives = 343/606 (56.60%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLK-KYSKSDTEMENLF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKC---ARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPS---EMPILERNCICKSNC---TIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            F  Q + ++R++ Q+N TLF D  F A+D+S+   G +  L  + WKRP +LC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  DQEW  N+P SY G+F    WR+G+W++VVIDDRLP+ NGKL++ HS   NEFWSAL+EKAYAK+CG YE+L GG T +++VDFTGG+ E +  L+ K+++ +     LF ++L    + G + C+  A+   +ME +L  GL+  HAY++T V K+R+ S  +   ++   L  IR+RNPWGQ+EWNG+ SD+SEEW  +S  ++  +G  VE+DGEFWM  DD   +F ++ + R I T     +  W   + +G W+         +G   +      Q  Q+  ++   + ++ +C   Q     A+G   A+G  I  VE NR + +H+       ++  +G      SRS+ LR  L  G Y++ P  +   P +  P  +LLR +T        +PS   E+ + E    C ++C     ++ ++H+I+AD ++A +     + +  I CE + + + V+ +T    +D   + +R K  +PI I+I+++    ++ +G
Sbjct:    8 FEGQEFSALRKQCQQNHTLFEDPVFRAEDQSLFLQGNR--LGKVTWKRPKDLCEDPHLFVNGISAHDLNQGQLGNCWFVAACSSLASREALWQKVIPDWKDQEWDKNKPESYAGIFHFRFWRFGDWVDVVIDDRLPTANGKLIYCHSNDSNEFWSALVEKAYAKMCGCYEALDGGNTADALVDFTGGVSEPMDLLEGKFAQDEEARHQLFDRVLKVHNRGGLISCSIRATTQADMEARLDCGLVKGHAYAVTDVRKVRLGSG-LLAFFKSEKLSMIRMRNPWGQREWNGAWSDSSEEWKRVSKGERERLGVTVEDDGEFWMDFDDFCKHFTDLILCRLINTSYLSIHKTWEEEVMRGCWSRHDDPLRNRSGGCINHKTTFLQNPQYVFDVTKAEDEVLICLQQQDKRARAKGENMAIGFDIQRVELNRIYRMHS-------IQKSVGSSIYINSRSVFLRKDLKEGRYVIVP--STFDPGM--PGDFLLRIFTD-------VPSDCKELTVDEPPQTCWTSCCGYPKLVTQVHVIRADGLKALDGDGSSDPYIIISCEGEKVCSPVHKDTQSPDFDVKAVFYRKKPKQPIRIQIYNKNLLSDSFMG 592          
BLAST of Calpain 5a vs. Ensembl Zebrafish
Match: capn5a (calpain 5a [Source:ZFIN;Acc:ZDB-GENE-061103-214])

HSP 1 Score: 345.51 bits (885), Expect = 1.432e-109
Identity = 191/507 (37.67%), Postives = 292/507 (57.59%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLK-KYSKSDTEMENLF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKC---ARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMP 1537
            F  Q + ++R++ Q+N TLF D  F A+D+S+   G +  L  + WKRP +LC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  DQEW  N+P SY G+F    WR+G+W++VVIDDRLP+ NGKL++ HS   NEFWSAL+EKAYAK+CG YE+L GG T +++VDFTGG+ E +  L+ K+++ +     LF ++L    + G + C+  A+   +ME +L  GL+  HAY++T V K+R+ S  +   ++   L  IR+RNPWGQ+EWNG+ SD+SEEW  +S  ++  +G  VE+DGEFWM  DD   +F ++ + R I T     +  W   + +G W+         +G   +      Q  Q+  ++   + ++ +C   Q     A+G   A+G  I  VE NR + +H+       ++  +G      SRS+ LR  L  G Y++ P  +   P +  P  +LLR +T   ++   L  + P
Sbjct:    8 FEGQEFSALRKQCQQNHTLFEDPVFRAEDQSLFLQGNR--LGKVTWKRPKDLCEDPHLFVNGISAHDLNQGQLGNCWFVAACSSLASREALWQKVIPDWKDQEWDKNKPESYAGIFHFRFWRFGDWVDVVIDDRLPTANGKLIYCHSNDSNEFWSALVEKAYAKMCGCYEALDGGNTADALVDFTGGVSEPMDLLEGKFAQDEEARHQLFDRVLKVHNRGGLISCSIRATTQADMEARLDCGLVKGHAYAVTDVRKVRLGSG-LLAFFKSEKLSMIRMRNPWGQREWNGAWSDSSEEWKRVSKGERERLGVTVEDDGEFWMDFDDFCKHFTDLILCRLINTSYLSIHKTWEEEVMRGCWSRHDDPLRNRSGGCINHKTTFLQNPQYVFDVTKAEDEVLICLQQQDKRARAKGENMAIGFDIQRVELNRIYRMHS-------IQKSVGSSIYINSRSVFLRKDLKEGRYVIVP--STFDPGM--PGDFLLRIFTDVPSDCKELTVDEP 500          
BLAST of Calpain 5a vs. Ensembl Zebrafish
Match: capn5b (calpain 5b [Source:ZFIN;Acc:ZDB-GENE-091116-29])

HSP 1 Score: 327.02 bits (837), Expect = 3.102e-101
Identity = 202/607 (33.28%), Postives = 330/607 (54.37%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLK-KYSKSDTEMENLF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYW-------TGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCAR-------GSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNC---ICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            F  Q+Y +++++  ++  LF D  F A D S+   G +  +  + WKRP ELC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  +QEW   +  SY G+F    WR+GEW++VVIDDRLP+ + +LV+ HS   NEFWSAL+EKAYAKV G YE+L GG T +++VDFTGG+ E +  L+ ++++ +T    LF ++L    +DG + C+  A+  ++ME +L  GL+  HAY++T V K+R+    +  +++   L  IR+RNPWG+KEW+G  SD+SEEW  +S  ++  +G  V++DGEFWM  +D    F ++ + R I T     +  W   + +G W          AG   +      Q  Q+  ++   + ++ +C L QK  R       G   A+G  I  VE NR + +H+        + ++ G     SR + LR  L  G Y++ P  T   P  +    +LLR +T   ++   L  + P   + C   +C      ++ ++H++ A+ +Q  +     + +  I CE + +R+ V+ +T    +D   + +R K    I I+I+++    +T +G
Sbjct:    8 FEGQHYSTLKRQCLQSGALFEDPLFPAVDDSLFYQGNR--IGRVHWKRPEELCDDPHLFVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKADSYAGIFHFRFWRFGEWVDVVIDDRLPTVDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPMDLLEGQFAQDETARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVRKVRL-GHGLLAYFKSEKLHMIRMRNPWGEKEWSGPWSDSSEEWKKVSKSEREKLGVTVQDDGEFWMNFEDFCHYFTDLILCRLINTSYLSIHKTWEEEVMRGLWLHRDEPLRNRAGGCINHKTTFLQNPQYVFDVRKVEDEVLIC-LQQKERRATPKEGKGENLAIGFDIHRVELNRKYRMHSA-------QQKVAGSIYINSRCVFLRKELKEGRYVIIP--TTFDPGQQGE--FLLRVFTDVPSDCKELTLDEP--PQTCWTGMC--GYPQLVTQVHVLSAEGLQGQDANGASDPYVIITCEGEKVRSPVHKDTRCPNFDIKGIFYRKKPKEGIHIEIYNKNVIVDTFLG 595          
BLAST of Calpain 5a vs. Ensembl Zebrafish
Match: BX324225.2 (calpain 5b [Source:NCBI gene;Acc:100006332])

HSP 1 Score: 320.087 bits (819), Expect = 1.404e-98
Identity = 196/594 (33.00%), Postives = 321/594 (54.04%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLK-KYSKSDTEMENLF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYW-------TGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNC---ICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKI 1780
            F  Q+Y +++++  ++  LF D  F A D S+   G +  +  + WKRP ELC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  +QEW   +  SY G+F    WR+GEW++VVIDDRLP+ + +LV+ HS   NEFWSAL+EKAYAKV G YE+L GG T +++VDFTGG+ E +  L+ ++++ +T    LF ++L    +DG + C+  A+  ++ME +L  GL+  HAY++T V K+R+    +  +++   L  IR+RNPWG+KEW+G  SD+SEEW  +S  ++  +G  V++DGEFWM  +D    F ++ + R I T     +  W   + +G W          AG   +      Q  Q+  ++   + ++ +C          K  +G   A+G  I  VE NR + +H+        + ++ G     SR + LR  L  G Y++ P  T   P  +    +LLR +T   ++   L  + P   + C   +C      ++ ++H++ A+ +Q  +     + +  I CE + +R+ V+ +T    +D   + +R K    I I++
Sbjct:    8 FEGQHYSTLKRQCLQSGALFEDPLFPAVDDSLFYQGNR--IGRVHWKRPEELCDDPHLFVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKADSYAGIFHFRFWRFGEWVDVVIDDRLPTVDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPMDLLEGQFAQDETARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVRKVRLGHG-LLAYFKSEKLHMIRMRNPWGEKEWSGPWSDSSEEWKKVSKSEREKLGVTVQDDGEFWMNFEDFCHYFTDLILCRLINTSYLSIHKTWEEEVMRGLWLHRDEPLRNRAGGCINHKTTFLQNPQYVFDVRKVEDEVLICLQQKERRATPKEGKGENLAIGFDIHRVELNRKYRMHSA-------QQKVAGSIYINSRCVFLRKELKEGRYVIIP--TTFDPGQQGE--FLLRVFTDVPSDCKELTLDEP--PQTCWTGMC--GYPQLVTQVHVLSAEGLQGQDANGASDPYVIITCEGEKVRSPVHKDTRCPNFDIKGIFYRKKPKEGIHIEV 583          
BLAST of Calpain 5a vs. Ensembl Xenopus
Match: ppa2 (pyrophosphatase (inorganic) 2 [Source:Xenbase;Acc:XB-GENE-961143])

HSP 1 Score: 312.383 bits (799), Expect = 2.110e-96
Identity = 189/505 (37.43%), Postives = 267/505 (52.87%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLM-CATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYW---TGVAGDRQSAL---AEIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMP 1537
               QNY  +++E  KN  LF D  F A D+S+  S   ++   IEWKRP ELC +P LF+ G S HD+ QG LGNCW V+A + LA       KVI N   QEW   RPH Y G+F    W  G+W++VVIDDRLPS +G LV+ HS VKNEFWSAL+EKAYAK+ GSYE+L GG T +++VDFTG + E  F+L K  Y  S  E   LF+ L   ++ G L+ C      S++ME   + GL+  HAYS+T + K+ +    +      N L  IR+RNPWG++EW G+ SD SEEW+ +S  +K  +G  V +DGEFWM  +D  ++F    + R + T        W      G W   T    +R           Q  Q+  E+   + ++ +        + +K  +G+   +G  I  VE NR++ +H        L       R+I LR  LT G Y++ P  T   P +     ++LR +T + +    L  + P
Sbjct:    8 LKTQNYHELKKECIKNGKLFEDPEFPASDESLFYSKAPDL--RIEWKRPKELCEDPHLFVDGISSHDLHQGRLGNCWFVAACSCLALKKALWTKVISNWKKQEWDPKRPHRYAGIFHFKFWCLGDWVDVVIDDRLPSVDGNLVYCHSNVKNEFWSALLEKAYAKLAGSYEALDGGNTADAIVDFTGAVTES-FELDKGDYRTSLMEQTKLFQELLKVYRAGGLISCYIKPVSSNDMEAVTSYGLVKGHAYSVTAIKKMPVGQRILC-FGNSNKLFMIRMRNPWGKREWKGAWSDESEEWNKVSRSEKATLGLTVADDGEFWMTFEDWCLSFTHADVCRILNTSYLSCYKTWKQEEVHGAWSKNTDPLLNRSGGCFNETTFFQNPQYIFEVRKKEDEVLISLQQKDQRIHKKDGKGNNFIIGFEIFKVELNREYRIHKISGQEKTLRSSYINLRAIFLRKVLTHGRYVIIP--TTFHPGISSS--FILRLFTDESSRFRELLLDKP 504          
BLAST of Calpain 5a vs. Ensembl Xenopus
Match: ENSXETT00000037551.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV460378.1:547358:568026:1 gene:ENSXETG00000014732.1 transcript:ENSXETT00000037551.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 294.278 bits (752), Expect = 4.513e-89
Identity = 190/523 (36.33%), Postives = 270/523 (51.63%), Query Frame = 2
Query:   41 MDFSRNFVF-FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGS-SVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWH--GNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDE-MEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFK-------------------YNSNWFGSMCKGYWTGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMP 1537
            M FS   V  + +QNY  ++   ++   LF D  F AD +S+  S  +     +EWKRP EL  NP LF  G  S HD+ QGSLGNCW V+A A LA  P   K+VIP+  +Q+W   G  PH+  G+FR  LWR+G W+E+VIDDRLP+  G+L+F     +  FW AL+EKAYAK+ GSYE+L GG T E+++DF+GGI E I  L +   S+ E + LFK L       SL+ A I   S + +E+ LA+GL+  HAYS+T V  + ++S  +   ++ + L  +RL+NPWG  EWNG+ SD SEEW  IS  ++  MG  V +DG+FWM   D   +F ++T+ R + T                       Y      ++   +   V  D+  AL  + Q  +                  Q+   G    +G  +  VE NR F +H          Y    SRS+ LR  L  G Y++ P  T  SP L     +LLR YT + ++   L  ++P
Sbjct:    1 MFFSTKMVVSYRDQNYGRLKDGCRQEGRLFEDPAFPADSRSLYYS--RTPPEGVEWKRPQELVQNPRLFAEGGISTHDLHQGSLGNCWFVAAAACLAGDPSVWKRVIPSPKEQDWPRPGAPPHA--GIFRFRLWRFGSWIEIVIDDRLPTVRGELLFCRPGQRGAFWCALLEKAYAKLNGSYEALDGGSTAEALIDFSGGISEPIDLLGENFTSEEERKKLFKALLKAHSRASLISAAIRPTSGQSLEQVLASGLVIGHAYSVTSVRSITLRSG-LLSLFRTHKLRLVRLQNPWGSGEWNGAWSDGSEEWKRISRAEREKMGVTVSDDGDFWMSWGDFCTHFTDLTLCRRVNTSTHYTLTCPRAPIILLPAPIPTLYLPAPIPTLYLPFSFDVTLDQDVALISVEQEDR----------------RTQRSEGGENLPIGFFVFKVEVNRKFRLHRTATKVSSSTYI--NSRSVFLRTELQRGRYVILP--TTFSPGLIG--SFLLRLYTDRASHLRELTRDIP 496          
BLAST of Calpain 5a vs. Ensembl Xenopus
Match: ppa2 (pyrophosphatase (inorganic) 2 [Source:Xenbase;Acc:XB-GENE-961143])

HSP 1 Score: 271.937 bits (694), Expect = 1.245e-80
Identity = 191/594 (32.15%), Postives = 284/594 (47.81%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLM-CATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALAEIG---------QGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIIC----RLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIF 1783
               QNY  +++E  KN  LF D  F A D+S+  S   ++   IEWKRP ELC +P LF+ G S HD+ QG LGNCW V+A + LA       KVI N   QEW   RPH Y G+F    W  G+W++VVIDDRLPS +G LV+ HS VKNEFWSAL+EKAYAK+ GSYE+L GG T +++VDFTG + E  F+L K  Y  S  E   LF+ L   ++ G L+ C      S++ME   + GL+  HAYS+T + K+                       P GQ+     L      W+ +S  +K  +G  V +DGEFWM  +D  ++F    + R + T        W      G W+    +    L   G         Q  Q+  E+   + ++ +        + +K  +G+   +G  I  VE NR++ +H        L       R+I LR  LT G Y++ P  T   P +     ++LR +T + +    L  + P        K +C  ++C    R+  +    ++       + +   I  E +++R+ V   TS   +D   +  R  +  PI I+++
Sbjct:    8 LKTQNYHELKKECIKNGKLFEDPEFPASDESLFYSKAPDL--RIEWKRPKELCEDPHLFVDGISSHDLHQGRLGNCWFVAACSCLALKKALWTKVISNWKKQEWDPKRPHRYAGIFHFKFWCLGDWVDVVIDDRLPSVDGNLVYCHSNVKNEFWSALLEKAYAKLAGSYEALDGGNTADAIVDFTGAVTES-FELDKGDYRTSLMEQTKLFQELLKVYRAGGLISCYIKPVSSNDMEAVTSYGLVKGHAYSVTAIKKM-----------------------PVGQR----ILCFGMTSWNKVSRSEKATLGLTVADDGEFWMTFEDWCLSFTHADVCRILNTSYLSCYKTWKQEEVHGAWS---KNTDPLLNRSGGCFNETTFFQNPQYIFEVRKKEDEVLISLQQKDQRIHKKDGKGNNFIIGFEIFKVELNREYRIHKISGQEKTLRSSYINLRAIFLRKVLTHGRYVIIP--TTFHPGISSS--FILRLFTDESSRFRELLLDKP--------KVSCWSLLCGYPQRVTQVLVRHVEGVGRQGQIQLHV-IKGEKKTIRSLVYKKTSTAKFDIQAIFFRKNISEPICIQVW 555          
BLAST of Calpain 5a vs. Ensembl Xenopus
Match: CAPN3 (calpain 3 [Source:NCBI gene;Acc:100497532])

HSP 1 Score: 269.626 bits (688), Expect = 2.307e-79
Identity = 168/508 (33.07%), Postives = 271/508 (53.35%), Query Frame = 2
Query:   62 VFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISP---SGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSD-EMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSN-WFGSMCKGYWTG--VAGDRQSALAEIGQGGQFKIEI----NNPKGDIFLCH----LLQKCARGSEAA------LGILIIAVERN-----RDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKN 1507
            V F NQ++ +++ E      LF D  F    +S+     + K   L +I WKRP E+C NP   + G++  D+CQG LG+CW ++A+A L  + + L +VIP   DQ +  N    Y G+F    WRYG+W++V+IDD LP+ N +LVF  S  +NEFWSAL+EKAYAK+ GSYE+L GG T E+M DFTGG+ E  ++LK+  K      +++ ++   ++ GSL+  +I +    ++E ++ANGL+  HAYS+TGV + ++K  P         +  +RLRNPWGQ EWNG+  D ++EW  +   +K  +  +V+ DGEFWM  DD + NF +  I       +   +   W  S+ +G W     AG  ++         Q+++++    ++P  +  +C     L+QK  R    A      +G  I  +  N     +DF ++       K    +   R +C R+RL    Y++ P  +   P  +    ++LR ++ ++N
Sbjct:   30 VKFENQDFATLKSEFVGKKKLFEDPIFLPAVQSLGQKEFAQKSTKLKNIIWKRPKEICENPQFILGGANRTDICQGDLGDCWFLAAIACLTLNEKVLFRVIP--PDQNFTDN----YAGIFHFQFWRYGDWVDVIIDDYLPTYNNELVFTKSSQRNEFWSALLEKAYAKLHGSYEALKGGNTTEAMEDFTGGVTE-FYELKEAPK------DMYNIMKKAFERGSLIGCSIDTLVPVQLETRMANGLVKGHAYSVTGVEETKLKGKP---------IKLVRLRNPWGQVEWNGAWGDNAKEWTMVDKSEKTRLQHQVQEDGEFWMSYDDFMKNFTKAEICNLTPDALDSDSLQVWTVSVNEGRWVRGCSAGGCRNYPDTYWTNPQYRLKLLEEDDDPADNEVVCSFVVALMQKNRRKDRKAGANLFTIGFAIYEMHGNNQHLQKDFFLYNASKAKCKSYINM---REVCQRFRLPPSEYVIIP--STYEPHQEGE--FILRVFSEKRN 508          
BLAST of Calpain 5a vs. Ensembl Xenopus
Match: icmt (isoprenylcysteine carboxyl methyltransferase [Source:Xenbase;Acc:XB-GENE-976857])

HSP 1 Score: 262.692 bits (670), Expect = 6.989e-78
Identity = 171/540 (31.67%), Postives = 280/540 (51.85%), Query Frame = 2
Query:  329 HPECLK--KVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMEN-LF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSA-------LAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSEA-------ALGILIIAVERNRDFMVHT--PKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPS---EMPILERNCICKSNC---TIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIE 1870
            HP  L    VIP+  +QEW+ ++P  Y G+F    W++GEW++VVIDDRLP+ N +L++ HS  KNE W AL+EKAYAK+ G YE+L GG T +++VDFTGG+ E I   + +  +D E  N LF ++L    + G + C+  A+ + +ME ++A GL+  HAY++T V K+R+    +   ++   L  IR+RNPWG++EWNG  SD+SEEW  +S  ++  +G  VE+DGEFWM  +D    + +I + R I T     +  W  ++ +  W       Q+         A   Q  QF  ++  P+ ++ +C L QK  R +         A+G  I  VE NR F +HT  PK  +         SR + LR  L  G Y++ P  T   P       +LLR +T        LPS   E+ + E    C S       ++ ++H++ A  ++  +     + +  I CE   +++ V  +     ++   + +R K  +PI++++++     +  +G    S D+ +L +   +E
Sbjct:    4 HPIALSFIVVIPDWKEQEWYADKPQIYAGIFHFHFWKFGEWVDVVIDDRLPTINNQLIYCHSNEKNELWCALVEKAYAKLAGCYEALDGGNTADALVDFTGGVSEPIELTEGHFVTDVEKRNDLFERVLKVHNRGGLISCSIRATSASDMEARMACGLVKGHAYAVTDVRKVRL-GHGLLAFFKSEKLEMIRMRNPWGEREWNGPWSDSSEEWQKVSKSEREKLGVTVEDDGEFWMTFEDFCKYYTDIIMCRLINTSYLSIHKTWEEAVLRSSWVQHQDPLQNRSGGCLNFKATYLQNPQFVFDVKKPEDEVLVC-LQQKTKRTTRQEGKAENLAIGFEIHQVELNRRFRMHTLQPKVASSIYI----NSRCVFLRTDLKEGRYVIIP--TTFDPGHTGE--FLLRVFTD-------LPSNCCELKLDEPTKTCWSGLCGYPQLVSQVHVVSAQGLKQQDSNGGADPYVIISCEGNKVQSPVIKDCLDPKFNVKGVFYRKKPGQPIVVQVWNHNVIKDEFMGLVDLSGDANNLQTQHSLE 526          
BLAST of Calpain 5a vs. Ensembl Mouse
Match: Capn5 (calpain 5 [Source:MGI Symbol;Acc:MGI:1100859])

HSP 1 Score: 328.561 bits (841), Expect = 8.812e-102
Identity = 196/599 (32.72%), Postives = 311/599 (51.92%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLMCATI-ASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALA-------EIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            + +QNY ++++   +   LF D  F A D S+   G      ++ WKRP ++C +P LF+ G S HD+ QG +GNCW V+A + LA      +KVIP+  +QEW+  +P SY G+F    WR+GEW++V++DDRLP+ N +L++ HS  KNEFW AL+EKAYAK+ G Y++L GG T +++VDFTGG+ E I DL +   +  + +   LF+ +      G L+ A+I A  + +ME +LA GL+  HAY++T V K+R+    +   ++   L  IRLRNPWG++EW G  SD SEEW  +S  ++  MG  V++DGEFWM  +D+   F +I   R I T     +  W  +   G WT     +Q+             Q  Q+  E+  P+ ++ +          ++  +G   A+G  I  VE NR + +H+ +       Y    SRS+ LR  L  G Y++ P       + +F    LLR +T   +N   L  + P   R C   S C        +         +     N +  I CE + +R+ V   TS   ++   + +R K+ +PI +++++     +  +G
Sbjct:    8 YEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTPG--PTVRWKRPKDICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNNQLIYCHSNSKNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI-DLTEGDLATDEAKRNQLFERVLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLDMIRLRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLINTSYLSIHKTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPEDEVLISIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYI--NSRSVFLRTELPEGRYVIIPTTFEPGHTGEF----LLRVFTDVPSNCRELRLDEP--PRTC-WSSLCGYPQQVAQVHVLGAAGLKDSPTGANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQPITVQVWNHRVLKDEFLG 593          
BLAST of Calpain 5a vs. Ensembl Mouse
Match: Capn5 (calpain 5 [Source:MGI Symbol;Acc:MGI:1100859])

HSP 1 Score: 328.561 bits (841), Expect = 8.812e-102
Identity = 196/599 (32.72%), Postives = 311/599 (51.92%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLMCATI-ASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALA-------EIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            + +QNY ++++   +   LF D  F A D S+   G      ++ WKRP ++C +P LF+ G S HD+ QG +GNCW V+A + LA      +KVIP+  +QEW+  +P SY G+F    WR+GEW++V++DDRLP+ N +L++ HS  KNEFW AL+EKAYAK+ G Y++L GG T +++VDFTGG+ E I DL +   +  + +   LF+ +      G L+ A+I A  + +ME +LA GL+  HAY++T V K+R+    +   ++   L  IRLRNPWG++EW G  SD SEEW  +S  ++  MG  V++DGEFWM  +D+   F +I   R I T     +  W  +   G WT     +Q+             Q  Q+  E+  P+ ++ +          ++  +G   A+G  I  VE NR + +H+ +       Y    SRS+ LR  L  G Y++ P       + +F    LLR +T   +N   L  + P   R C   S C        +         +     N +  I CE + +R+ V   TS   ++   + +R K+ +PI +++++     +  +G
Sbjct:    8 YEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTPG--PTVRWKRPKDICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNNQLIYCHSNSKNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI-DLTEGDLATDEAKRNQLFERVLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLDMIRLRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLINTSYLSIHKTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPEDEVLISIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYI--NSRSVFLRTELPEGRYVIIPTTFEPGHTGEF----LLRVFTDVPSNCRELRLDEP--PRTC-WSSLCGYPQQVAQVHVLGAAGLKDSPTGANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQPITVQVWNHRVLKDEFLG 593          
BLAST of Calpain 5a vs. Ensembl Mouse
Match: Capn6 (calpain 6 [Source:MGI Symbol;Acc:MGI:1100850])

HSP 1 Score: 256.144 bits (653), Expect = 1.044e-74
Identity = 167/516 (32.36%), Postives = 259/516 (50.19%), Query Frame = 2
Query:   65 FFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLAN-GLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-----------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGS-----RSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMP 1537
             F NQ Y  ++QE  K+  LFCD TF  ++ S+  +  + +   + WKRP ++  +P L +   S H + QG LGN  ++SA + LA       K IPN  DQEW   +P  Y G+F    W +GEW EVVIDD LP+ NG LVF  S   NEFW+AL+EKAYAK+ G YE+L G    + ++DFTG + E I D++K  Y+    E   LF  L+  +  G L+C +I S S E +E   + GL+  + Y++T + KLR+    + E +    L  +RLRNP G++EW+G  S+ SEEW  ++  D+  +G  + +DGEFWM ++D   NF+++ + R +   +F            G WT           G   +R + L    Q  Q+   +      + +          ++  R     +G  +  VE NR F +H     ++ ++ R G S     R++ L   L  G+Y++ P +     + +F    LLR ++        L  +MP
Sbjct:    7 LFKNQKYQELKQECMKDGRLFCDPTFLPENDSLFFN--RLLPGKVVWKRPQDISDDPHLIVGNISNHQLIQGRLGNKAMISAFSCLAVQESHWTKAIPNHKDQEWDPRKPEKYAGIFHFRFWHFGEWTEVVIDDLLPTINGDLVFSFSTSMNEFWNALLEKAYAKLLGCYEALDGLTITDIIMDFTGTLAE-IIDMQKGRYTDLVEEKYKLFGELYKTFTKGGLICCSIESPSQEEQEVETDWGLLKGYTYTMTDIRKLRLGER-LVEVFSTEKLYMVRLRNPLGRQEWSGPWSEISEEWQQLTVTDRKNLGLVMSDDGEFWMSLEDFCHNFHKLNVCRNVNNPVFGRKE---LESVVGCWTVDDDPLMNRSGGCYNNRDTFL----QNPQYIFTVPEDGHKVIMSLQQKDLRTYRRMGRPDNYIIGFELFKVEMNRRFRLH-----HLYIQERAGTSTYIDTRTVFLSKYLKKGSYVLVPTMFQHGRTSEF----LLRIFSEVPVQLRELTLDMP 502          
BLAST of Calpain 5a vs. Ensembl Mouse
Match: Capn8 (calpain 8 [Source:MGI Symbol;Acc:MGI:2181366])

HSP 1 Score: 248.44 bits (633), Expect = 1.107e-74
Identity = 139/345 (40.29%), Postives = 201/345 (58.26%), Query Frame = 2
Query:   50 SRNFVFFNNQNYVSMRQEHQKNLTLFCDDTFGA-----DDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLM-CATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI 1066
            ++N V +  Q++ ++R++   +  LF D  F A       + + P   +     I WKRP+ELC NP   + G++  D+ QG LG+CWL++A+A L  + + L +V+P   DQ +  N    Y G+F    W+YGEW+EVVIDDRLP++NG+L+F+HS+  NEFWSAL+EKAYAK+ GSYE+L GG T E   DFTGGI E  +DL+K         NL+  +    + GSL+ C+   S + E E      L+  HAYS+TGV ++  +  P            IRLRNPWG+ EW G+ SD++ EW+ I  + K  +  + E DGEFWM   D L  F+ + I
Sbjct:   21 NQNAVKYLGQDFETLRKQCLNSGVLFKDPEFPACPSALGYRDLGPGSAE--TQGIIWKRPTELCSNPQFIVGGATRTDIRQGGLGDCWLLAAIASLTLNEKLLYRVVPR--DQSFQKN----YAGIFHFQFWQYGEWVEVVIDDRLPTKNGQLLFLHSEEGNEFWSALLEKAYAKLNGSYEALAGGSTIEGFEDFTGGISE-FYDLRKPPG------NLYYTIQKALRKGSLLGCSIDVSNAAEAEATTRQKLVKGHAYSVTGVEEVDFRGLPE---------KLIRLRNPWGEVEWTGAWSDSAPEWNYIDPQKKGELDKRAE-DGEFWMSFSDFLKQFSRLEI 340          
BLAST of Calpain 5a vs. Ensembl Mouse
Match: Capn11 (calpain 11 [Source:MGI Symbol;Acc:MGI:1352490])

HSP 1 Score: 254.218 bits (648), Expect = 2.881e-73
Identity = 177/525 (33.71%), Postives = 266/525 (50.67%), Query Frame = 2
Query:   53 RNFVFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSG---KQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLM-CATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFN--EITIIRPIKTGIFKYNSNWFGSMCKGYWT--GVAGDRQSALAEIGQGGQFKI---EINNPKGD--------IFLCHLLQKCARGSEAA-----LGILIIAVERN----RDFMVHTPKFCNVKLEYRLGG-------SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFL 1522
            +N   + NQNY  +R E  +   LF D  F A+ +SI         E + +I W+RP ++  NP       S  D+CQG LG+CWL++A+  L   P+ L +V+P   +Q +  N    Y G+F   LW++G WL VV+DDRLP+RN KLVFVH+  + +FWSAL+EKAYAK+ GSY +L GG T E + DFTGG+  Q   L+K         N+ +LL    +  SLM C+   + + E+E    N L+  HAY++TG+  +         +Y+      IR++NPWG+ EWNG+ SD + EW  +S   ++ +  K ++DG+FWM  +D + NF   EI  + P     + Y S W  +  +G W     AG  ++         QFKI   E+++P+ D          L  L+QK  R +        +G +I +V +     RD  +    F    L+YR  G       SR +    RL  G Y++ P          F    LLR + T+K++ T+L
Sbjct:   32 QNAYNYKNQNYEDLRAECLRKGELFEDPFFPAEPRSIGVKNLGPNSEHMQNIYWQRPKDIIHNPQFITNDFSPTDICQGILGDCWLLAAIGSLTTCPKLLYRVVPR--NQSFKKN----YAGIFHFQLWQFGHWLNVVVDDRLPTRNNKLVFVHASHRQDFWSALLEKAYAKLIGSYGALSGGSTLEGLEDFTGGVA-QCIPLQKPPG------NMLRLLKKALEKSSLMGCSIEVTDNSEVETMTHNMLVRGHAYAVTGLEDV---------YYRDKLETLIRIQNPWGRVEWNGAWSDKATEWEEVSPDVRVQLLHK-KDDGDFWMSYEDFMSNFTLLEICNLTPDALNTWDYKSRWHSTFYEGSWRRGSTAGGCRNHPETFWSNPQFKISLPEVDDPEDDSEKNEMVCTCLVALMQKNWRHAREGPQLLTIGFVIFSVPKEFQNLRDIHLKKDFF----LKYRDHGFSEIFINSREVNSHLRLPPGEYVIIPSTYEPHKDADF----LLRVF-TEKHSETWL 524          
BLAST of Calpain 5a vs. UniProt/SwissProt
Match: sp|O15484|CAN5_HUMAN (Calpain-5 OS=Homo sapiens OX=9606 GN=CAPN5 PE=1 SV=2)

HSP 1 Score: 336.265 bits (861), Expect = 7.390e-104
Identity = 204/622 (32.80%), Postives = 324/622 (52.09%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLMCATI-ASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALA-------EIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSN-CTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNM 1882
            + +QNY ++R++ ++   LF D  F A D S+   G      ++ WKRP  +C +P LF+ G S HD+ QG +GNCW V+A + LA      +KVIP+  +QEW   +P++Y G+F    WR+GEW++VVIDDRLP+ N +L++ HS  +NEFW AL+EKAYAK+ G Y++L GG T +++VDFTGG+ E I DL +  ++  +T+   LF+ +      G L+ A+I A  + +ME +LA GL+  HAY++T V K+R+    +   ++   L  IRLRNPWG++EWNG  SD SEEW  +S  ++  MG  V++DGEFWM  +DV   F +I   R I T     +  W  +   G WT     RQ+             Q  Q+  E+  P+ ++ +C         ++  +G   A+G  I  VE NR + +H+ +       Y    SRS+ LR     G Y++ P       + +F    LLR +T   +N      E+ + E    C S+ C        +         +     N +  I CE   +R+ V   TS   ++   + +R K+ +PI +++++     +  +G      D  +L   + + TL++
Sbjct:    8 YEDQNYSALRRDCRRRKVLFEDPLFPATDDSLYYKGTPG--PAVRWKRPKGICEDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWDPEKPNAYAGIFHFHFWRFGEWVDVVIDDRLPTVNNQLIYCHSNSRNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI-DLTEGDFANDETKRNQLFERMLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLDMIRLRNPWGEREWNGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDVCRYFTDIIKCRVINTSHLSIHKTWEEARLHGAWTLHEDPRQNRGGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYI--NSRSVFLRTDQPEGRYVIIPTTFEPGHTGEF----LLRVFTDVPSNC----RELRLDEPPHTCWSSLCGYPQLVTQVHVLGAAGLKDSPTGANSYVIIKCEGDKVRSAVQKGTSTPEYNVKGIFYRKKLSQPITVQVWNHRVLKDEFLGQVHLKADPDNL---QALHTLHL 612          
BLAST of Calpain 5a vs. UniProt/SwissProt
Match: sp|O08688|CAN5_MOUSE (Calpain-5 OS=Mus musculus OX=10090 GN=Capn5 PE=1 SV=1)

HSP 1 Score: 328.561 bits (841), Expect = 6.164e-101
Identity = 196/599 (32.72%), Postives = 311/599 (51.92%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLMCATI-ASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALA-------EIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            + +QNY ++++   +   LF D  F A D S+   G      ++ WKRP ++C +P LF+ G S HD+ QG +GNCW V+A + LA      +KVIP+  +QEW+  +P SY G+F    WR+GEW++V++DDRLP+ N +L++ HS  KNEFW AL+EKAYAK+ G Y++L GG T +++VDFTGG+ E I DL +   +  + +   LF+ +      G L+ A+I A  + +ME +LA GL+  HAY++T V K+R+    +   ++   L  IRLRNPWG++EW G  SD SEEW  +S  ++  MG  V++DGEFWM  +D+   F +I   R I T     +  W  +   G WT     +Q+             Q  Q+  E+  P+ ++ +          ++  +G   A+G  I  VE NR + +H+ +       Y    SRS+ LR  L  G Y++ P       + +F    LLR +T   +N   L  + P   R C   S C        +         +     N +  I CE + +R+ V   TS   ++   + +R K+ +PI +++++     +  +G
Sbjct:    8 YEDQNYSALKRACLRKKVLFEDPLFPATDDSLYYKGTPG--PTVRWKRPKDICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWNPEKPDSYAGIFHFNFWRFGEWVDVIVDDRLPTVNNQLIYCHSNSKNEFWCALVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI-DLTEGDLATDEAKRNQLFERVLKVHSRGGLISASIKAVTAADMEARLACGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLDMIRLRNPWGEREWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTFEDMCRYFTDIIKCRLINTSYLSIHKTWEEARLHGAWTRHEDPQQNRSGGCINHKDTFFQNPQYVFEVKKPEDEVLISIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYI--NSRSVFLRTELPEGRYVIIPTTFEPGHTGEF----LLRVFTDVPSNCRELRLDEP--PRTC-WSSLCGYPQQVAQVHVLGAAGLKDSPTGANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLAQPITVQVWNHRVLKDEFLG 593          
BLAST of Calpain 5a vs. UniProt/SwissProt
Match: sp|Q8R4C0|CAN5_RAT (Calpain-5 OS=Rattus norvegicus OX=10116 GN=Capn5 PE=1 SV=1)

HSP 1 Score: 324.324 bits (830), Expect = 1.977e-99
Identity = 197/599 (32.89%), Postives = 310/599 (51.75%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLFKLLHFDWKDGSLMCATI-ASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALA-------EIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            +  QNY ++++   +   LF D  F A D S+   G      ++ WKRP ++C +P LF+ G S HD+ QG +GNCW V+A + LA      +KVIP+  +QEW+  +P SY G+F    WR+GEW++VV+DDRLP+ N +L++ HS  KNEFW A +EKAYAK+ G Y++L GG T +++VDFTGG+ E I DL +   +  + +   LF+ +      G L+ A+I A  + +ME +LA GL+  HAY++T V K+R+    +   ++   L  IRLRNPWG++ W G  SD SEEW  +S  ++  MG  V++DGEFWM  +D+   F +I   R I T     +  W  +  +G WT     +Q+             Q  Q+  E+  P+ ++ +C         ++  +G   A+G  I  VE NR + +H+ +       Y    SRS+ LR  L  G Y++ P  T   P     +  LLR +T   +N   L  + P   R C   S C        +         +     N +  I CE + +R+ V   TS   ++   + +R K+ +PI +++++     +  +G
Sbjct:    8 YEYQNYSALKRACLRRKVLFEDPHFPASDDSLYYKGTPG--PTVRWKRPFDICDDPRLFVDGISSHDLHQGQVGNCWFVAACSSLASRESLWQKVIPDWKEQEWNPEKPDSYAGIFHFNFWRFGEWVDVVVDDRLPTVNNQLIYCHSNSKNEFWCAPVEKAYAKLAGCYQALDGGNTADALVDFTGGVSEPI-DLTEGDLATDEAKRSQLFERVLKVHSRGGLISASIKAMTAADMETRLACGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLDMIRLRNPWGERVWTGPWSDTSEEWQKVSKSEREKMGVTVQDDGEFWMTYEDMCRYFTDIIKCRLINTSYLSIHKTWEEARLRGAWTRHEDPQQNRSGGCINHKDTFFQNPQYIFEVKKPEDEVLICIQQRPKRSTRREGKGENLAIGFDIYKVEENRQYRMHSLQHKAASSIYI--NSRSVFLRTELPEGRYVIIP--TTFEPGHTGEL--LLRVFTDVPSNCRELRLDEP--PRTC-WSSLCGYPQQVTQVHVLGAAGLKDSSTGANSYVIIKCEGEKVRSAVQRGTSTPEYNVKGIFYRKKLSQPITVQVWNNRVLKDEFLG 593          
BLAST of Calpain 5a vs. UniProt/SwissProt
Match: sp|Q22036|CAN5_CAEEL (Calpain-5 OS=Caenorhabditis elegans OX=6239 GN=tra-3 PE=1 SV=1)

HSP 1 Score: 316.62 bits (810), Expect = 2.438e-96
Identity = 204/600 (34.00%), Postives = 314/600 (52.33%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLK--KYSKSDTEMENLFKLLHFDWKDGSLMCATIASRS-DEMEEKLANGLITTHAYSITGVCKLRI-----KSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVEN----DGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT------GVAGDRQSA----LAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSE-----AALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYR-LTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIF 1783
            F NQNY  +R+   K    F D  F   ++S+    +Q   S I WKRP EL  +P LF+ G+S +DV QG LGNCW VSA + L  + + L +VIP+ DDQEW  +  H+Y G+FR   WR+G+W+EVVIDD LP+R+GKL+F  SK  NEFWSAL+EKA+AK+ G YE+LVGG   +++ D +GG+ E +   K  K   +DTE++ LF  L   +  G+L+ A IA+R+ +E+EE L  GL+  HAY+++ VC + +     +S   +    K     IRL+NPWG+KEWNG+ SD S EW ++S      MG +  N    DG+FWM  +  +  F +I++ +   T +F ++ ++   +    WT      G   DR        A      Q+  +I +P   +    +    + G +       +G+ ++ VE NR + VHT        +Y  G  RS+ L  + L  G Y++ P  T  +P  K    ++LR Y+ +  + + L    P L     CKS  ++    +H +  +           N++  +    +S RT        + WDE FL H+SK  +   I+++
Sbjct:   10 FGNQNYEKLRKICIKKKQPFVDTLFPPTNQSLFLEQRQS--SDIVWKRPGELHPDPHLFVEGASPNDVTQGILGNCWFVSACSALTHNFKLLAQVIPDADDQEW--STKHAYAGIFRFRFWRFGKWVEVVIDDLLPTRDGKLLFARSKTPNEFWSALLEKAFAKLYGCYENLVGGHLSDALQDVSGGVAETLHVRKFLKDDPNDTELK-LFNDLKTAFDKGALVVAAIAARTKEEIEESLDCGLVKGHAYAVSAVCTIDVTNPNERSFTSFIMGSKRKQNLIRLQNPWGEKEWNGAWSDDSPEWQNVSASQLSTMGVQPANSDSDDGDFWMPWESFVHYFTDISLCQLFNTSVFSFSRSYDEQIVFSEWTTNGKKSGAPDDRAGGCHNFKATFCNNPQYIFDIPSPNCSVMFALIQNDPSEGLKKREPFVTIGMHVMKVENNRQYRVHTAMHPIAISDYASG--RSVYLHLQSLPRGRYLLIP--TTFAP--KEQTLFMLRVYSDEHIHFSPLTKHAPKLGL-LKCKSAQSVTRLTIHGVDFNSASTGTH----NVYAILKDSRKSFRTKTLSGVKSIQWDEQFLFHKSKNRQQYKIEVW 593          
BLAST of Calpain 5a vs. UniProt/SwissProt
Match: sp|Q11002|CANA_DROME (Calpain-A OS=Drosophila melanogaster OX=7227 GN=CalpA PE=1 SV=2)

HSP 1 Score: 265.774 bits (678), Expect = 8.378e-76
Identity = 181/505 (35.84%), Postives = 268/505 (53.07%), Query Frame = 2
Query:   77 QNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRPIKTGIFKYNSN---WFGSMCKGYWT-GV-AGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARGSEA------ALGILIIAVERNRDFMVHTPKFCN-VKLEYRLGGS------RSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNN 1510
            Q+Y ++      + +LF D  F A ++S+  S + +    IEW RP E+  NP  F+ G S  DV QG LG+CWL++A A L Q      +VIP   +Q +  N    Y G+F    W+YG+W++V+IDDRLP+ NG+L+++HS  KNEFWSAL+EKAYAK+ GSYE+L GG TCE+M DFTGG+ E  +DLK+         NLF +L    +  S+M  +I    +  E +   GLI  HAYSIT VC + I  TP     ++  +  IR+RNPWG + EWNG  SD+S EW  I  + K  +G   + DGEFWM   D L +F+ + I  + P      + NS    W  SM +G WT GV AG  ++ L       Q+ I + +P  +        +  L+QK  R           +G  I ++  N   + + P+  N  + +  +G S      R +C R++L  G Y++ P     +   +F    ++R ++  +NN
Sbjct:   73 QDYETILNSCLASGSLFEDPLFPASNESLQFSRRPD--RHIEWLRPHEIAENPQFFVEGYSRFDVQQGELGDCWLLAATANLTQESNLFFRVIPA--EQSFEEN----YAGIFHFRFWQYGKWVDVIIDDRLPTYNGELMYMHSTEKNEFWSALLEKAYAKLHGSYEALKGGSTCEAMEDFTGGVSE-WYDLKEAPG------NLFTILQKAAERNSMMGCSIEPDPNVTEAETPQGLIRGHAYSITKVCLIDI-VTP----NRQGKIPMIRMRNPWGNEAEWNGPWSDSSPEWRYIPEEQKAEIGLTFDRDGEFWMSFQDFLNHFDRVEICNLSPDSLTEDQQNSGKRKWEMSMYEGEWTPGVTAGGCRNFLDTFWHNPQYIITLVDPDEEDEEGQCTVIVALMQKNRRSKRNMGMECLTIGFAIYSL--NDRELENRPQGLNFFRYKSSVGRSPHFINTREVCARFKLPPGHYLIVPSTFDPNEEGEF----IIRVFSETQNN 551          
BLAST of Calpain 5a vs. TrEMBL
Match: A0A3Q2QZ28 (Calpain 5a OS=Fundulus heteroclitus OX=8078 PE=3 SV=1)

HSP 1 Score: 384.03 bits (985), Expect = 1.035e-119
Identity = 224/610 (36.72%), Postives = 345/610 (56.56%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMEN-LF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-----------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNC---ICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            +  Q++V++R++ ++N  LF D  F A D+S+     +  +  + WKRP EL  +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  +QEW    P SY G+F    WR+G W++VVIDDRLP+ NGKLV+ HS  KNEFWSAL+EKAYAK+CG YE+L GG T +++VDFTGG+ E +   +   K D E  N LF ++L    +DG + C+  A  +++ME KLA GL+  HAY++T V ++R+    +  +++ + L  IR+RNPWGQ+EWNG  SD+SEEW  +S  ++  MG  V++DGEFWM  DD + NF ++ + R I T     +  W  ++ +G W            G + ++QS L    Q  Q+K ++  PK ++ +C          +  RG    +G  I  VE NR + +H        ++ ++GG     SRS+ LR  LT G Y++ P  T  +P L+    +LLR +     + T L  + P   + C   IC      ++ ++H++QAD +   +   V + +  I CE Q +R+ V  NT    ++   L +R K +RPI I+I++   F ++ +G
Sbjct:    5 YEEQSFVALRRQCRQNGNLFEDLLFPASDQSLFYQSNR--IGHVTWKRPKELSPDPHLFVDGISAHDLHQGQLGNCWFVAACSSLASREALWQKVIPDWKEQEWDKENPDSYAGIFHFQFWRFGRWVDVVIDDRLPTVNGKLVYCHSNDKNEFWSALVEKAYAKMCGCYEALDGGNTADALVDFTGGVSEPVDLTENGYKDDEEKRNDLFERVLKVHNRDGLISCSIRAITAEDMEAKLACGLVKGHAYAVTDVRRVRLGHG-LLSYFKSDKLNMIRMRNPWGQREWNGPWSDSSEEWKKVSKSERERMGVTVQDDGEFWMTFDDFIANFTDLILCRLINTSYLSLHKTWEEAVMRGSWRRHDDPLCNRAGGCSNNKQSFL----QNPQYKFDVKKPKDEVLICLQQEDRRATLREGRGENLPIGFDIQRVELNRTYRMHA-------VQEKVGGSIYINSRSVFLRTELTEGRYVIIP--TTFNPGLEGE--FLLRIFADVPTDCTELTLDEP--PQTCWSGIC--GYPSLVTQVHVLQADGLAGQDSDGVSDPYVIIRCEGQKVRSAVYQNTRSPAFNTKGLFYRKKANRPISIEIYNHNVFKDSFLG 592          
BLAST of Calpain 5a vs. TrEMBL
Match: A0A3Q3EVJ7 (Calpain 5a OS=Labrus bergylta OX=56723 PE=3 SV=1)

HSP 1 Score: 381.719 bits (979), Expect = 7.906e-119
Identity = 220/613 (35.89%), Postives = 346/613 (56.44%), Query Frame = 2
Query:   62 VFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTE-MENLF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-----------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKC-------ARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNC---ICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            V +  Q++ ++R++ Q+   LF D  F   D+S+     +  + S+ WKRP ELC NP LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  DQEW  ++P SY G+F    WR+GEW++VVIDDRLP+ NG+LV+ HS   NEFWSAL+EKAYAK+CG YE+L GG T +++VDFTGG+ E +  ++   K D E  + LF ++L    ++G + C+  A+ + +ME +LA GL+  HAY++T V ++R+    +  +++ + L  IR+RNPWGQ+EWNG  SD+SEEW  +S  ++  +G  V++DGEFWM  DD + NF ++ + R I T    ++  W  ++ +G W            G   ++QS L    Q  Q+  ++  P+ +I +C L QK         RG   A+G  I  VE NR + +H         + ++GG     SRS+ +R  L  G Y++ P  T   P L+    +LLR +T   +N   L  + P   + C   +C      ++ ++HI++A  +   +     + +  I CE Q +R+ VN +T    +D   L +R K+ +PI IK+++     ++ +G
Sbjct:    3 VSYVGQSFSALRKQCQQKGVLFEDPLFPTTDQSLFYQSNR--IGSVTWKRPKELCSNPHLFVDGISAHDLHQGQLGNCWFVAACSSLASREALWRKVIPDWKDQEWDEDKPESYAGIFHFRFWRFGEWVDVVIDDRLPTANGELVYCHSNDSNEFWSALVEKAYAKMCGCYEALDGGNTADALVDFTGGVSEPLDLVETGFKDDKEKRDELFERVLKVHNREGLISCSIRATTAADMEARLACGLVKGHAYAVTDVRRVRL-GHGLLAYFRSDKLTMIRMRNPWGQREWNGPWSDSSEEWKKVSSSEREKIGVTVQDDGEFWMTFDDFIANFTDLILCRLINTSYLSFHKTWEETVIRGSWIRNGDTLLNRTGGCTNNKQSFL----QNPQYVFDVKKPEDEILIC-LQQKDRRASLREGRGENLAIGFDIHRVELNRTYRMHA-------TQEKVGGSTYINSRSVSVRLELKEGRYVIIP--TTFDPGLEGE--FLLRIFTDVPSNCKELTLDKP--PKTCWSGLC--GYPSLVTQVHILRAAGLAGQDSDGASDPYVIISCEGQKVRSPVNKDTRSPAFDTKGLFYRKKVKQPISIKLYNHNLLIDSFLG 592          
BLAST of Calpain 5a vs. TrEMBL
Match: A0A4Z2IKQ2 (Calpain-5 OS=Liparis tanakae OX=230148 GN=CAPN5_0 PE=3 SV=1)

HSP 1 Score: 379.407 bits (973), Expect = 8.126e-118
Identity = 221/615 (35.93%), Postives = 345/615 (56.10%), Query Frame = 2
Query:   53 RNFVFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMEN-LF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKC-------ARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPS---EMPILERNCICKSNC---TIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            R  V +  Q++ ++R++ Q+N +LF D  F   D+S+     +  + S+ WKRP ELC NP LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  DQEW   +P SY G+F    WR+GEW +VVIDDRLP+ NG+LV+ HS   NEFWSAL+EKAYAK+CG YE+L GG T +++VDFTGG+ E +  ++   K D E  N LF ++L    + G + C+  A+ + +ME +L+ GL+  HAY++T V ++R+    +  +++ + L  IR+RNPWG+KEWNG+ SD+SEEW  +S  ++  +G  V +DGEFWM  DD +VNF ++ + R I T    ++  W  S+ +G W          AG   +      Q  Q+  ++  P+ ++ +C L QK         RG   A+G  I  VE NR + +H         + ++GG     SRS+ +R  L  G Y++ P  T   P L+    +LLR +T        +PS   E+ + E    C S       ++ ++H++ A+ +   +   V + +  I CE + +R+ V+ NT    +D   L +R K ++PI I+I++     ++ +G
Sbjct:    6 RMVVPYEGQSFSALRRQCQQNGSLFEDPLFPTSDQSLFYQSNR--IGSVTWKRPKELCDNPHLFVDGISAHDLHQGQLGNCWFVAACSSLASREALWQKVIPDWKDQEWDEEKPESYAGIFHFRFWRFGEWADVVIDDRLPTANGELVYCHSNDSNEFWSALVEKAYAKMCGCYEALDGGNTADALVDFTGGVSEPMDLMENGFKDDDEKRNELFERVLKVHDRGGLISCSIRATTAADMEARLSCGLVKGHAYAVTDVRRVRLGHG-LLAYFRSDKLTMIRMRNPWGEKEWNGAWSDSSEEWKKVSKSERERIGVTVRDDGEFWMTFDDFIVNFTDLILCRLINTSYLSFHKTWEESVMRGSWQRHDEPLLNRAGGCTNQKHSFLQNPQYVFDVKKPEDEVLIC-LQQKDRRATLREGRGENLAIGFEIHRVEFNRTYRMHV-------TQQKVGGSVYINSRSVFIRIELPEGRYVIIP--TTFDPDLEG--VFLLRTFTD-------VPSDCKELTLHEPPQTCWSGLCGYPSLVTQIHVLNANGLAGQDSDGVSDPYVLIRCEGEKVRSPVHKNTRSPNFDTKGLFYRKKANQPIRIEIYNHNVLMDSFLG 598          
BLAST of Calpain 5a vs. TrEMBL
Match: A0A4W6G005 (Uncharacterized protein OS=Lates calcarifer OX=8187 GN=LOC108872711 PE=3 SV=1)

HSP 1 Score: 375.17 bits (962), Expect = 2.801e-116
Identity = 219/613 (35.73%), Postives = 346/613 (56.44%), Query Frame = 2
Query:   62 VFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMEN-LF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-----------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKC-------ARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNC---TIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            V +  Q++ ++R++ Q+N  LF D  F A D+S+        +  + WKRP ELC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  DQEW+  +P SY G+F    WR+GEW++VVIDD+LP+ NG+LV+ HSK  NEFWSAL+EKAYAK+CG YE+L GG T +++VDFTGG+ E +   +   K D E  N LF ++L    + G + C+  A+ +++ME +LA GL+  HAY++T V K+R+    +  +++ + L  IR+RNPWGQ+EWNG  SD+SEEW  +S  ++  +G  V++DGEFWM  DD + NF ++ + R I T     +  W  ++ +G W            G   ++++ L    Q  Q+  ++  P+ +I +C L QK         RG   A+G  I  VE NR + +H         + ++GG     SRS+ LR  L  G Y++ P  T   P L+    +LLR ++   ++      E+ + E    C S       ++ ++HI+QA+ +   +   V + +  I CE + +R+ ++ NT    +D   L +R K ++PI I+I++     ++ +G
Sbjct:    3 VPYEGQSFSALRRQCQQNGRLFVDPLFPASDQSLFYQSNH--IGRVTWKRPKELCSDPHLFVDGISAHDLHQGQLGNCWFVAACSSLASREALWQKVIPDWKDQEWNDEKPESYAGIFHFRFWRFGEWVDVVIDDQLPTVNGELVYCHSKDSNEFWSALVEKAYAKMCGCYEALDGGNTADALVDFTGGVSEPMNLTENGFKEDEEKRNELFERVLKVHNRGGLISCSIRATSAEDMEARLACGLVKGHAYAVTDVRKVRLGHG-LLAYFRSDKLTMIRMRNPWGQREWNGPWSDSSEEWKKVSKSEREKIGVTVQDDGEFWMTFDDFIANFTDLILCRLINTSYLSLHKTWEEAVMRGSWRRHDDPLLNRAGGCTNNKRTFL----QNPQYVFDVKKPEDEILIC-LQQKDRRARLKEGRGENLAIGFDIHRVELNRIYRMHV-------TQQKVGGSVYINSRSVFLRIDLKEGRYVIIP--TTFDPGLEGE--FLLRIFSDVSSDC----KELTVDEPPQTCWSGLCGYPSLVTQVHILQANGLAGQDSDGVSDPYVIIRCEGEKVRSPIHKNTRSPAFDTKGLFYRKKANQPISIEIYNHNVLMDSFLG 592          
BLAST of Calpain 5a vs. TrEMBL
Match: R7VLA7 (Uncharacterized protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_228346 PE=3 SV=1)

HSP 1 Score: 371.703 bits (953), Expect = 5.275e-115
Identity = 214/603 (35.49%), Postives = 334/603 (55.39%), Query Frame = 2
Query:   53 RNFVFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGI--PEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRS-DEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSEA----ALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILER-NCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLH-RSKMDRPIIIKIFHRGRFFNTLIG 1816
            ++ V F +Q+Y  +R+E Q +  LF D TF A++ SI  +      + IEWKRP ++  NP LF+ G +  D+ QG LGNCW V+A + LA + E  +KVIPN  DQEW   +P  Y G++    WR+GEW +VVIDD LP+RNG LV+ HSK +NEFWSAL+EKAYAK+ GSYESL GG   E++ DFTGG+  P  + DL K    +    +L+K++     + ++M A I S + +E EE +  GL+  HAY IT V ++ ++ T ++  + K  +  IRLRNPWG  EW G+ SD SEEW  I  + +  +G   ++DGEFWM  +D   +F  ++I R I T +F + + W  +   G W       G   ++++ L    +  Q+  ++++   D  L  L QKC RG E      +G  I+ VE NR + VH  +   +        SR I LR+ L  G Y++        P++K    +LLR YTT  ++   L  + P  +  +C+       ++ R+ II+A  ++  + +   + +C+I CE    +T+   +T    W+ +++ + R+   +PI I+I++     NT +G
Sbjct:    4 KSVVLFKDQDYDKLRKEAQSSGQLFTDPTFPANEASIGGNA-----AGIEWKRPKDIAENPSLFVDGVTCSDLNQGELGNCWFVAACSCLATNKEIWRKVIPNHKDQEWDPEKPEKYAGIYYFRFWRFGEWTDVVIDDLLPTRNGDLVYAHSKDRNEFWSALLEKAYAKLYGSYESLDGGELAEALEDFTGGVSEPLNLVDL-KVGIEEEARNDLYKVMRKAMDNHAMMAAAIPSATKEEQEEVMDMGLVKGHAYGITAVKRIALEGTGIFNMFNKEKIAMIRLRNPWGGTEWKGAFSDESEEWKKIDKESREKIGLTFDDDGEFWMNFEDYCKHFTNMSICRVINTSLFSFQTTWTEACMHGEWVTPHFSGGCVNNKETFL----KNPQYVFDVDD-NDDECLFQLTQKCGRGGEGIEKTTIGFSIMKVEYNRKYRVH--QMQRITKSSAFKNSRGIFLRHTLDKGRYVI--VACTFEPNVK--AKHLLRVYTTGTSHAHALVKDKPSEKTLSCLPWFAYPSVVTRVTIIRARDLEKQDTIGGADPYCQISCEGHHYKTSTIKDTVNPEWNSSYIFYRRNHRSKPIEIEIWNSNALKNTFMG 589          
BLAST of Calpain 5a vs. Ensembl Cavefish
Match: capn5a (calpain 5 [Source:NCBI gene;Acc:103038917])

HSP 1 Score: 334.724 bits (857), Expect = 3.064e-104
Identity = 202/615 (32.85%), Postives = 333/615 (54.15%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLK-KYSKSDTEMENLF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-----------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCAR-------GSEAALGILIIAVERNRDFMVHTP--KFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNC---ICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYD 1837
            +  Q + ++R+  Q++ TLF D  F   D+S+     Q  +  + WKRP ELC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  DQEW  N P SY G+F    W +GEW++VVIDDRLP+ NG L++ HS   NEFWSAL+EKAYAK+ G YE+L GG T +++VDFTGG+ E +  L+ ++ + +     LF ++L    + G + C+  A+   +ME +L  GL+  HAY++T V ++R+    +  +++   LM IR+RNPWG++EWNG  SD+SEEW  +S  ++  +G  V++DGEFWM+ +D   +F ++ + R I T     +  W  ++  G W+           G   ++ + L    Q  Q+  ++  P+ ++ +C L QK  R       G   A+G  +  VE NR + +HT   K C+         SRS+ +R  L  G Y++ P  T  +P L+    +LLR +T   ++   L  + P   + C   +C      ++ ++H+++   +Q  +     + +  I CE   +++  + +     +D   L +R K  + I I+++++    ++ +G    S D
Sbjct:    8 YEGQQFEALRKRCQQSRTLFEDPLFPPVDESLFYQTNQ--IGKVTWKRPKELCSDPHLFVNGISAHDLHQGRLGNCWFVAACSSLASREALWQKVIPDWKDQEWDSNHPDSYAGIFHFRFWLFGEWVDVVIDDRLPTANGNLIYCHSNDSNEFWSALVEKAYAKIHGCYEALDGGNTADALVDFTGGVSEPVDLLEGRFGQEEEARNQLFDRVLKVHNRGGLISCSIRATTQADMEARLDCGLVKGHAYAVTDVRRVRLGHG-LLAYFKSEKLMMIRMRNPWGEREWNGPWSDSSEEWQKVSKGEREKLGVTVQDDGEFWMMFEDFSKHFTDLILCRLINTSYLSIHKTWEEAVMMGSWSRHDDPLSNRSGGCINNKTTYL----QNPQYVFDVKKPEDEVLIC-LQQKDRRARPKEGKGENLAIGFDLQRVELNRVYRMHTSQQKLCSSVYI----NSRSVFVRKDLKEGRYVIIP--TTFNPGLQGD--FLLRVFTDVPSDCKELTLDEP--PQTCWTGLC--GYPQLVTQVHVMKGVGLQGQDSDGSSDPYIIISCEGVKVKSPAHKSNLSPEFDVKALFYRKKPGQGIHIEVYNKNVLNDSFMGQVTLSGD 602          
BLAST of Calpain 5a vs. Ensembl Cavefish
Match: capn5b (calpain-5-like [Source:NCBI gene;Acc:103035636])

HSP 1 Score: 326.25 bits (835), Expect = 5.371e-101
Identity = 205/607 (33.77%), Postives = 325/607 (53.54%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMEN-LF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCAR-------GSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNC---ICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            F  Q Y +++++  ++ TLF D  F A D S+   G +  +  + WKRP ELC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  +QEW   +  SY G+F    WR+GEW++VVIDDRLP+ + +LV+ HS   NEFWSAL+EKAYAKV G YE+L GG T +++VDFTGG+ E +  L+     D    N LF ++L    +DG + C+  A+  ++ME +L  GL+  HAY++T V K+R+    +   ++   L  IR+RNPWG+KEW+G  SD+SEEW  +S  ++  +G  V++DGEFWM  DD    F ++ + R I T     +  W   + +G W          +G   +  A   Q  Q+  ++   + ++ +C L QK  R       G   A+G  I  VE NR + +H+        + ++ G     SR + LR  L  G Y++ P  T   P  +    +LLR +T   ++   L  + P   + C   +C      ++ ++H++ A+ +Q  +     + +  I CE + +R+ V+ +T    +D   +  R K    I I+I+++    +T +G
Sbjct:    8 FEGQQYSTLKKQCLQSGTLFEDPLFPAVDDSLFYQGNR--IGRVHWKRPRELCDDPHLFVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWREQEWDPEKDESYVGIFHFRFWRFGEWVDVVIDDRLPTVDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPMDLLEGQMAQDEVARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVKKVRL-GHGLLAFFKSEKLHMIRMRNPWGEKEWSGPWSDSSEEWKKVSKSEREKLGVTVQDDGEFWMNFDDFCQYFTDLILCRLINTSYLSIHKTWEEEVMRGTWVYRDDPLRNRSGGCINHKATFLQNPQYVFDVRKVEDEVLIC-LQQKEKRATPKEGKGENLAIGFDIHRVELNRKYRMHSA-------QQKVAGSIYINSRCVFLRKELKEGRYVIIP--TTFDPGQQGE--FLLRVFTDVPSDCKELTLDDP--PQTCWTGMC--GYPQLVTQVHVLSAEGLQGQDSNGASDPYVIITCEGEKVRSPVHKDTRCPNFDVKGVFFRKKPKEGIHIEIYNKNVIVDTFLG 595          
BLAST of Calpain 5a vs. Ensembl Cavefish
Match: capn5b (calpain-5-like [Source:NCBI gene;Acc:103035636])

HSP 1 Score: 317.775 bits (813), Expect = 5.608e-98
Identity = 202/594 (34.01%), Postives = 317/594 (53.37%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMEN-LF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCAR-------GSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNC---ICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIK 1777
            F  Q Y +++++  ++ TLF D  F A D S+   G +  +  + WKRP ELC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  +QEW   +  SY G+F    WR+GEW++VVIDDRLP+ + +LV+ HS   NEFWSAL+EKAYAKV G YE+L GG T +++VDFTGG+ E +  L+     D    N LF ++L    +DG + C+  A+  ++ME +L  GL+  HAY++T V K+R+    +   ++   L  IR+RNPWG+KEW+G  SD+SEEW  +S  ++  +G  V++DGEFWM  DD    F ++ + R I T     +  W   + +G W          +G   +  A   Q  Q+  ++   + ++ +C L QK  R       G   A+G  I  VE NR + +H+        + ++ G     SR + LR  L  G Y++ P  T   P  +    +LLR +T   ++   L  + P   + C   +C      ++ ++H++ A+ +Q  +     + +  I CE + +R+ V+ +T    +D   +  R K    I I+
Sbjct:    8 FEGQQYSTLKKQCLQSGTLFEDPLFPAVDDSLFYQGNR--IGRVHWKRPRELCDDPHLFVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWREQEWDPEKDESYVGIFHFRFWRFGEWVDVVIDDRLPTVDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPMDLLEGQMAQDEVARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVKKVRL-GHGLLAFFKSEKLHMIRMRNPWGEKEWSGPWSDSSEEWKKVSKSEREKLGVTVQDDGEFWMNFDDFCQYFTDLILCRLINTSYLSIHKTWEEEVMRGTWVYRDDPLRNRSGGCINHKATFLQNPQYVFDVRKVEDEVLIC-LQQKEKRATPKEGKGENLAIGFDIHRVELNRKYRMHSA-------QQKVAGSIYINSRCVFLRKELKEGRYVIIP--TTFDPGQQGE--FLLRVFTDVPSDCKELTLDDP--PQTCWTGMC--GYPQLVTQVHVLSAEGLQGQDSNGASDPYVIITCEGEKVRSPVHKDTRCPNFDVKGVFFRKKPKEGIHIE 582          
BLAST of Calpain 5a vs. Ensembl Cavefish
Match: ENSAMXT00000048279.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000063.1:113453:132090:1 gene:ENSAMXG00000038709.1 transcript:ENSAMXT00000048279.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 285.804 bits (730), Expect = 5.573e-86
Identity = 192/604 (31.79%), Postives = 300/604 (49.67%), Query Frame = 2
Query:   74 NQNYVSMRQEHQKNLTLFCDDTFGADDKSI----SPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQI-FDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-----------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQK-------CARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            NQ+Y  +++E  +   LF D  F   ++S+     P G       ++WKRP E+C  P LF+ G S HD+ QG +GNCW V+A + LA  P+  +KVIPN  +QEW  +RP  YTG+F    W +GEW +VV+DDRLP+ NGKL++ HSK  NEFWSAL+EKAYAK+ G YESL GG T +++VDF+G + E +  +   +       E LF  L      G ++  +IAS   E E +LANGL+  HAYS+TGV ++R+    +  +++ + +  IR+RNPWG+ EW G+ SD   E+ S    D   +  K        M  DD   NF ++ + R + T +      W   +  G W            G    RQ+ L    Q  Q+ +++ +   D  L  L Q+         +G    +G  I  VE NR + +H               +RS+ LR  L  G YI+ P  +  +P +     ++LR Y  Q      +  E+ + + +  C S+       +  +     +  E  D  + +  I CE  S+++ V  +T    +D   + +R K ++PI I++++     +  +G
Sbjct:    8 NQHYSELKRECLQQKKLFEDPEFLCSNRSLFYRTPPPG------PVQWKRPGEMCEAPRLFVEGISAHDLNQGEVGNCWFVAACSCLALKPQLWQKVIPNWKEQEWDPDRPDRYTGIFHFQFWIFGEWTDVVVDDRLPTINGKLIYCHSKSNNEFWSALLEKAYAKLSGCYESLNGGNTGDAVVDFSGAVNEPVSLETGSFRTDSKTREKLFSDLLNVNDQGGIISCSIAS-PHERELRLANGLVKGHAYSVTGVRRVRLGHG-LLAYFKNDTVDLIRMRNPWGKHEWRGAWSDRWGEFLS----DDFKLLKK--------MSFDDWCQNFTDVDVCRLMNTSVLSLQKRWREVVHFGSWIKHSEPLRNRSGGCMNHRQTFL----QNPQYILDLQDE--DELLVSLQQRDMKIHRAHGQGENLTIGFAIFKVELNRKYRMHDIITQQNVATSSYINARSVFLRKLLPKGRYIIIP--STFTPGILGD--FMLRVYANQ----DLICRELDVDKPSVRCWSSFMGYPQVVTQVYVHGAEGLENQDSADPYVIISCEKNSIQSEVQKDTRDPQFDIRAIFYRKKPNKPITIQVWNSNVVKDQFMG 577          
BLAST of Calpain 5a vs. Ensembl Cavefish
Match: ENSAMXT00000050823.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000063.1:117226:132090:1 gene:ENSAMXG00000038709.1 transcript:ENSAMXT00000050823.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 276.559 bits (706), Expect = 2.019e-82
Identity = 186/609 (30.54%), Postives = 303/609 (49.75%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSI----SPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQI-FDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-----------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQK-------CARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCT---IIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            + NQ+Y  +++E  +   LF D  F   ++S+     P G       ++WKRP  +C  P LF+ G S HD+ QG +GNCW V+A + LA  P+  +KVIPN  +QEW  +RP  YTG+F    W +GEW +VV+DDRLP+ NGKL++ HSK  NEFWSAL+EKAYAK+ G YESL GG T +++VDF+G + E +  +   +       E LF  L      G ++  +IA+   E E +LANGL+  HAYS+TGV ++R+    +  +++ + +  IR+RNPWG+ EW G+ SD    W ++                   M  DD   NF ++ + R + T +      W   +  G W            G    RQ+ L    Q  Q+ +++ +   D  L  L Q+         +G    +G  I  VE NR + +H               +RS+ LR  L  G YI+ P  +  +P +     ++LR Y  Q      +  E+ + + +  C S+      ++ ++++  A+ ++  +     + +  I CE  S+++ V  +T    +D   + +R K ++PI I++++     +  +G
Sbjct:    8 YKNQHYSELKRECLQQKKLFEDPEFLCSNRSLFYRTPPPG------PVQWKRPG-MCEAPRLFVEGISAHDLNQGEVGNCWFVAACSCLALKPQLWQKVIPNWKEQEWDPDRPDRYTGIFHFQFWIFGEWTDVVVDDRLPTINGKLIYCHSKSNNEFWSALLEKAYAKLSGCYESLNGGNTGDAVVDFSGAVNEPVSLETGSFRTDSKTREKLFSDLLNVNDQGGIISCSIAASPHERELRLANGLVKGHAYSVTGVRRVRLGHG-LLAYFKNDTVDLIRMRNPWGKHEWRGAWSD---RWGNVLRTFLCVF---------CRMSFDDWCQNFTDVDVCRLMNTSVLSLQKRWREVVHFGSWIKHSEPLRNRSGGCMNHRQTFL----QNPQYILDLQDE--DELLVSLQQRDMKIHRAHGQGENLTIGFAIFKVELNRKYRMHDIITQQNVATSSYINARSVFLRKLLPKGRYIIIP--STFTPGILGD--FMLRVYANQD----LICRELDVDKPSVRCWSSFMGYPQVVTQVYVHGAEGLENQDSSGGADPYVIISCEKNSIQSEVQKDTRDPQFDIRAIFYRKKPNKPITIQVWNSNVVKDQFMG 582          
BLAST of Calpain 5a vs. Ensembl Sea Lamprey
Match: capn9 (calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2])

HSP 1 Score: 239.58 bits (610), Expect = 4.005e-70
Identity = 146/445 (32.81%), Postives = 236/445 (53.03%), Query Frame = 2
Query:  197 IEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRIC--LWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLM-CATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI-----IRPIKTGIFKYNSNWFGSMCKGYWTG--VAGDRQSALAEIGQGGQFKIEINNPKGDI---------FLCHLLQKCARGSEAALGILIIAVER--------NRDFMVH------TPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKP 1432
            ++W    E+  NP   + G++  D+ QG+LG+CWL++A+A L  + + L KV+P         N    Y G+F      W +GEW++V IDDRLP++NG+LVFVHS  K EFWSAL+EKAY+K+ GSYE+L GG   E+M DFTGG+ E + DLK      T   +LF+++    + GS+M C+   + + E E + +NGL+  HAYSITGV ++         +Y+   +  +R+RNPWG+ EWNG+ SD + EW ++   ++  +   +  DGEFWM  DD + +F ++ I      R  + G  +Y   W  ++  G W     AG  ++         QF+++++N   +          F+  L+QK  R  +  +  +  A+ +         ++F ++      +P F N+         R +  R+RL  G Y++ P
Sbjct:    2 VKWGLSREIVQNPEFIVDGATRTDIKQGALGDCWLLAAIASLTLNDQLLAKVVPPGQ------NFRDGYAGIFHFQQKFWHFGEWMDVFIDDRLPTKNGQLVFVHSADKREFWSALLEKAYSKLNGSYEALKGGSIAEAMEDFTGGVYE-LLDLK------TAPPDLFRIMCKARQKGSMMGCSIDVTNASESEARTSNGLVKGHAYSITGVDEV---------NYRGQKVKLLRIRNPWGEVEWNGAWSDHAPEWKALDQGERNRLQQVMAEDGEFWMSFDDFMRHFTKMEICNLTPDRVEREGDPRY---WTVTVHDGRWLKGCTAGGCRNFPETFWTNPQFRLKLHNEDDEADETGSKACSFIVALMQKNMRKQQRNMLTMGYAIYKIPDQTGPMPKEFFLYNASKARSPSFINL---------REVSQRFRLPAGEYVIVP 412          
BLAST of Calpain 5a vs. Ensembl Sea Lamprey
Match: capn3a (calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912-97])

HSP 1 Score: 219.935 bits (559), Expect = 3.178e-61
Identity = 170/536 (31.72%), Postives = 246/536 (45.90%), Query Frame = 2
Query:  119 TLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLM-----------CATIASRS------------------------DEMEEKLA----------NGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSN-WFGSMCKGYWTG--VAGDRQSALAEIGQGGQFKIEINNPKGDI--------FLCHLLQKCAR------GSEAALGILIIAV-ERNRDFMVHTPK----------FCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKN 1507
             LF D  F A + SI  S  Q      +W RP ELC+   + I  +  H +C+G LG+CW+++A+A +  + E L +VIP     E       +Y G+F    WR+GEW++VV+DDRLP+ N +LVFV S  +NEFWSAL+EKAYAKV GSYE+L GG T E+M DFTGG+ E  F++K   K      +L+K++       SLM           C   A  S                        D  + K+A           GL+  HAYSITG+ +++ +S           +  +RLRNPWG  EW G  SDAS+EW+ I+  +K  +      DGEFW+   D   NF ++ I       +    +N W  S+ +G W     AG  ++         Q+++++ +   D         F+  L+QK  R       +   +G  I  V E  R    H PK           CN  +       R +  R+RL  G Y++ P    A    +F    LLR +  + N
Sbjct:   65 VLFEDPDFPAHNNSIYFS--QNAPMQFQWMRPKELCVPRSIVIEANHTH-ICEGDLGDCWVLAAIACMTMNEELLARVIPAGQSFE------ENYAGIFHFQFWRFGEWVDVVVDDRLPTFNNQLVFVQSAERNEFWSALLEKAYAKVHGSYEALKGGNTTEAMEDFTGGVTE-YFEMKNPPK------DLYKIMVKATSRRSLMGCSIDDGMCWRCGVPAPDSIGLVRSNMSPPILRHIQLTPIGIEDAKKRKIAMLTHAESRTPMGLVRNHAYSITGLDEVKHRS---------KIVQLVRLRNPWGHVEWIGPWSDASKEWNEITPSEKQRLQLISAEDGEFWISFQDFCRNFTKLEICNLSPDALADDRTNKWTVSVSEGRWVRGCSAGGCRNYPDTFWTNPQYRLQLYDEDDDPDDNELLCSFIVALMQKNRRKERRQGSTMLTIGFAIYEVTEELRGSREHLPKDFFLYNASRARCNSYINL-----REVTERFRLPPGEYVIVPSTFEAHQEGEF----LLRVFAEKHN 566          
BLAST of Calpain 5a vs. Ensembl Sea Lamprey
Match: capn1a (calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc:ZDB-GENE-040426-1263])

HSP 1 Score: 211.846 bits (538), Expect = 5.038e-59
Identity = 158/531 (29.76%), Postives = 245/531 (46.14%), Query Frame = 2
Query:   53 RNFVFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSS----IEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIA--SRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSN-WFGSMCKGYW----TGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCH-------LLQKCARGSE------AALGILIIAVE-----------RNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPI 1540
            RNF    ++ +  +++E  +   LF D  F A   S+    +  +++     IEWKRP EL  +P   ++G++  D+ QG+L +CWL+SA+A L  +P+ L KV+P    Q +H      Y G+F     +YGEW++V +DDRLP++ G+LVFV S   NEFWSAL+EKAYAK+ G YE+L  G   E++ DFTGG+ E  F +    +      + +  +    K G+++C  I   + S   E+    GL+  HAYSITGV KL+         +    +  IR+RNP+G+ E+ G  SD S  W+ +  +D+  +  + E DGEFW+   D   NF+ + I         ++  N W   +    W          R     E     QF + +      + +CH       L QK  R           +GI I               R    +V +P+F            R + +R  L  G YI+ P    A    +F    LLR +  +      L S++ +
Sbjct:   21 RNFKT-KSKTFQEIKKECLQRKILFEDPDFPASLSSLHIRVQPTVITQSNNFIEWKRPWELVRHPEFIVSGATRADINQGTLPDCWLLSAIASLTLYPDLLAKVVPM--GQSFH----EDYAGIFLFRFCQYGEWVDVHVDDRLPTKKGELVFVQSGTGNEFWSALLEKAYAKLNGCYEALAYGFPVEALCDFTGGVGE-TFTMNNAPR------DYWDGISRAIKKGAIICCGIETLAASGRGEKVTPMGLVEGHAYSITGVIKLK---------FPGKTVQLIRVRNPYGKVEYTGPWSDGSTTWNEVPEEDQKRLHVRAE-DGEFWISDKDFRKNFHLVEICHQGSEVEIEHRKNLWICELHNSMWLKGLNAGGSRRHRVFKEFPLNYQFFLTLLEEDNVMDVCHGCHFLLSLTQKHRRKFRKIGIDFVPIGIYIYKAVVPGKKLTPQQLRKEKPLVESPEFI---------ARREVTMRMTLPPGNYIIIPCTESAGQEAQF----LLRIFMEKAQQHQGLASQLEV 514          
BLAST of Calpain 5a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000152.1 (pep scaffold:Pmarinus_7.0:GL488881:291:5685:-1 gene:ENSPMAG00000000135.1 transcript:ENSPMAT00000000152.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 184.882 bits (468), Expect = 5.596e-54
Identity = 105/248 (42.34%), Postives = 146/248 (58.87%), Query Frame = 2
Query:  287 GNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLM-CATIASRSDEM--EEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFW 1021
            G+CW ++A++ L  +   L +V+P    Q+  G R H+Y G+F    WRYGEW++VV+DDRLP+  GKL FV S   NEFW AL+EKAYAKVCGSYE+L  G   E++VDFTGG+ E       Y   +    +L+  L      GSL+ C+ +  R      E+K  +GL+  HAYSITGV ++++             +  +RLRNPWG+ EWNG+ SD+S  W  +    K  +  K+E DGEFW
Sbjct:    1 GDCWFLAAISSLTLNERLLGRVVPM---QQGFGTR-HAYAGIFHFKFWRYGEWVDVVVDDRLPTLKGKLAFVRSCESNEFWGALLEKAYAKVCGSYEALRSGRFTEALVDFTGGVKEH------YLLGEAPPPDLWLFLKRAENAGSLLSCSGVGERVPRTRPEQKTRDGLVLGHAYSITGVERVKVDG---------EVVELVRLRNPWGKVEWNGAWSDSSPVWKCVDCDAKRKLQVKLE-DGEFW 228          
BLAST of Calpain 5a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003998.1 (pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 gene:ENSPMAG00000003440.1 transcript:ENSPMAT00000003998.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 195.667 bits (496), Expect = 3.396e-53
Identity = 145/505 (28.71%), Postives = 236/505 (46.73%), Query Frame = 2
Query:  206 KRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLM------CATIASRSDEMEEKLANGLITTHAYSITGVCKLR------------------IKSTPMYE-----------------------HYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRPIKTGIFKYNSNWFGSMCKGYWTG--VAGDRQSALAEIGQGGQFKIEINNPKGDI--------FLCHLLQKCARGSEAALGILIIAVERNRDFMVHTPKFC-NVKLEYRLGGS-----------RSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKN 1507
            + P E+C NP   + G++  D+ QG+LG+CWL++A+A L  HP  L +V+P  + Q +       Y G+F    W++GEW++VVIDD LP++N KL F+HS  +NEFWSAL+EKAYAK+ GSYE+L GG   E+M DFTGG+ E  ++LKK         +L++++    +  S+M       +T   RS      ++    T  A+S +G+ +                    I+ T M++                        ++   +  +R+RNPWG+ EWNG+ SD S EW  +   ++  +      DGEFWM   D   NF+++ I  + P        + +W  +  +G W     AG  ++         QF + ++    D         F+  L+QK  R  +  L  +  A+    +  +  P  C ++  E+ +  S           R +  R+RL  G Y++ P  +   P  +    +LLR Y  + N
Sbjct:    1 RAPQEICYNPQFIVNGATRTDIKQGALGDCWLLAAIASLTLHPRLLARVVP--EGQSF----SDGYAGIFHFQFWQFGEWVDVVIDDLLPTQNNKLAFLHSTDRNEFWSALLEKAYAKLNGSYEALKGGSIAEAMEDFTGGVFE-FYNLKKAPP------DLYRIMRKGLEKASMMGCSIDEGSTFKYRSTPRAINMSKMTATFRAWS-SGIRRFAERFLPSRLGHARLLASSGIEITSMFDLEARLPNGLVKGHAYSITGLDQVFFEGQDVRLVRIRNPWGEVEWNGAWSDNSWEWRVVDVSERRRLEQVRAEDGEFWMSFSDFKRNFSKMEICNLSPDTLRTQSGSRHWTVTAHEGRWLRGCTAGGCRNYAGTFWTNPQFHLRLHEEDDDPDDDEVACSFIVALMQKNMRRQKRDLLTIGYAIY---EIPLKAPPGCTHLPGEFFVRNSSRARSHNFINLREVSDRFRLPPGHYVIVP--STYEPHQEAD--FLLRVYCEKMN 484          
BLAST of Calpain 5a vs. Ensembl Nematostella
Match: EDO34860 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SN59])

HSP 1 Score: 357.836 bits (917), Expect = 2.153e-113
Identity = 219/616 (35.55%), Postives = 323/616 (52.44%), Query Frame = 2
Query:   65 FFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELC--INPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQI-FDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIA-SRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTG----------IFKYNSNWFGSMCKGYWTGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSEA------ALGILIIAVERNRDFMVHT--PK-----FCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCE----IDCENQSLRTTVNCNTSGLFWDETFLLH-RSKMDRPIIIKIFHRGRFFNTLIG 1816
            +F NQ Y  ++ E +KN  LF D  F  +  S+  S +      +EWKRPSE+C    P LF+ G+  HDV QG LGNCW V+A + LA  P  L KVIP+ D QEW   +P +Y G+FR   +R GEW EVV+DD LP+ NGKLV++HSK KNEFWSALIEKAYAK+ G+YE+L  G T +++VDFTGG+ E I      Y++   +   LFK L    K+ SLM A+I  +  +EME++L  GLI  HAY +T V K+ +    +   + K H   IRLRNPWG+KEWNG  SD SEEW  +   D+  MG   ENDGEFWM  DD    F + T+   I             I+K+N NW      G   G   ++ + L    +  Q+   I + +G+  +  L+Q+  R  ++       +G  I+ VE NR + VH+  PK     F N         +R +  R+ L  G Y+V P  +   P    P ++++R +T +++N  FL  +  +  +   C   C    C +  +        ++   +++ C+    I CE + ++T +  +T    WD   L + R      I+++I+      ++ +G
Sbjct:    6 YFANQRYSKLKAECEKNEQLFVDSVFKPETSSLYYS-RSCPPEPVEWKRPSEICHPAVPHLFVDGADSHDVTQGKLGNCWFVAACSSLALRPFLLYKVIPDKDKQEWDPKKPENYQGIFRFRFYRQGEWTEVVVDDLLPTVNGKLVYIHSKEKNEFWSALIEKAYAKLAGTYEALAAGSTADALVDFTGGVAEAISLSNGGYAEDQEKRLQLFKTLERGHKEKSLMSASIKINNRNEMEQRLDTGLIKGHAYGVTMVKKVTV-GEGLLSLFNKKHFYMIRLRNPWGEKEWNGRWSDESEEWKKLKPGDRKKMGIVFENDGEFWMEFDDFCREFTDCTLCHVINKAMIHKVFKQWHIYKHNYNWTQGQNAG---GCVQNQDTFL----KNPQYAFSITDNEGEDAMVSLMQEDRRKDKSKGVGNLTIGFYIMKVEENRKYRVHSMFPKAGDSIFIN---------AREVMNRFFLAAGRYLVVP--STYEPHT--PGHFMMRIFTRKRSNAMFLDQDHSVGSKIWCCLPRCRAPQCVV-SVYVTSAAGLQKTGKMSLTCDPYALIICEGRKIKTPIKYDTLIPSWDAGALFYVRQPQKSQIVVQIWDSNWILDSFMG 598          
BLAST of Calpain 5a vs. Ensembl Nematostella
Match: EDO40193 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S7W7])

HSP 1 Score: 282.337 bits (721), Expect = 1.263e-84
Identity = 183/500 (36.60%), Postives = 271/500 (54.20%), Query Frame = 2
Query:   92 MRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGN-RPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCK-GYWTG--VAGDRQSALAEIGQGGQFKIEINNPKGD-----IFLCHLLQKCARGSEA------ALGILIIAVERNRD---------FMVH-----TPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQ 1501
            +R++ +     F DD F A D SI  S +       EWKRPS++C +P +F+ G+S  D+ QG LG+CWL++A+A L QH   + KV+P    Q++  N    +YTG  + C+W+YGEW +V+IDDRLP+ NGKLVFVHS  +NEFWSAL+EKAYAK+ GSYESL GG T E++ DFTGG+ E  FDL K    D     LF ++    K  +LM  +IA++++E+E KL NGL+  HAY++TG  +++ K+           +  +R+RNPWG ++EW G+  D S EW  +S  +K ++G   E+DGEFWM  DD   +F  + I         + +S  F S  + G W     AG  ++ +    +  QF+I + +   D       +  L+QK  R  +        +G  I  +E  +D         F  H     +P F N         SR +  RY L  G Y+V P  T  +P+ +    ++LR Y+ +
Sbjct:    9 VRRQVRSTGKPFEDDEFLAIDSSIFFSKRPP--RPFEWKRPSDICEDPHMFVGGASRLDIQQGMLGDCWLLAAIAALTQHSALMNKVVP----QDYVANPNDRNYTGALKFCIWQYGEWKDVIIDDRLPTYNGKLVFVHSSERNEFWSALLEKAYAKLNGSYESLKGGQTGEALEDFTGGLAES-FDLNKNVPKD-----LFCIMQTAEKRHALMGCSIAAKANEIEAKLNNGLVKGHAYTVTGCRQVKAKT-----RRGDLDVELVRVRNPWGNEREWKGAWGDGSSEWQLLSDYEKKSIGLTFEDDGEFWMSFDDFKKHFTTLEICMLGADSAMEGSSVGFESRSEHGMWRRGLTAGGCRNFIKTFHKNPQFRITLQDSDDDADDLCTVIIALMQKDRRKEKKHGINPLTIGFSIYKLEEEKDKQGNLDMEFFQYHASTARSPVFIN---------SREVVGRYALPPGEYVVIP--TTFNPNEEGN--FVLRMYSEK 478          
BLAST of Calpain 5a vs. Ensembl Nematostella
Match: EDO48633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ83])

HSP 1 Score: 234.572 bits (597), Expect = 2.854e-67
Identity = 164/477 (34.38%), Postives = 236/477 (49.48%), Query Frame = 2
Query:   77 QNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASR---SDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQ-KEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYN-SNWFGSMCKGYWT-GV-AGDRQSALAEIGQGGQFKIEINNP-KGDIFLCHLLQKCAR---------GSEAALGILIIAVER--------NRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKP 1432
            + + S++++   +  LF D  F A ++ +    +   L    WKRP E+  +P     G S  DV QG + NCW V+ALA L  + + L  V P   DQ +    P SY GMFR   W++GEW+E+++DD LP+ NG+L F  S   +EFWSAL+EKAYAK+CGSYE++  G   E++ D TGG+ E + DL+           LF ++   ++  SLM  +I  +   SD+ E  L NGLIT HAYSITG+ K  + S        +  +  IRLRNP     EW G+ SD S EW+ +S ++K  +    ++DGEFWM  DD L NF  + I       + + +   W     KG W  GV AG  ++ +A      QF++ + NP   D  LC ++    R            A +G  I             +R F  +      V +       R I  RYRL  G Y+V P
Sbjct:   10 ERFASLQRQLLNSKRLFEDRDFPASNRVLFTRRRSVQLI---WKRPHEISKSPQFIARGFSSSDVAQGRIRNCWFVAALADLTTNIDLLHHVCP--PDQSFE---PGSYCGMFRFNFWQFGEWVEIIVDDYLPTYNGRLYFTKSDDPDEFWSALLEKAYAKLCGSYEAMSLGRISEALQDMTGGMIENV-DLQ------NPPHGLFNVMMKAYERQSLMGCSIEVKKYSSDQYEGTLENGLITRHAYSITGLRKATLSSL-----RGRPEVDLIRLRNPHANSSEWRGAWSDRSPEWNMLSSQEKRELNLTFDDDGEFWMSFDDFLNNFTRLEICMLTPDSMEQNDRRKWDVQNEKGRWQKGVTAGGCRNFIASFYTNPQFRVCLKNPDDDDDELCTVIVSLMRVDHSHRVKIPDRAPIGFAIYKAPSDMRKGDRLDRAFFEYNKA---VAMTTSFSKLREISSRYRLHAGEYVVIP 463          
BLAST of Calpain 5a vs. Ensembl Nematostella
Match: EDO48536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJ84])

HSP 1 Score: 203.371 bits (516), Expect = 3.087e-56
Identity = 115/310 (37.10%), Postives = 174/310 (56.13%), Query Frame = 2
Query:  218 ELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNR-PHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI-IRPIKTGIFKYNSNWFGSMCKGYW 1138
            E+C  P  ++ G+S  D+ QG LGNCWL++A++VLAQH   + +++P   +  +  +R    YTG     LW+YGEW+ V+IDDRLP+  GKLVFVHS  KNEFW AL+EKAYAK+ GSYE+L GGLT E++ DFTGG+ E +F L+          NLF+++    K  +LM  +I            N  ++T                       +  +  IR+RNPWG +KEW G+  D S EW  +S  +K ++  + + DGEFWM  +D   +F+++ + +  ++  I K   ++   +  G+W
Sbjct:   12 EICSEPRFYVDGASRLDIKQGVLGNCWLLAAMSVLAQHKPLVDRIMP---EGVYEADRFSPRYTGKVVFKLWQYGEWVTVIIDDRLPTYKGKLVFVHSPEKNEFWCALLEKAYAKIHGSYEALKGGLTGEALEDFTGGLSE-VFVLEDAPA------NLFQIMQRAEKRSALMGCSI------------NVFLST-----------------------RGGVELIRIRNPWGDEKEWTGAWGDRSPEWQELSQDEKRSLDLEFDVDGEFWMSFEDFKSHFDKLEVCMLDVENAIDKTQISFNSRLENGFW 276          
BLAST of Calpain 5a vs. Ensembl Nematostella
Match: EDO37991 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SE78])

HSP 1 Score: 130.954 bits (328), Expect = 1.092e-31
Identity = 102/329 (31.00%), Postives = 157/329 (47.72%), Query Frame = 2
Query:  125 FCDDTFGADDKSISPSGKQ-EILSSIEWKRPSEL-----CIN--PCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLP-SRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQI-FDLKKYSKSDTE---MENLFKLLHFDWKDGSLMCATIASRSDEMEEKLAN--GLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI 1066
            F DD+F    KS+  + +  E     +W RP+E+     C    P          D+ QG LG+CW +S+LAVLA+ PE L+K++           R  S  G +++ L + G+W  ++IDD LP ++ G+ V+  +  + + W  LIEKA AK+ GSYE+L  G + E +   TG   E I     + +  +TE    + ++  L      G LM A+    +   EE   N  GL T HAYS+  V  +             + +  +RLRNPWGQ  W G  SDAS  W      + +  G     +G FWM ++D +  F+ + +
Sbjct:   44 FVDDSFPPVLKSLYINPRHSEHPRVADWLRPNEIDNFSTCRTNIPWAVFRNPRPSDIIQGVLGDCWFLSSLAVLAERPELLEKILI---------TREVSPQGAYQVRLCKDGKWTVILIDDLLPCNQRGQPVYSWAH-RRQLWVPLIEKAMAKLHGSYEALTAGRSIEGLATLTGAPCESIALHESQNNSGNTEPIDKDLIWAQLISSRTAGFLMGASCGGDTQPEEEPGYNAVGLQTHHAYSVLDVRDV-------------HGIRLLRLRNPWGQYSWTGDWSDASSLWTPELRHELMVHG---AQEGVFWMSLEDFMKYFDSVDV 346          
BLAST of Calpain 5a vs. Ensembl Medaka
Match: ENSORLT00000002598.2 (calpain-5 [Source:NCBI gene;Acc:101166153])

HSP 1 Score: 355.91 bits (912), Expect = 2.587e-112
Identity = 211/611 (34.53%), Postives = 332/611 (54.34%), Query Frame = 2
Query:   62 VFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKK--YSKSDTEMENLF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-----------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICK-SNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            V +  Q++ ++R+  Q+   LF D  F   DKS+   G +  +  + WKRP EL  +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  +QEW   +P SY G+F    WR+GEW++VVIDD LP+ +G+L++ HS   NEFWSAL+EKAYAK+ G YE+L GG T +++VDFTGG+ E I DL +  Y + D + + LF ++L    + G + C+  A+ + +ME +L  GL+  HAY++T V ++R+    +   ++ + L  IR+RNPWGQKEWNG  SD+SEEW  +S  ++  MG  V++DGEFWM  DD L NF ++ + R I T     +  W   + +G W            G + ++ S      Q  Q+  ++  P+ ++ +C          K  RG    +G  I  VE NR + +H         + ++GG     SR++ LR  L  G Y++ P    A    +F    LLR +T   +N   L  + P   R+C         ++ ++++ QA+ +   +   V + +  I CE Q +R+ V+ NT    +D   L +R K  +PI ++I++   F ++ +G
Sbjct:    3 VPYEGQSFSALRKRCQQKGCLFEDPLFPPSDKSLFYEGNR--VGQVVWKRPGELSSDPHLFVDGISAHDLHQGQLGNCWFVAACSSLASREALWQKVIPDWKEQEWDKEKPQSYAGIFHFRFWRFGEWVDVVIDDLLPTVSGQLLYGHSNDHNEFWSALVEKAYAKMFGCYEALDGGNTADALVDFTGGVSEPI-DLIQNGYKEDDEKRDELFERVLKVHNRGGLISCSIRATSAADMEARLGCGLVKGHAYAVTDVRRVRL-GHGLLAFFKSDKLSMIRMRNPWGQKEWNGPWSDSSEEWKKVSKSEREKMGVTVDDDGEFWMTFDDFLTNFTDLILCRLINTSYLSLHKTWEEVVVRGSWRRHDEPLRNRAGGCSNNKHSHF----QNPQYVFDVTKPEDEVMVCLQQKDRRATLKEGRGENLPIGFDIQKVELNRVYRMHAA-------QQKVGGSIYINSRAVFLRIDLKKGRYVIVPTTFEAGLEGEF----LLRIFTDVPSNCRELTLDEP--RRSCWSGLRGYPSLVTQVYVQQANGLAGQDSDRVSDPYVIIRCEGQEVRSDVHKNTCSPVFDTKALFYRKKSKQPISVEIYNHNVFKDSFLG 592          
BLAST of Calpain 5a vs. Ensembl Medaka
Match: capn5b (calpain 5 [Source:NCBI gene;Acc:101155135])

HSP 1 Score: 337.035 bits (863), Expect = 2.892e-104
Identity = 204/606 (33.66%), Postives = 328/606 (54.13%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMEN-LF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNC---ICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            F+ Q Y +++++  ++  LF D  F A D S+   G +  +  + WKRP ELC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  +QEW   +P SYTG+F    WR+GEW++VVIDDRLP+ + +LV+ HS   NEFWSAL+EKAYAKV G YE+L GG T +++VDFTGG+ E +  L+    +D    N LF ++L    +DG + C+  A+  ++ME +L  GL+  HAY++T V K+R+    +   ++   L  IR+RNPWG+KEW+G  SD+SEEW+ +S  ++  +G  V++DGEFWM  DD    F ++ + R I T     +  W   + +G W          AG   +  +   Q  Q+  ++   + ++ +C          K  +G   A+G  I  VE NR + +HT        + ++ G     SR + LR  +  G Y++ P  T   P  +    +LLR +T   ++   L  + P   + C   +C      ++ ++H++ A+ +Q  +    ++ +  I CE + +R+ V  +T    +D   L +R K    I I++++R    +T +G
Sbjct:   80 FDGQQYSTLKRQCLQSGLLFEDPRFPAIDDSLFYLGNR--IGRVVWKRPRELCEDPHLFVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWKEQEWDTEKPDSYTGIFHFRFWRFGEWVDVVIDDRLPTVDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPVDLLEGQMATDEAARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLQMIRMRNPWGEKEWSGPWSDSSEEWNKVSKSEREKLGVTVQDDGEFWMTFDDFCQYFTDLILCRLINTSYLSIHKTWEEEVIRGLWVHRQDPLRNRAGGCINHKSTFLQNPQYVFDVKKLEDEVLICLQQKERRATPKEGKGENLAIGFDIHRVELNRKYRMHT-------AQQKVAGSIYINSRCVFLRKEMKEGRYVIIP--TTFDPGQQGE--FLLRVFTDVPSDCKELTLDEP--PQTCWTGMC--GYPQLVTQVHVLNAEGLQGQDSNGAVDSYVVITCEGERVRSPVQKDTRCPNFDFKGLFYRKKPKEGIHIEVYNRNMIVDTFLG 667          
BLAST of Calpain 5a vs. Ensembl Medaka
Match: ENSORLT00000039414.1 (calpain-5 [Source:NCBI gene;Acc:101158220])

HSP 1 Score: 327.02 bits (837), Expect = 2.995e-101
Identity = 197/618 (31.88%), Postives = 318/618 (51.46%), Query Frame = 2
Query:   47 FSRNFVFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSI----SPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQI-FDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT----------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNC-TIIICRLHXXXXXXXXXXEELD------VLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
             S + V F NQ Y  +++E  +   LF D  F ADD S+     P GK      +EWKRP ++  +P LF+ G + HD+ QG +GNCW V+A + LA  P   +KVIP+  +QEW    P +Y G+F    W +G+W +VV+DDRLP+ NGKL++ HS  K EFWSAL+EKAYAK+ G YESL GG   +++VDFTG + E+I  + + + K     + LF+ L   ++ G ++  +I ++ DE+E K+ANGL+  HAYS+T V ++ +    +  H++   L  IR+RNPWG+ EWNG+ SD+SEEW  I   ++  +G  VE+DGEFWM  +D    F +  +   I T +   +  W   +  G WT          G  G+  + L    Q  Q+  ++     ++ +          +K  +G   ++G  ++ VE NR + +H               +RS+ +R  L  G YI+ P    A    +F    +LR +T   +    L  + P        K  C T +      +    ++ AE L+        + +  I CE +S+++ V+ +T    +D + + +R K  +PI +++++     +  +G
Sbjct:    1 MSSSVVPFKNQRYADLKRESIQRKILFRDPEFPADDSSLFYKEPPPGK------VEWKRPWKISSDPHLFVEGINSHDLYQGEIGNCWFVAASSCLAMMPHLWQKVIPDWQEQEWDPKHPENYAGIFHFQFWVFGQWTDVVVDDRLPTINGKLIYCHSNSKKEFWSALLEKAYAKLYGCYESLSGGFAGDAVVDFTGAVYERIDLEREAFYKDQRNQDYLFENLLKVYEHGGIISCSIKAKPDELEFKMANGLVKGHAYSVTAVKRIHL-CHELVAHFKTETLPMIRMRNPWGKMEWNGAWSDSSEEWSKIGDTERHNLGLTVEDDGEFWMSFEDWCKKFTDADVCSIINTSLVSIHKTWSEVLHFGSWTKHGDPLLNRCGGCGNNNTFL----QNPQYMFDVTKEIEEVLITLQQKDRRTFKKTGQGENLSIGFSVLKVELNRKYRIHRLLSQKSMESSVFINARSVFVRCILPQGRYIIIPSTFQAGELGEF----MLRIFTDVDSGCRELTEDKP--------KVKCWTPLFGYPQAVTHVFVEKAERLENQDRTAGADPYVIISCEGKSVKSIVHKDTLNPQFDTSAVFYRKKPSKPITVEVWNSNAVADEFMG 595          
BLAST of Calpain 5a vs. Ensembl Medaka
Match: capn5b (calpain 5 [Source:NCBI gene;Acc:101155135])

HSP 1 Score: 328.946 bits (842), Expect = 4.680e-101
Identity = 202/622 (32.48%), Postives = 321/622 (51.61%), Query Frame = 2
Query:   68 FNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMEN-LF-KLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT-------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGG-----SRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMP-------------------ILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            F+ Q Y +++++  ++  LF D  F A D S+   G +  +  + WKRP ELC +P LF+ G S HD+ QG LGNCW V+A + LA      +KVIP+  +QEW   +P SYTG+F    WR+GEW++VVIDDRLP+ + +LV+ HS   NEFWSAL+EKAYAKV G YE+L GG T +++VDFTGG+ E +  L+    +D    N LF ++L    +DG + C+  A+  ++ME +L  GL+  HAY++T V K+R+    +   ++   L  IR+RNPWG+KEW+G  SD+SEEW+ +S  ++  +G  V++DGEFWM  DD    F ++ + R I T     +  W   + +G W          AG   +  +   Q  Q+  ++   + ++ +C          K  +G   A+G  I  VE NR + +HT        + ++ G     SR + LR  +  G Y++ P  T   P  +    +LLR +T   ++   L  + P                   +L    +   +       LH +     +   +   ++ +  I CE + +R+ V  +T    +D   L +R K    I I++++R    +T +G
Sbjct:   80 FDGQQYSTLKRQCLQSGLLFEDPRFPAIDDSLFYLGNR--IGRVVWKRPRELCEDPHLFVDGISAHDLHQGQLGNCWFVAACSSLASRESLWQKVIPDWKEQEWDTEKPDSYTGIFHFRFWRFGEWVDVVIDDRLPTVDNQLVYCHSNDSNEFWSALVEKAYAKVYGCYEALDGGNTADALVDFTGGVSEPVDLLEGQMATDEAARNQLFERVLKVHNRDGLISCSIRATTVEDMEARLDCGLVKGHAYAVTDVRKVRLGHG-LLAFFKSEKLQMIRMRNPWGEKEWSGPWSDSSEEWNKVSKSEREKLGVTVQDDGEFWMTFDDFCQYFTDLILCRLINTSYLSIHKTWEEEVIRGLWVHRQDPLRNRAGGCINHKSTFLQNPQYVFDVKKLEDEVLICLQQKERRATPKEGKGENLAIGFDIHRVELNRKYRMHT-------AQQKVAGSIYINSRCVFLRKEMKEGRYVIIP--TTFDPGQQGE--FLLRVFTDVPSDCKELTLDEPPQTCWTGMCGYPQLVTQVHVLNAEGLQGQDSN---GELHCLNPQKKRLLGKAQAVDSYVVITCEGERVRSPVQKDTRCPNFDFKGLFYRKKPKEGIHIEVYNRNMIVDTFLG 684          
BLAST of Calpain 5a vs. Ensembl Medaka
Match: ENSORLT00000028657.1 (calpain-5 [Source:NCBI gene;Acc:101158220])

HSP 1 Score: 322.783 bits (826), Expect = 9.791e-100
Identity = 195/617 (31.60%), Postives = 315/617 (51.05%), Query Frame = 2
Query:   50 SRNFVFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSI----SPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQI-FDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWT----------GVAGDRQSALAEIGQGGQFKIEINNPKGDIFLC------HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNC-TIIICRLHXXXXXXXXXXEELD------VLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIG 1816
            S + V F NQ Y  +++E  +   LF D  F ADD S+     P GK      +EWKRP ++  +P LF+ G + HD+ QG +GNCW V+A + LA  P   +KVIP+  +QEW    P +Y G+F    W +G+W +VV+DDRLP+ NGKL++ HS  K EFWSAL+EKAYAK+ G YESL GG   +++VDFTG + E+I  + + + K     + LF+ L   ++ G ++   I +   E+E K+ANGL+  HAYS+T V ++ ++   +  H++   +  IR+RNPWG+ EWNG  SD+SEEW  I   ++  +G  VE+DGEFWM  +D    F +  +   I T +   +  W   +  G WT          G  G+  + L    Q  Q+  ++     ++ +          +K  +G   ++G  ++ VE NR + +H               +RS+ +R  L  G YI+ P    A    +F    +LR +T   +    L  + P        K  C T +      +    ++ AE L+        + +  I CE +S+++ V+ +T    +D + + +R K  +PI +++++     +  +G
Sbjct:    2 SSSVVPFKNQRYADLKRESIQRKILFRDPEFPADDSSLFYKEPPPGK------VEWKRPWKISSDPHLFVEGINSHDLYQGEIGNCWFVAASSCLAMMPHLWQKVIPDWQEQEWDPKHPENYAGIFHFQFWVFGQWTDVVVDDRLPTINGKLIYCHSNSKKEFWSALLEKAYAKLYGCYESLSGGFAGDAVVDFTGAVYERIDLEREAFYKDQRNQDYLFENLLKVYEHGGIISCGITAEPHELEFKMANGLVKGHAYSVTAVKRIHLRHE-LVAHFKTETIPMIRMRNPWGKMEWNGPWSDSSEEWSKIGDTERHNLGLTVEDDGEFWMSFEDWCKKFTDADVCSIINTSLVSIHKTWSEVLHFGSWTKHGDPLLNRCGGCGNNNTFL----QNPQYMFDVTKEIEEVLITLQQKDRRTFKKTGQGENLSIGFSVLKVELNRKYRIHRLLSQKSMESSVFINARSVFVRCILPQGRYIIIPSTFQAGELGEF----MLRIFTDVDSGCRELTEDKP--------KVKCWTPLFGYPQAVTHVFVEKAERLENQDRTAGADPYVIISCEGKSVKSIVHKDTLNPQFDTSAVFYRKKPSKPITVEVWNSNAVADEFMG 595          
BLAST of Calpain 5a vs. Planmine SMEST
Match: SMESG000009459.1 (SMESG000009459.1)

HSP 1 Score: 1282.7 bits (3318), Expect = 0.000e+0
Identity = 626/626 (100.00%), Postives = 626/626 (100.00%), Query Frame = 2
Query:   92 MRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNMVFEPKLKTPCTKIRNLKITQFHTDNQKYL 1969
            MRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHIIQADIIQAAEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNMVFEPKLKTPCTKIRNLKITQFHTDNQKYL
Sbjct:    1 MRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHIIQADIIQAAEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNMVFEPKLKTPCTKIRNLKITQFHTDNQKYL 626          
BLAST of Calpain 5a vs. Planmine SMEST
Match: SMESG000009459.1 (SMESG000009459.1)

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 328/328 (100.00%), Postives = 328/328 (100.00%), Query Frame = 2
Query:  986 MGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHXXXXXXXXXXEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNMVFEPKLKTPCTKIRNLKITQFHTDNQKYL 1969
            MGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHIIQADIIQAAEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNMVFEPKLKTPCTKIRNLKITQFHTDNQKYL
Sbjct:    1 MGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFGSMCKGYWTGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLCHLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCICKSNCTIIICRLHIIQADIIQAAEELDVLNIFCEIDCENQSLRTTVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDSRHLNSPEVIETLNMVFEPKLKTPCTKIRNLKITQFHTDNQKYL 328          
BLAST of Calpain 5a vs. Planmine SMEST
Match: SMESG000017238.1 (SMESG000017238.1)

HSP 1 Score: 299.286 bits (765), Expect = 9.558e-90
Identity = 189/527 (35.86%), Postives = 273/527 (51.80%), Query Frame = 2
Query:   77 QNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTE-MENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITI--IRPIKTG-IFKYNSN---WFGSMCKGYWT--GVAGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARG------------------SEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPILERNCI 1558
            ++Y S++++     TL+ D+ F A+ +SI  +  +    + +WKRP E+C +P  F+ G+S  DVCQG LG+CWL++A+A L+       +V PN  DQ +   +   Y G F    W YGEW E++IDDRLP+RN +LVF+HS+  NEFWSAL+EKAYAK+CGSYE L GG + E+M DFTGGI E I DLK  ++ + E  E LF+++       SLM  +I +     E KL NGLI  HAYSIT V ++  K       Y  + +  +R+RNPWGQ EWNG   D+S+ WH IS K++  +G   +NDGEFWM  +D + NF ++ I  + P   G     NSN   W  S+ +G W     AG   +         QF+I + +P  D        +  LLQK  R                        G L     R    +  +P F N+         R +C R+RL  G+Y + P     +    F    LLR ++ + N G  +     + ++N +
Sbjct:   90 ESYDSLKEKLVAKGTLYEDEDFPANGESIYFTSNKG--GNFQWKRPHEICSDPQFFVGGASRFDVCQGELGDCWLLAAVASLSMQTMLFSQVAPN--DQSFAKGK---YCGAFHFNFWHYGEWKEIIIDDRLPTRNNRLVFMHSRDSNEFWSALLEKAYAKLCGSYELLKGGSSSEAMEDFTGGITE-IIDLKGDNRKNNESKEKLFQIMIQSHSKMSLMGCSIDANPKVTEAKLGNGLIMGHAYSITAVKQISAK----VPGYNGDIIKLVRIRNPWGQSEWNGEWGDSSDSWHHISDKERGVLGLNFDNDGEFWMSFNDFVNNFEKLEICHLGPQSVGESLLKNSNKRTWESSVQQGAWKKGASAGGCLNFQETFWSNPQFRIVVTDPDKDDTDNMGTVIIGLLQKNMRSIKNRGNDLFPIGYVLYKLPSTDCGPLDKVFFRTNRKVAMSPAFINM---------REVCGRHRLPPGSYAIIPSTFEVNQEADF----LLRIFSERANCGKEIDETSKMDDKNLV 591          
BLAST of Calpain 5a vs. Planmine SMEST
Match: SMESG000062902.1 (SMESG000062902.1)

HSP 1 Score: 265.003 bits (676), Expect = 2.470e-77
Identity = 181/508 (35.63%), Postives = 263/508 (51.77%), Query Frame = 2
Query:   80 NYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFG----SMC--KGYWTG--VAGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARGSEAALGILIIAVE-----------RNRDF------MVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKN 1507
            +Y  + ++ +    L+ D  F AD  S+  S   +     EWKRP ++C NP LF  G S  DV QG+LG+CWL++ +A L+ +    K V+P   DQ++  N    Y G FR   WR+G+W+EVV+DDRLP+  GKLVF+HS   NEFWSAL+EKAYAK+CG YESL GG   E+M DFTGG+ E I    K ++ +  +    ++L F  K  +LM   I S   ++E  +ANGLI+ HAYSIT V K++     + E         +R+RNPWG +KEW G  SD+S EW +IS  +K  +     NDGEFWM  DD   NF +I I      G    N +  G     MC   G W     AG  ++ +       QF++E+ +P  +        +  L+QK  R  +  LG L+I               N+ F      +  +P F N          R +C R++L  G Y++ P  +  +P+ +    ++LR ++ + N
Sbjct:   51 SYSDLLEQLKGTGKLWEDPDFPADTSSVFVSKASKGYREFEWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPT--DQDFDKN----YIGAFRFRFWRFGKWVEVVVDDRLPTYGGKLVFMHSADNNEFWSALLEKAYAKMCGIYESLSGGSQIEAMEDFTGGLCETI----KLNEKERPVGLYNQMLKFA-KQSTLMGCAIESA--KIEGVMANGLISGHAYSITDVQKVKQTDGTVVE--------LVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICH---LGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSENTGTVIIGLMQKDMR--QRNLGFLVIGYVIYKLKDPNCGLLNKSFFKFSTTVAKSPGFIN---------QREVCGRHKLPTGHYVIIP--STFNPNEE--ANFMLRIFSEKPN 519          
BLAST of Calpain 5a vs. Planmine SMEST
Match: SMESG000062904.1 (SMESG000062904.1)

HSP 1 Score: 263.077 bits (671), Expect = 9.407e-77
Identity = 182/508 (35.83%), Postives = 263/508 (51.77%), Query Frame = 2
Query:  101 EHQKNL-TLFCDDTFGADDKSISPSGKQEILSSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPECLKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGKLVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQIFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGLITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWG-QKEWNGSLSDASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGIFKYNSNWFG----SMC--KGYWTG--VAGDRQSALAEIGQGGQFKIEINNPKGD------IFLCHLLQKCARGSE---AALGILIIAVER------NRDF------MVHTPKFCNVKLEYRLGGSRSICLRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSE 1531
            EH K    L+ D  F AD  S+  S   +     EWKRP ++C NP LF  G S  DV QG+LG+CWL++ +A L+ +    K V+P   DQ++  N    Y G FR   WR+G+W+EVV+DDRLP+  G+LVF+HS   NEFWSAL+EKAYAK+CG YESL GG   E+M DFTGG+ E I    K ++ +  +    ++L F  K  +LM   I S   ++E  +ANGLI+ HAYSIT V K++     + E         +R+RNPWG +KEW G  SD+S EW +IS  +K  +     NDGEFWM  DD   NF +I I      G    N +  G     MC   G W     AG  ++ +       QF++E+ +P  +        +  L+QK  R        +G +I  ++       N+ F      +  +P F N          R +C R++L  G Y++ P  +  +P+ +    ++LR ++ ++N    L  E
Sbjct:   57 EHLKGTGKLWEDPDFPADTSSVFVSKASKGYREFEWKRPKDICKNPQLFADGVSRFDVQQGALGDCWLLAVVASLSLYEPIFKNVVPT--DQDFDKN----YIGAFRFRFWRFGKWVEVVVDDRLPTYRGRLVFMHSADNNEFWSALLEKAYAKMCGIYESLNGGSQIEAMEDFTGGLCETI----KLNEKERPVGLYNQMLKFA-KQSTLMGCAIESA--KIEGVMANGLISGHAYSITDVQKVKQTDGTVVE--------LVRVRNPWGNEKEWKGKWSDSSPEWETISKSEKERLCSNFANDGEFWMTFDDFAKNFTKIEICH---LGPESLNEDLSGKRRWEMCIEDGSWCKNINAGGCRNFIDSFVTNPQFRVEVVDPDDEDSEDTGTVIIGLMQKDMRQRNLDFLVIGYVIYKLKDPNCGLLNKSFFKFSTTVAKSPGFIN---------QREVCGRHKLPTGHYVIIP--STFNPNEE--ANFMLRIFSEKQNKSKELDVE 527          
The following BLAST results are available for this feature:
BLAST of Calpain 5a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CAPN51.539e-10432.80calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482][more]
CAPN51.539e-10432.80calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482][more]
CAPN51.539e-10432.80calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482][more]
CAPN51.102e-9630.82calpain 5 [Source:HGNC Symbol;Acc:HGNC:1482][more]
CAPN87.765e-7741.45calpain 8 [Source:HGNC Symbol;Acc:HGNC:1485][more]
back to top
BLAST of Calpain 5a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tra-31.916e-9734.00Calpain-5 [Source:UniProtKB/Swiss-Prot;Acc:Q22036... [more]
clp-61.110e-7039.08CaLPain family [Source:UniProtKB/TrEMBL;Acc:Q9N4B... [more]
clp-13.580e-7035.06Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-15.391e-7035.06Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
clp-15.391e-7035.06Calpain clp-1 [Source:UniProtKB/Swiss-Prot;Acc:P3... [more]
back to top
BLAST of Calpain 5a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CalpA2.311e-7935.84gene:FBgn0012051 transcript:FBtr0086530[more]
CalpA8.358e-7735.84gene:FBgn0012051 transcript:FBtr0112869[more]
CalpA8.358e-7735.84gene:FBgn0012051 transcript:FBtr0086529[more]
CalpA1.085e-7635.84gene:FBgn0012051 transcript:FBtr0340532[more]
CalpB1.538e-7636.04gene:FBgn0025866 transcript:FBtr0076343[more]
back to top
BLAST of Calpain 5a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn5a3.486e-11435.15calpain 5a [Source:ZFIN;Acc:ZDB-GENE-061103-214][more]
capn5a3.486e-11435.15calpain 5a [Source:ZFIN;Acc:ZDB-GENE-061103-214][more]
capn5a1.432e-10937.67calpain 5a [Source:ZFIN;Acc:ZDB-GENE-061103-214][more]
capn5b3.102e-10133.28calpain 5b [Source:ZFIN;Acc:ZDB-GENE-091116-29][more]
BX324225.21.404e-9833.00calpain 5b [Source:NCBI gene;Acc:100006332][more]
back to top
BLAST of Calpain 5a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppa22.110e-9637.43pyrophosphatase (inorganic) 2 [Source:Xenbase;Acc:... [more]
ENSXETT00000037551.14.513e-8936.33pep primary_assembly:Xenopus_tropicalis_v9.1:KV460... [more]
ppa21.245e-8032.15pyrophosphatase (inorganic) 2 [Source:Xenbase;Acc:... [more]
CAPN32.307e-7933.07calpain 3 [Source:NCBI gene;Acc:100497532][more]
icmt6.989e-7831.67isoprenylcysteine carboxyl methyltransferase [Sour... [more]
back to top
BLAST of Calpain 5a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Capn58.812e-10232.72calpain 5 [Source:MGI Symbol;Acc:MGI:1100859][more]
Capn58.812e-10232.72calpain 5 [Source:MGI Symbol;Acc:MGI:1100859][more]
Capn61.044e-7432.36calpain 6 [Source:MGI Symbol;Acc:MGI:1100850][more]
Capn81.107e-7440.29calpain 8 [Source:MGI Symbol;Acc:MGI:2181366][more]
Capn112.881e-7333.71calpain 11 [Source:MGI Symbol;Acc:MGI:1352490][more]
back to top
BLAST of Calpain 5a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O15484|CAN5_HUMAN7.390e-10432.80Calpain-5 OS=Homo sapiens OX=9606 GN=CAPN5 PE=1 SV... [more]
sp|O08688|CAN5_MOUSE6.164e-10132.72Calpain-5 OS=Mus musculus OX=10090 GN=Capn5 PE=1 S... [more]
sp|Q8R4C0|CAN5_RAT1.977e-9932.89Calpain-5 OS=Rattus norvegicus OX=10116 GN=Capn5 P... [more]
sp|Q22036|CAN5_CAEEL2.438e-9634.00Calpain-5 OS=Caenorhabditis elegans OX=6239 GN=tra... [more]
sp|Q11002|CANA_DROME8.378e-7635.84Calpain-A OS=Drosophila melanogaster OX=7227 GN=Ca... [more]
back to top
BLAST of Calpain 5a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3Q2QZ281.035e-11936.72Calpain 5a OS=Fundulus heteroclitus OX=8078 PE=3 S... [more]
A0A3Q3EVJ77.906e-11935.89Calpain 5a OS=Labrus bergylta OX=56723 PE=3 SV=1[more]
A0A4Z2IKQ28.126e-11835.93Calpain-5 OS=Liparis tanakae OX=230148 GN=CAPN5_0 ... [more]
A0A4W6G0052.801e-11635.73Uncharacterized protein OS=Lates calcarifer OX=818... [more]
R7VLA75.275e-11535.49Uncharacterized protein OS=Capitella teleta OX=283... [more]
back to top
BLAST of Calpain 5a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn5a3.064e-10432.85calpain 5 [Source:NCBI gene;Acc:103038917][more]
capn5b5.371e-10133.77calpain-5-like [Source:NCBI gene;Acc:103035636][more]
capn5b5.608e-9834.01calpain-5-like [Source:NCBI gene;Acc:103035636][more]
ENSAMXT00000048279.15.573e-8631.79pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000050823.12.019e-8230.54pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Calpain 5a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
capn94.005e-7032.81calpain 9 [Source:ZFIN;Acc:ZDB-GENE-010724-2][more]
capn3a3.178e-6131.72calpain 3a, (p94) [Source:ZFIN;Acc:ZDB-GENE-040912... [more]
capn1a5.038e-5929.76calpain 1, (mu/I) large subunit a [Source:ZFIN;Acc... [more]
ENSPMAT00000000152.15.596e-5442.34pep scaffold:Pmarinus_7.0:GL488881:291:5685:-1 gen... [more]
ENSPMAT00000003998.13.396e-5328.71pep scaffold:Pmarinus_7.0:GL501031:16584:50555:1 g... [more]
back to top
BLAST of Calpain 5a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Calpain 5a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO348602.153e-11335.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO401931.263e-8436.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO486332.854e-6734.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO485363.087e-5637.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379911.092e-3131.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Calpain 5a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002598.22.587e-11234.53calpain-5 [Source:NCBI gene;Acc:101166153][more]
capn5b2.892e-10433.66calpain 5 [Source:NCBI gene;Acc:101155135][more]
ENSORLT00000039414.12.995e-10131.88calpain-5 [Source:NCBI gene;Acc:101158220][more]
capn5b4.680e-10132.48calpain 5 [Source:NCBI gene;Acc:101155135][more]
ENSORLT00000028657.19.791e-10031.60calpain-5 [Source:NCBI gene;Acc:101158220][more]
back to top
BLAST of Calpain 5a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009459.10.000e+0100.00SMESG000009459.1[more]
SMESG000009459.10.000e+0100.00SMESG000009459.1[more]
SMESG000017238.19.558e-9035.86SMESG000017238.1[more]
SMESG000062902.12.470e-7735.63SMESG000062902.1[more]
SMESG000062904.19.407e-7735.83SMESG000062904.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023857 ID=SMED30023857|Name=Calpain 5a|organism=Schmidtea mediterranea sexual|type=transcript|length=2338bp
CAAAACACAAATATTTTTATTAGTTTTGTGGGACAATTAAATGGATTTTT
CTCGAAATTTTGTCTTTTTTAATAATCAAAATTATGTGTCCATGCGACAA
GAGCATCAAAAGAATTTGACACTTTTCTGCGATGATACGTTTGGAGCTGA
TGACAAAAGCATTTCTCCATCAGGGAAACAGGAAATTTTAAGTTCGATTG
AATGGAAAAGACCATCAGAACTTTGTATCAATCCTTGTCTTTTTATTGCT
GGGAGTTCCGTTCATGATGTATGTCAAGGATCTCTTGGAAATTGCTGGCT
AGTGTCAGCCCTAGCTGTTCTAGCTCAGCATCCGGAATGTTTAAAAAAGG
TCATTCCCAATGTCGACGATCAGGAATGGCACGGAAATAGACCTCATTCT
TATACCGGTATGTTTAGGATTTGTCTGTGGCGATATGGAGAATGGCTAGA
AGTTGTCATAGATGACAGACTTCCGAGCAGAAATGGGAAATTAGTGTTTG
TTCATTCTAAAGTGAAAAATGAATTTTGGAGTGCTTTAATTGAAAAGGCC
TACGCAAAGGTTTGTGGCTCATATGAATCACTAGTAGGAGGGTTGACTTG
TGAGTCTATGGTTGACTTTACTGGGGGAATCCCTGAACAAATCTTTGATC
TCAAAAAGTATTCTAAAAGCGATACAGAAATGGAAAATCTTTTCAAACTT
CTTCATTTCGATTGGAAAGACGGTTCATTAATGTGTGCGACTATTGCTTC
TCGCAGTGATGAAATGGAGGAAAAATTAGCCAACGGTCTCATCACAACCC
ATGCGTACAGTATCACAGGGGTCTGCAAACTACGGATCAAATCAACTCCT
ATGTATGAGCACTATCAAAAGAATCATTTGATGTGTATAAGACTGAGAAA
TCCGTGGGGGCAAAAAGAATGGAACGGATCTTTATCAGATGCATCCGAGG
AATGGCATTCAATCAGTCATAAAGACAAGATAGCTATGGGATGGAAAGTT
GAGAATGACGGGGAATTCTGGATGCTGATTGATGATGTCTTGGTCAATTT
CAATGAAATAACAATCATTCGACCGATCAAAACAGGAATATTTAAATATA
ATAGCAACTGGTTCGGAAGTATGTGCAAAGGATACTGGACTGGTGTGGCC
GGTGATAGGCAATCTGCTTTAGCTGAAATTGGTCAAGGGGGTCAATTTAA
AATCGAGATTAATAATCCGAAAGGTGATATTTTCCTATGTCATTTGCTGC
AGAAGTGTGCCAGGGGGTCTGAAGCGGCTCTTGGAATATTGATAATTGCT
GTGGAAAGGAATAGGGATTTCATGGTTCATACACCGAAATTTTGTAACGT
AAAACTTGAATACAGATTAGGAGGGTCTCGATCTATTTGTTTGCGATACC
GATTGACATGTGGAACTTATATTGTTAAACCATTTTTAACTGTAGCGTCA
CCAAGCCTGAAATTTCCAATTTATTATTTGTTACGATGCTACACCACTCA
GAAAAATAATGGAACTTTCTTGCCATCAGAAATGCCTATCCTTGAGAGGA
ATTGTATCTGTAAATCGAATTGTACCATTATCATTTGTCGCTTACATATC
ATACAGGCTGATATCATCCAAGCGGCCGAGGAATTAGACGTTTTGAATAT
ATTTTGTGAGATTGACTGTGAAAATCAAAGTTTGAGAACAACAGTTAACT
GCAACACAAGTGGATTGTTTTGGGATGAAACTTTTCTATTGCATCGCTCA
AAAATGGATCGACCAATCATAATAAAGATTTTTCATCGAGGCCGTTTTTT
TAACACTTTGATTGGATACTCGTGCTGTTCGTACGATTCTCGGCATCTCA
ATTCGCCAGAGGTTATAGAGACTCTCAATATGGTTTTTGAGCCAAAACTG
AAGACTCCTTGCACAAAAATTAGGAATTTGAAGATCACCCAATTCCACAC
AGACAATCAAAAATATTTATGAATGGTTTTTGTGGAAATCCTTTCATGGT
TGAGGATTTTTCTGGTGAAACTTTAAAAACTATATTCATTTAAACGTGAC
TTTTAATGGCTTTGGGTGTACTGGTTCTTTGGCTTTATTAGCGTCCGTGC
CAATAAATTAAAAATAAAATTTGAATTTTTAAAGGAGCTGTGGAAATAAA
AGATTAAAATTAATCACTAAATAAATGGTCTGCAACTTATTGTAATAGAT
ATTGGTTTGTTACTGATTGAGAATGTTAGGTGTATTAGTGATAAAGATTA
GAAAGGCTATGTCTTAGCACATTGGATCTTTGTAATGAGTGTTGTTTCGA
ATGTCTAGCATATGTTAAACAGTATATACGAAAGGTGG
back to top

protein sequence of SMED30023857-orf-1

>SMED30023857-orf-1 ID=SMED30023857-orf-1|Name=SMED30023857-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=644bp
MDFSRNFVFFNNQNYVSMRQEHQKNLTLFCDDTFGADDKSISPSGKQEIL
SSIEWKRPSELCINPCLFIAGSSVHDVCQGSLGNCWLVSALAVLAQHPEC
LKKVIPNVDDQEWHGNRPHSYTGMFRICLWRYGEWLEVVIDDRLPSRNGK
LVFVHSKVKNEFWSALIEKAYAKVCGSYESLVGGLTCESMVDFTGGIPEQ
IFDLKKYSKSDTEMENLFKLLHFDWKDGSLMCATIASRSDEMEEKLANGL
ITTHAYSITGVCKLRIKSTPMYEHYQKNHLMCIRLRNPWGQKEWNGSLSD
ASEEWHSISHKDKIAMGWKVENDGEFWMLIDDVLVNFNEITIIRPIKTGI
FKYNSNWFGSMCKGYWTGVAGDRQSALAEIGQGGQFKIEINNPKGDIFLC
HLLQKCARGSEAALGILIIAVERNRDFMVHTPKFCNVKLEYRLGGSRSIC
LRYRLTCGTYIVKPFLTVASPSLKFPIYYLLRCYTTQKNNGTFLPSEMPI
LERNCICKSNCTIIICRLHIIQADIIQAAEELDVLNIFCEIDCENQSLRT
TVNCNTSGLFWDETFLLHRSKMDRPIIIKIFHRGRFFNTLIGYSCCSYDS
RHLNSPEVIETLNMVFEPKLKTPCTKIRNLKITQFHTDNQKYL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR035892C2_domain_sf
IPR038765Papain-like_cys_pep_sf
IPR022684Calpain_cysteine_protease
IPR001300Peptidase_C2_calpain_cat
IPR000008C2_dom
IPR000169Pept_cys_AS
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
Vocabulary: molecular function
TermDefinition
GO:0004198calcium-dependent cysteine-type endopeptidase activity
GO:0005515protein binding
GO:0008233peptidase activity
GO:0008234cysteine-type peptidase activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR022684Peptidase C2, calpain familyPRINTSPR00704CALPAINcoord: 55..77
score: 45.07
coord: 121..146
score: 56.67
coord: 13..36
score: 31.67
coord: 151..174
score: 71.81
coord: 322..343
score: 42.12
coord: 176..203
score: 53.1
coord: 79..95
score: 56.47
IPR001300Peptidase C2, calpain, catalytic domainSMARTSM00230cys_prot_2coord: 10..355
e-value: 1.5E-134
score: 463.0
IPR001300Peptidase C2, calpain, catalytic domainPFAMPF00648Peptidase_C2coord: 29..343
e-value: 4.1E-103
score: 344.5
IPR001300Peptidase C2, calpain, catalytic domainPROSITEPS50203CALPAIN_CATcoord: 28..342
score: 64.882
IPR001300Peptidase C2, calpain, catalytic domainCDDcd00044CysPccoord: 19..342
e-value: 6.60522E-107
score: 323.9
NoneNo IPR availableGENE3DG3DSA:3.90.70.10coord: 204..349
e-value: 4.3E-34
score: 119.0
NoneNo IPR availablePANTHERPTHR10183:SF381CALPAIN-6coord: 7..596
NoneNo IPR availablePANTHERPTHR10183CALPAINcoord: 7..596
NoneNo IPR availableSUPERFAMILYSSF49562C2 domain (Calcium/lipid-binding domain, CaLB)coord: 516..609
IPR035892C2 domain superfamilyGENE3DG3DSA:2.60.40.150coord: 515..639
e-value: 7.7E-7
score: 31.4
IPR000169Cysteine peptidase, cysteine active sitePROSITEPS00139THIOL_PROTEASE_CYScoord: 79..90
IPR038765Papain-like cysteine peptidase superfamilySUPERFAMILYSSF54001Cysteine proteinasescoord: 5..344