PBPe domain-containing protein

Overview
NamePBPe domain-containing protein
Smed IDSMED30023852
Length (bp)1991
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of PBPe domain-containing protein (SMED30023852) t-SNE clustered cells

Violin plots show distribution of expression levels for PBPe domain-containing protein (SMED30023852) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023852

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023852SMESG000034966.1 SmedASXL_031693SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30023852SMESG000034966.1 SmedASXL_080470SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30023852 SmedASXL_002101SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30023852 SmedASXL_019513SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
headSMED30023852SMESG000034966.1 dd_Smed_v6_71905_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 79.7221 bits (195), Expect = 9.021e-15
Identity = 113/486 (23.25%), Postives = 200/486 (41.15%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKL 849          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 79.7221 bits (195), Expect = 9.021e-15
Identity = 113/486 (23.25%), Postives = 200/486 (41.15%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKL 849          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 78.1814 bits (191), Expect = 2.880e-14
Identity = 112/486 (23.05%), Postives = 198/486 (40.74%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKV 849          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIA4 (glutamate ionotropic receptor AMPA type subunit 4 [Source:HGNC Symbol;Acc:HGNC:4574])

HSP 1 Score: 78.1814 bits (191), Expect = 2.880e-14
Identity = 112/486 (23.05%), Postives = 198/486 (40.74%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKV 849          
BLAST of PBPe domain-containing protein vs. Ensembl Human
Match: GRIA3 (glutamate ionotropic receptor AMPA type subunit 3 [Source:HGNC Symbol;Acc:HGNC:4573])

HSP 1 Score: 73.9442 bits (180), Expect = 6.423e-13
Identity = 105/440 (23.86%), Postives = 183/440 (41.59%), Query Frame = 3
Query:  690 ENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNL-------PFAVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELA----------DTMSIRPHVQPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYK 1898
            ENRT    +    P++ +  N +         G  ++    I K ++I   +  +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+L         P +  D      N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA          D+ S +   + S +  Y  + S M S+         +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +++ + E  YK
Sbjct:  421 ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLEDNNEEPRDPQSPPD----PPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPS------VFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYK 849          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 70.4774 bits (171), Expect = 2.738e-12
Identity = 94/362 (25.97%), Postives = 151/362 (41.71%), Query Frame = 3
Query:  786 GILMESLQRITKILKINLVIQKMDTYDYG---------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDT---KLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILG-------------IYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHV----------QPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNIT--SDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDK 1757
            G  ++ L  +T++LK N  I ++    YG           +  +     D+  S  T    R E+VDF  P M   + +L+ +   +T    LW  L PLS   W+ L++   +V   + + +  SP   +NL       DE ++ ENI                 GS +QQG D  P   ++R I  +WW+F+ II SSY+A L +FLT+  +   IE+ ++LA+   IR  V          + S +P Y  + S M+SS        V  N     I       Y+Y M     ES + E       +L  +   +DS   G+   K S +  + +  + +L E          +W D+
Sbjct:  431 GFCIDLLNEMTQVLKFNYTIIEVQDGTYGIEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLERI----DERDF-ENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPG-----VFVNSSREGIARVKSGGYAYMM-----ESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDR 777          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-4 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:Q17697])

HSP 1 Score: 70.4774 bits (171), Expect = 3.119e-12
Identity = 94/362 (25.97%), Postives = 151/362 (41.71%), Query Frame = 3
Query:  786 GILMESLQRITKILKINLVIQKMDTYDYG---------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDT---KLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILG-------------IYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHV----------QPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNIT--SDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDK 1757
            G  ++ L  +T++LK N  I ++    YG           +  +     D+  S  T    R E+VDF  P M   + +L+ +   +T    LW  L PLS   W+ L++   +V   + + +  SP   +NL       DE ++ ENI                 GS +QQG D  P   ++R I  +WW+F+ II SSY+A L +FLT+  +   IE+ ++LA+   IR  V          + S +P Y  + S M+SS        V  N     I       Y+Y M     ES + E       +L  +   +DS   G+   K S +  + +  + +L E          +W D+
Sbjct:  431 GFCIDLLNEMTQVLKFNYTIIEVQDGTYGIEDESGRWNGIIGALQRHEADLSLSAVTITYSRAEVVDFTLPFMHLGISILLARTSEETDKGSLWTFLEPLSLTVWISLLISYCIVSYSMHILAKFSPYEWYNLER----IDERDF-ENIKNQKNQFTVLNSFWFTMGSLMQQGSDVIPRAAATRLIAVVWWMFTQIIISSYTAQLAAFLTVERMSTPIESTQDLANQQKIRYGVLKSGSTMDFFRESKIPMYERMWSVMESSSPG-----VFVNSSREGIARVKSGGYAYMM-----ESSMLEYYLERDCELQSIGGLLDSKGYGIALPKGSPLRDILSRTVLQLQERTILEALKNKWWRDR 777          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-1 (Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot;Acc:P34299])

HSP 1 Score: 63.1586 bits (152), Expect = 5.661e-10
Identity = 60/200 (30.00%), Postives = 113/200 (56.50%), Query Frame = 3
Query:  879 VNDVNSG-AYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLN----LPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQ-----PSYLPYTTLK 1445
            + ++ SG A+ + ASL T N++R  +VDF  P M   + +++++P + +  +++ ++PLS+  W+ +I   I V +++ L S  SP   W +       F +S++ +    +     +F+QQG D  P  +S R   S WW F+ II SSY+A+L +FLT+  +Q  IE++++LA    I+  +Q      S+  Y++++
Sbjct:  533 IGELLSGRAHAVVASL-TINQERERVVDFSKPFMTTGISIMIKKPDKQEFSVFSFMQPLSTEIWMYIIFAYIGVSVVIFLVSRFSPYE-WRVEETSRGGFTISNDFSVYNCLWFTLAAFMQQGTDILPRSISGRIASSAWWFFTMIIVSSYTANLAAFLTLEKMQAPIESVEDLAKQSKIKYGIQGGGSTASFFKYSSVQ 730          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-5 (GLutamate Receptor family (AMPA) [Source:UniProtKB/TrEMBL;Acc:O01623])

HSP 1 Score: 55.0694 bits (131), Expect = 1.780e-7
Identity = 101/460 (21.96%), Postives = 187/460 (40.65%), Query Frame = 3
Query:  594 LSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRT--FYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP---RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNL--------------------PFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTI--PFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQ-----KIAQRIVIF---NDCTTNITSDN---------DYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVD 1811
            L  + F++  T+V++  S    + L   V + +     F   +    P++    N     +  +  G  ++ L  ++K L     I  +    YG            + ++  G  +M  +  T N +R+E VDF  P +   + +L + P   +PD  L++ L PLS   W  +    I V + +   ++ +P   WNLN                     P  +S+  ++   +  +  + L+ G DF P  +S+R +   WW+F  +I S+Y+A+L + LT+  P+I   I+ + +LA+  +I          Y T++    S++Q     +IA  + ++    D    +TS+          +Y+Y M     ES   E +      L  +   + S   G+   KKS  T   + +I    + G    K   +W  K     +  +ST SA + D
Sbjct:  401 LDDIGFWEPATNVHVNMSGDSKAQLQRNVQVSDELKPHFRVTTIMERPYVMLKKNHYELDANSKFEGFCIDLLAELSKDLGFTYTIHAVKDGKYGNDKYGNGSWDGMMGEILRGEAEMAVAPLTVNYRRSEAVDFTKPFLSLGISILYKVPDDQQPD--LFSFLNPLSWQIWTAIATSIITVTLGMYFVANVTPYE-WNLNFSCCTAHEPHPAAAFATNQEAPIVMSNNYSFWNTVWYVLSTMLKGGCDFGPRAVSTRLLGGTWWVFYLVIISAYTANLAAVLTVSRPYIP--IKNLDDLANQTTI---------SYGTIRGG--STMQFFQESRIAAHVKMWQYMKDKDVFVTSNGKGVERALSMNYAYLM-----ESTSLEYETQQNCNLTQIGGVLGSKGYGIALAKKSEWTDRISRQILLYAKRGIIEMKKTKWWRSKG----AACASTASAVKHD 835          
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Match: glr-2 (Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot;Acc:Q10914])

HSP 1 Score: 52.7582 bits (125), Expect = 8.923e-7
Identity = 47/168 (27.98%), Postives = 85/168 (50.60%), Query Frame = 3
Query:  906 DMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAW--NLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSI 1400
            D+  +  T  ++R   VDF  P M   + +++++P + +  +++ + PL    W+  +     V + + L S  SP           F V++E     ++     +F+QQG D  P  +S R   S WW F+ II SSY+A+L +FLT+  +   IE++++LA+   I
Sbjct:  570 DVAVAPLTITQERERAVDFSKPFMTTGISIMIKKPEKQEFNIFSFMEPLGMTIWIFTLSSYFGVSLTIFLVSWFSPYEKRIEFKRGEFTVTNEFTLYNSLWFTLAAFMQQGTDILPRAVSGRIASSCWWFFTLIIVSSYTANLAAFLTLERMTPPIESVEDLANQNKI 737          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: KaiR1D (gene:FBgn0038837 transcript:FBtr0083987)

HSP 1 Score: 70.4774 bits (171), Expect = 3.039e-12
Identity = 92/395 (23.29%), Postives = 166/395 (42.03%), Query Frame = 3
Query:  777 ELTGILMESLQRITKILKINLVIQKMDTYDYGKC----------VNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLS--AWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDK---NNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYK 1898
            +  G  ++ +  I+K L  N  IQ +    YG            + ++     D+  +  T   +R + VDF TP M   + +L R+P +    L++ L PLS   W+ +    + V ++L + +  +P    A+       V  +      +    GS +QQG DF P  LS+R +  +WW F+ I+ SSY+A+L +FLT+  +   IE+ ++LA    I+             + S  S+ Q++     + R  +F                   F  ES   E       +L  +   +D+ + G+     S   +  N+ I +L E G        +W +K      R+  S S+ +A  + +  +G + ++     GV  +I VCE ++K
Sbjct:  443 QFEGYAVDLIHEISKSLGFNYKIQLVPDGSYGSLNKLTGEWNGMIRELLEQRADLAIADLTITFEREQAVDFTTPFMNLGVSILYRKPIKQPPNLFSFLSPLSLDVWIYMATAYLGVSVLLFILAKFTPYEWPAYTDAHGEKVESQFTLLNCMWFAIGSLMQQGCDFLPKALSTRMVAGIWWFFTLIMISSYTANLAAFLTVERMDSPIESAEDLAKQTRIKYGALKGGSTAAFFRDSKISTYQRMWSFMESARPSVFTASNGEGVERVAKGKGSYAFLMESTSIEYVTERNCELTQVGGMLDTKSYGIATPPNSPYRTAINSVILKLQEEGKLHILKTKWWKEKRGGGKCRVETSKSSSAANELGLANVGGVFVVLMGGMGVACVIAVCEFVWK 837          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: GluRIIE (gene:FBgn0051201 transcript:FBtr0110837)

HSP 1 Score: 63.5438 bits (153), Expect = 4.259e-10
Identity = 76/312 (24.36%), Postives = 135/312 (43.27%), Query Frame = 3
Query:  879 VNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDT-KLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWN-----LNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELAD-----------TMSIRPHVQPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDK--LYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDD 1754
            + ++ +G  D+  +  T   +R + +DF  P M   + +L  +P+  T +L+  + P S   W  L    + V +   +    SP S W+     +  P  + ++     +I    G+ LQQG +  P  LS+RT+ S WW F+ I+ SSY+A+L +FLTI   Q  I ++ +LAD           T S R     S    Y  +   M  + Q + +  +   +    + ++  Y++ M   S       I++N   +  L  + + +D    G+  RK       FN  +  L E G   K    +W++
Sbjct:  491 LREIMTGRADLAITDLTITSEREQALDFTIPFMNLGIAILYLKPQKATPELFTFMDPFSEEVWWFLGFSFLGVSLSFFILGRLSP-SEWDNPYPCIEEPEELENQFTLGNSIWFTTGALLQQGSEIGPKALSTRTVASFWWFFTLIVVSSYTANLAAFLTIEKPQSLINSVDDLADNKDGVVYGAKKTGSTRNFFMTSAEERYKKMNKFMSENPQYLTEDNM---EGVNRVKTNTHYAFLMESTS-------IEYNTKRECNLKKIGDALDEKGYGIAMRKDWPHRGKFNNALLELQEQGVLEKMKNKWWNE 791          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: GluRIID (gene:FBgn0028422 transcript:FBtr0083938)

HSP 1 Score: 62.003 bits (149), Expect = 1.598e-9
Identity = 83/328 (25.30%), Postives = 139/328 (42.38%), Query Frame = 3
Query:  879 VNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGI-------YGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELAD-----------TMSIRPHVQPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDK--LYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDS 1796
            + ++  G  D+  +  T   +R E++DF  P M   + +L  +P +    L++ + P SS  WL L +  + V +   +    SP+   N   P+   +E    EN   I        G+ LQQG +  P  LS+RTI ++WW F+ I+ SSY+A+L +FLTI      I ++K+LAD           T S R     S  P Y  +   +++  + + +           + S   Y++ M   S       I+FN   +  L  + + +D    G+   K       FN  +  L E G  A+    +W++      S  S  D 
Sbjct:  489 LKEIVEGRADLAITDLTITSEREEVIDFSIPFMNLGIAILYVKPQKAPPALFSFMDPFSSEVWLYLGIAYLGVSLCFFIIGRLSPIEWDN---PYPCIEEPEELENQFTINNSLWFTTGALLQQGSEIAPKALSTRTISAIWWFFTLIMVSSYTANLAAFLTIENPTSPINSVKDLADNKDDVQYGAKRTGSTRNFFSTSEEPIYIKMNEYLNAHPEMLMEN---NQQGVDKVKSGTKYAFLMESTS-------IEFNTVRECNLTKVGDPLDEKGYGIAMVKNWPYRDKFNKALLELQEQGVLARLKNKWWNEVGAGVCSAKSDDDG 803          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Grik (gene:FBgn0038840 transcript:FBtr0335015)

HSP 1 Score: 55.4546 bits (132), Expect = 1.486e-7
Identity = 83/395 (21.01%), Postives = 159/395 (40.25%), Query Frame = 3
Query:  693 NRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGKCVNDVNSGAY------------DMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWN-----LNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELA-DTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-------AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSA 1799
            N++F   +  +EP+      S+      +  G  +E +  ++K L  +   +  +   YG    D  +G +            DMG +  T   +R   VDF  P M   + +L R+P +   KL++ + P S   WL L +  + V I + +    SP + W+     +  P  + ++ ++   +    G+ LQQG +  P   S+R + + WW F+ I+ SSY+A+L +FLT+  +   I    +L+ +   +    +     +   K S   + Q++        Q +   N    +   +++Y++ M     ES   E        L  +   +D    G+  RK        +  +  + E G   K    +W +K      + +  DS 
Sbjct:  411 NKSFVVITAISEPYGMLKETSEKLEGNDQFEGFGIELIDELSKKLGFSYTWRLQEDNKYGGI--DPKTGEWNGMLREIIDSRADMGITDLTMTSERESGVDFTIPFMSLGIGILFRKPMKEPPKLFSFMSPFSGEVWLWLGLAYMGVSISMFVLGRLSP-AEWDNPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWFFTLILVSSYTANLAAFLTVESLVTPINDADDLSKNKGGVNYGAKIGGATFNFFKESNYPTYQRMYEFMRDNPQYMTNTNQEGVDRVENSNYAFLM-----ESTTIEYITERRCTLTQVGALLDEKGYGIAMRKNWPYRDTLSQAVLEMQEQGLLTKMKTKWWQEKRGGGACSDADEDSG 797          
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Match: Grik (gene:FBgn0038840 transcript:FBtr0335016)

HSP 1 Score: 54.299 bits (129), Expect = 3.975e-7
Identity = 59/235 (25.11%), Postives = 108/235 (45.96%), Query Frame = 3
Query:  693 NRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGKCVNDVNSGAY------------DMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWN-----LNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTI 1343
            N++F   +  +EP+      S+      +  G  +E +  ++K L  +   +  +   YG    D  +G +            DMG +  T   +R   VDF  P M   + +L R+P +   KL++ + P S   WL L +  + V I + +    SP + W+     +  P  + ++ ++   +    G+ LQQG +  P   S+R + + WW F+ I+ SSY+A+L +FLT+
Sbjct:  411 NKSFVVITAISEPYGMLKETSEKLEGNDQFEGFGIELIDELSKKLGFSYTWRLQEDNKYGGI--DPKTGEWNGMLREIIDSRADMGITDLTMTSERESGVDFTIPFMSLGIGILFRKPMKEPPKLFSFMSPFSGEVWLWLGLAYMGVSISMFVLGRLSP-AEWDNPYPCIEEPTELENQFSFANCLWFSIGALLQQGSELAPKAYSTRAVAASWWFFTLILVSSYTANLAAFLTV 642          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria3b (glutamate receptor, ionotropic, AMPA 3b [Source:ZFIN;Acc:ZDB-GENE-030616-53])

HSP 1 Score: 80.8777 bits (198), Expect = 2.565e-15
Identity = 109/458 (23.80%), Postives = 193/458 (42.14%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE--NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEIDIL*QKIFNALNFK 1982
            +ENRT    +    P++ +  N        +  G  ++    I K + I   +  +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W L+    V D     +  N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G  AK    +W DK      +S S D    + +  +  +  I     G+ +++ + E  YK     R+ A +++++       NA N+K
Sbjct:  410 VENRTIVVTTIMEAPYVMYKKNHMHLEGNEKYEGYCVDLASEIAKHVGIKYRLSIVMDGKYGARDPETKSWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WQLDETDEVKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILAKLKNKWWYDKGECGTKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYK----SRAEAKRLKLEK------NAQNYK 856          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria4a (glutamate receptor, ionotropic, AMPA 4a [Source:ZFIN;Acc:ZDB-GENE-020125-7])

HSP 1 Score: 79.337 bits (194), Expect = 7.740e-15
Identity = 107/445 (24.04%), Postives = 187/445 (42.02%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSD--EVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTD-SAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            +ENRT    +    P++    N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P   SD    +   N  GI+       G+F+QQG DF P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E  +   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D S+  + +  +  +  I     G+ +L+ + E  YK     R+ A K+++
Sbjct:  406 MENRTVIVTTIMEGPYVMLKKNWEMYEGNEQFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEEGSDGPPSDQPPNEFGIFNSLWFSLGAFMQQGCDFTPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALVEFCYK----SRAEAKKLKL 845          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria4b (glutamate receptor, ionotropic, AMPA 4b [Source:ZFIN;Acc:ZDB-GENE-030131-8013])

HSP 1 Score: 77.7962 bits (190), Expect = 2.319e-14
Identity = 114/494 (23.08%), Postives = 210/494 (42.51%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEV--NYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELA----------DTMSIRPHVQPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTD-SAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +N     R+ ++++   + L    Q  +LL +  + +ENRT    +    P++    N +      +  G  ++    I K +     I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P   +D +  +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA          D+ S +   + S +  Y  + S M S+         +F   T    +    S     F  ES + E  +   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D S+  + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKSNGP--RRIGYWNDADKLVL---TQDHALLPNETSGMENRTVIVTTIMEGPYVMLKKNWEMYEGNEQYEGYCVDLASEIAKHIGFKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEEGTDGLPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSA------EPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSQLRTPVNLAVLKLSESGILDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRNEAKRMKL 851          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria3b (glutamate receptor, ionotropic, AMPA 3b [Source:ZFIN;Acc:ZDB-GENE-030616-53])

HSP 1 Score: 76.2554 bits (186), Expect = 7.016e-14
Identity = 107/458 (23.36%), Postives = 190/458 (41.48%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE--NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEIDIL*QKIFNALNFK 1982
            +ENRT    +    P++ +  N        +  G  ++    I K + I   +  +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W L+    V D     +  N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +++ + E  YK     R+ A +++++       NA N+K
Sbjct:  410 VENRTIVVTTIMEAPYVMYKKNHMHLEGNEKYEGYCVDLASEIAKHVGIKYRLSIVMDGKYGARDPETKSWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WQLDETDEVKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYK----SRAEAKRLKLEK------NAQNYK 856          
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Match: gria3b (glutamate receptor, ionotropic, AMPA 3b [Source:ZFIN;Acc:ZDB-GENE-030616-53])

HSP 1 Score: 76.2554 bits (186), Expect = 7.016e-14
Identity = 107/458 (23.36%), Postives = 190/458 (41.48%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE--NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEIDIL*QKIFNALNFK 1982
            +ENRT    +    P++ +  N        +  G  ++    I K + I   +  +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W L+    V D     +  N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +++ + E  YK     R+ A +++++       NA N+K
Sbjct:  410 VENRTIVVTTIMEAPYVMYKKNHMHLEGNEKYEGYCVDLASEIAKHVGIKYRLSIVMDGKYGARDPETKSWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WQLDETDEVKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYK----SRAEAKRLKLEK------NAQNYK 856          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 78.9518 bits (193), Expect = 1.625e-14
Identity = 110/459 (23.97%), Postives = 187/459 (40.74%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGKCVNDVNS----------GAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE--NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFNDCTTNI--------------------TSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            ++NRT+   +    P++    N+          G  +E    I K +     ++ +    YG   +D+ +          G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+ N  F    E   T+  N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+  +LA    I          Y TL S       K   +I +F    T +                     S   Y+Y +     ES + E I+   P     +   +DS   G+   K S +    N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +L+ + E  YK     RS + K+++
Sbjct:  404 VQNRTYIVTTILEAPYVMLKKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WH-NEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEI---------AYGTLDSGSTKEFFK-RSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLL-----ESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYK----SRSESKKMKV 841          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 76.2554 bits (186), Expect = 1.077e-13
Identity = 111/459 (24.18%), Postives = 189/459 (41.18%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGKCVNDVNS----------GAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE--NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFNDCTTNI--------------------TSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            ++NRT+   +    P++    N+          G  +E    I K +     ++ +    YG   +D+ +          G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+ N  F    E   T+  N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+  +LA    I          Y TL S       K   +I +F    T +                     S   Y+Y +     ES + E I+   P     +   +DS   G+   K S +    N  + +L E G   K    +W DK      +S S  SA  +  +     ++I     G+GL +LV   + +  +  RS + K+++
Sbjct:  399 VQNRTYIVTTILEAPYVMLKKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WH-NEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEI---------AYGTLDSGSTKEFFK-RSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLL-----ESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRGAVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKTSALSLSNVAGVFYILIG----GLGLAMLVA--LIEFCYKSRSESKKMKV 834          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 75.485 bits (184), Expect = 1.697e-13
Identity = 109/459 (23.75%), Postives = 186/459 (40.52%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGKCVNDVNS----------GAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE--NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFNDCTTNI--------------------TSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            ++NRT+   +    P++    N+          G  +E    I K +     ++ +    YG   +D+ +          G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+ N  F    E   T+  N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+  +LA    I          Y TL S       K   +I +F    T +                     S   Y+Y +     ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +L+ + E  YK     RS + K+++
Sbjct:  381 VQNRTYIVTTILEAPYVMLKKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WH-NEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEI---------AYGTLDSGSTKEFFK-RSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLL-----ESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYK----SRSESKKMKV 818          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 74.7146 bits (182), Expect = 3.288e-13
Identity = 105/456 (23.03%), Postives = 179/456 (39.25%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGKCVNDVNS----------GAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFNDCTTNI--------------------TSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVE 1937
            ++NRT+   +    P++    N+          G  +E    I K +     ++ +    YG   +D+ +          G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP    N               N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+  +LA    I          Y TL S       K   +I +F    T +                     S   Y+Y +     ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +L+ + E  YK     RS + K++
Sbjct:  405 VQNRTYIVTTILEAPYVMLKKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEI---------AYGTLDSGSTKEFFK-RSKIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLL-----ESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYK----SRSESKKMK 841          
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Match: traf3ip2 (TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB-GENE-6035451])

HSP 1 Score: 74.3294 bits (181), Expect = 4.091e-13
Identity = 105/456 (23.03%), Postives = 180/456 (39.47%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGKCVNDVNS----------GAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFNDCTTNI--------------------TSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVE 1937
            ++NRT+   +    P++    N+          G  +E    I K +     ++ +    YG   +D+ +          G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP    N               N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+  +LA    I          Y TL S       K + +I +F    T +                     S   Y+Y +     ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +L+ + E  YK     RS + K++
Sbjct:  352 VQNRTYIVTTILEAPYVMLKKNADQLEGNDRFEGYCVELAAEIAKHVGFKYKLEIVKDGKYGARDSDMKAWNGMVGELVYGRADLAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHNEEFEEGKEQPTTDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESADDLAKQTEI---------AYGTLDSGSTKEFFKRS-KIAVFEKMWTYMRSAEPSVFVKTTEEGMNRVRKSKGKYAYLL-----ESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSPLRNPVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYK----SRSESKKMK 788          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 80.1073 bits (196), Expect = 5.036e-15
Identity = 113/486 (23.25%), Postives = 200/486 (41.15%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDAPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKL 849          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 77.7962 bits (190), Expect = 2.772e-14
Identity = 112/486 (23.05%), Postives = 198/486 (40.74%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDAPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKL 849          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria4 (glutamate receptor, ionotropic, AMPA4 (alpha 4) [Source:MGI Symbol;Acc:MGI:95811])

HSP 1 Score: 77.7962 bits (190), Expect = 2.772e-14
Identity = 112/486 (23.05%), Postives = 198/486 (40.74%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDAPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKL 849          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria3 (glutamate receptor, ionotropic, AMPA3 (alpha 3) [Source:MGI Symbol;Acc:MGI:95810])

HSP 1 Score: 73.9442 bits (180), Expect = 4.357e-13
Identity = 102/434 (23.50%), Postives = 179/434 (41.24%), Query Frame = 3
Query:  690 ENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNL-------PFAVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYK 1898
            ENRT    +    P++ +  N +         G  ++    I K ++I   +  +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+L         P +  D      N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +++ + E  YK
Sbjct:  415 ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLEDNNEEPRDPQSPPD----PPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYK 843          
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Match: Gria1 (glutamate receptor, ionotropic, AMPA1 (alpha 1) [Source:MGI Symbol;Acc:MGI:95808])

HSP 1 Score: 73.1738 bits (178), Expect = 7.858e-13
Identity = 100/438 (22.83%), Postives = 179/438 (40.87%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSI---------------RPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYK 1898
            ++NRT+   +   +P++    N+          G  +E    I K +  +  ++ +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP    +           +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I               R  +      +T +KS+  S   +  +  +I         S   Y+Y +     ES + E I+   P     +   +DS   G+   K S +    N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +L+ + E  YK
Sbjct:  335 VQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYRLEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRDQTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSVFVRTTEEGMI-----RVRKSKGKYAYLL-----ESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSALRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIGGLGLAMLVALIEFCYK 762          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Z2W8|GRIA4_MOUSE (Glutamate receptor 4 OS=Mus musculus OX=10090 GN=Gria4 PE=1 SV=2)

HSP 1 Score: 80.1073 bits (196), Expect = 3.523e-14
Identity = 113/486 (23.25%), Postives = 200/486 (41.15%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDAPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKL 849          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P48058|GRIA4_HUMAN (Glutamate receptor 4 OS=Homo sapiens OX=9606 GN=GRIA4 PE=1 SV=2)

HSP 1 Score: 79.7221 bits (195), Expect = 4.332e-14
Identity = 113/486 (23.25%), Postives = 200/486 (41.15%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKL 849          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q38PU5|GRIA4_MACFA (Glutamate receptor 4 OS=Macaca fascicularis OX=9541 GN=GRIA4 PE=2 SV=1)

HSP 1 Score: 77.7962 bits (190), Expect = 1.795e-13
Identity = 112/486 (23.05%), Postives = 198/486 (40.74%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDVPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLGNAVNLAVLKLNEPGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKL 849          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|P19493|GRIA4_RAT (Glutamate receptor 4 OS=Rattus norvegicus OX=10116 GN=Gria4 PE=1 SV=1)

HSP 1 Score: 75.485 bits (184), Expect = 9.053e-13
Identity = 111/486 (22.84%), Postives = 197/486 (40.53%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPF-AVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L +   T  R   + N  D  +L  +Q    L +    IENRT    +    P++ +  N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P        +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E  +   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  374 MDVFELKS---TGPRKVGYWNDMDKLVL--IQDMPTLGNDTAAIENRTVVVTTIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTKIWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEDGKEGPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKGKFAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSSLGNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRAEAKRMKL 849          
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9Z2W9|GRIA3_MOUSE (Glutamate receptor 3 OS=Mus musculus OX=10090 GN=Gria3 PE=1 SV=2)

HSP 1 Score: 73.9442 bits (180), Expect = 3.048e-12
Identity = 102/434 (23.50%), Postives = 179/434 (41.24%), Query Frame = 3
Query:  690 ENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNL-------PFAVSDEVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYK 1898
            ENRT    +    P++ +  N +         G  ++    I K ++I   +  +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+L         P +  D      N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +++ + E  YK
Sbjct:  415 ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKYGARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLEDNNEEPRDPQSPPD----PPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTADGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYK 843          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8J1L9 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 173.326 bits (438), Expect = 3.085e-44
Identity = 99/313 (31.63%), Postives = 167/313 (53.35%), Query Frame = 3
Query:  867 YGKCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIV---IFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDS 1796
            +  CV ++  G   + A  FT    R+E++DF  P+ E++  +L+ +P P++KLW V  P +   WL ++    V      + +  SP +A+NLNL FA++DEV   E +    GSFLQQGQDFYP+ +SSRT ++ WW+ S II  +++ DLT+ LT+    + I+T+ +L     IRP+V      +T L ++     +KI + +V    ++DC T+  + N      AC +D + L  I   N  + Y+  E   ++ + L+    +    LFN  + +L E G   + +Q YW   +   + +S+ TD+
Sbjct:   37 FNGCVGELQRGEVSVAAGPFTITAARDEVIDFSVPLFEESNAILLPRPAPESKLWRVFSPFTMSVWLSIVAALFVTTFATWVLAYFSPFTAYNLNLEFAIADEVWLQEYLWSAIGSFLQQGQDFYPFAMSSRTAMAFWWLLSVIICGAFNGDLTAHLTVTVTHYPIKTLDDLTGQTEIRPYVIAGTSLHTLLLNAESGVYKKITESMVELGPYDDCPTDPPNPNQ-----ACLTDYTYLLNIARKNCTQFYLAEELFLTAPIALMLPDDAFYAELFNFHMQKLHETGQLQRWFQLYWSSDSVCSVGSSAETDA 344          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A267FSX5 (PBPe domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017883g2 PE=4 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 3.064e-39
Identity = 99/310 (31.94%), Postives = 169/310 (54.52%), Query Frame = 3
Query:  867 YGKCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDS 1796
            +  CV +V  G   +G S FT    R+ +VDF TP+ ++   +L+ +P P++KLWNV  P     W+++I+   V   +  + +  SP SA+NL L FA++DE+   E I  I GSF+QQGQDFYP+ +S R +L+ WW+F+ IIY +Y+ DLT+ LTI F    I+T+ +L    +++P V       T L SS     +++A ++++ +     I  +  +    AC +D + L  +   N  K+YI +E  +++TV  ++ + +   +  + +  ++ E G   K + TYW         +S+  DS
Sbjct:  220 FSGCVGEVQRGIVSIGGSTFTKTAIRDSVVDFSTPLFQEANGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVCAAVTWVLAYFSPFSAYNLRLEFAIADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLDTLLSSSTGGVYRQVADKMLMSDTLPGCI--EQTFQGKEACLTDYTALLYVARANCSKVYIADEIFNTATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLFNTYWSSDAVCSSGSSTEADS 527          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8J047 (PBPe domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 159.458 bits (402), Expect = 5.669e-39
Identity = 106/385 (27.53%), Postives = 191/385 (49.61%), Query Frame = 3
Query:  690 ENRTFYACSPWNEPWLYFPANSQTNF------SVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDS 1796
            +N+T   C+P + P         TNF      S   + G+  + L  +   L+     +  D  ++G           CV ++  G   + A  FT    R+ ++D+ TP+ +++  +L+ +P P +K+WNV  P +   W+ +IV+  +   I  + +  SP +A+NL   +A++DEV + E +  + GSFLQQGQDFYP+ +S RTIL+ WW+F+ IIY +Y+ DLT+ LT+    + I+T+ +L    +I+P+V      YT  K S     +++A  +V       +   D+      AC +D + L  I   N  + Y+  E  +++TV  ++   +     F+  + +L+E G   + ++ YW       +  S+  +S
Sbjct:    4 KNQTIVVCTPESPP--------MTNFEKRFSNSTVIINGMTFDLLNILASKLEFRFYTKDSDDGNWGAPVPNQPYFNGCVGELQRGLVTIAAGPFTRTTTRDSVIDYSTPLFQESNGILLPRPPPASKMWNVYLPFNYDVWISVIVLLFICSFITWILAYFSPFTAYNLKEEYAIADEVWFQEYVWSVVGSFLQQGQDFYPFAMSPRTILAFWWMFTVIIYGAYTGDLTAHLTVTITDYPIKTLSDLVSQTAIKPYVPAGTNLYTLFKESNSGVYKQVADVMVDLGP--YDYCPDSVVRQERACLNDYTYLLAIAMKNCTQYYLAEETFNTATVAFMYPDDAYFAEYFDFYMQKLLETGLMQRLFKIYWSSDIVCTVGKSTEANS 378          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8HR46 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 3.047e-38
Identity = 96/299 (32.11%), Postives = 161/299 (53.85%), Query Frame = 3
Query:  909 MGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIV---IFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDS 1796
            + A  FT    R+E++DF  P+ E++  +L+ +P P++KLW V  P +   WL ++    V      + +  SP +A+NLNL FA++DEV   E +    GSFLQQGQDFYP+ +SSRT ++ WW+ S II  +++ DLT+ LT+    + I+T+ +L     IRP+V      +T L ++     +KI + +V    ++DC T+  + N      AC +D + L  I   N  + Y+  E   ++ + L+    +    LFN  + +L E G   + +Q YW   +   + +S+ TD+
Sbjct:  297 VAAGPFTITAARDEVIDFSVPLFEESNAILLPRPAPESKLWRVFSPFTMSVWLFIVAALFVTTFATWVLAYFSPFTAYNLNLEFAIADEVWLQEYLWSAIGSFLQQGQDFYPFAMSSRTAMAFWWLLSVIICGAFNGDLTAHLTVTVTHYPIKTLDDLTGQTEIRPYVIAGTSLHTLLLNAESGVYKKITESMVELGPYDDCPTDPPNPNQ-----ACLTDYTYLLNIARKNCTQFYLAEELFLTAPIALMLPDDAFYAELFNFHMQKLHETGQLQRWFQLYWSSDSVCSVGSSAETDA 590          

HSP 2 Score: 135.576 bits (340), Expect = 4.719e-29
Identity = 85/287 (29.62%), Postives = 144/287 (50.17%), Query Frame = 3
Query:  909 MGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFND---CTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKN 1760
            +GA  FT    R+ ++DF TP+ + +  V++ +P PDTK+WN+  PLS   W +L+       +++ + + +SP SA+NL L +AVSDE+   E I    GSFLQQGQDFYP+ +S RT+++ WW+               F  I F         +L    +++P+V      YT L ++     ++IA  +V+      C  N    ND     AC +D + L      +    Y+++E  + STV L++ + +    +F+  + ++ E G   + +  YW  +N
Sbjct:  862 LGAGPFTKTSIRDSVIDFSTPLFDQSTAVMVPKPPPDTKMWNIFTPLSPSVWYLLLGTLACASVVMWVLAYYSPFSAYNLGLEYAVSDEIWLHEYIWSAIGSFLQQGQDFYPFAMSPRTVMAFWWM---------------FTLIIF-----GAFTDLVSQTAVKPYVPTGTNHYTLLTTAESGIYKQIADAMVVMPAGEYCPYN-PPKND----AACINDYTFLLGQAIRHCSLYYMLSETFNPSTVALMYSEDAFYAQMFDYNLQKMHESGLMQRLFDFYWSREN 1123          
BLAST of PBPe domain-containing protein vs. TrEMBL
Match: A0A1I8HAM9 (CCHC-type domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 163.696 bits (413), Expect = 4.120e-38
Identity = 96/294 (32.65%), Postives = 162/294 (55.10%), Query Frame = 3
Query:  867 YGKCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYW 1748
            +  CV +V  G   +G S FT +  R+ +VDF TP+ ++   +L+ +P P++KLWNV  P     W+++I+   V   +  + +  SP +A+NL L FA +DE+   E I  I GSF+QQGQDFYP+ +S R +L+ WW+F+ IIY +Y+ DLT+ LTI F    I+T+ +L    +++P V      Y  L +S     +++A ++ I +     I  +  +    AC +D + L      N  K+YI +E  +S+TV  ++ + +   +  + +  ++ E G   K + TYW
Sbjct:  996 FSGCVGEVQRGIVSIGGSTFTKSTTRDGVVDFSTPLFQEAYGILVPRPPPESKLWNVYAPFKYDVWILVIIFIFVSAAVTWVLAYFSPFTAYNLRLEFAFADEIWLQEYIWSIVGSFMQQGQDFYPFAMSPRAVLAFWWMFTVIIYGTYTGDLTAHLTISFTDLPIKTLSDLVAQSAVKPLVPEGTNLYNLLTTSTGGVYRQVADKLQISDTIPECI--EQTFQGKEACLTDYTALLYAARANCSKVYIADEIFNSATVAFMYPEDAYFGANIDFQFQKMHETGIMQKLFNTYW 1287          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: gria4b (glutamate receptor 4 [Source:NCBI gene;Acc:103035012])

HSP 1 Score: 74.7146 bits (182), Expect = 1.973e-13
Identity = 101/426 (23.71%), Postives = 178/426 (41.78%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSD--EVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDK 1757
            + +F L  N     R+ ++++   + L   +Q  +LL +  + +ENRT    +    P++    N +         G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P   +D    +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E  +   P     +   +DS   G+   K S + S  N  + +L E G   K    +W DK
Sbjct:  374 MDVFELKNNGP--RRIGYWNDADKLVL---IQDQALLPNETSGMENRTVVVTTIMEGPYVMLKKNWEMYEGNDRYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEEGTDGPPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWGYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSQLRSAVNLAVLKLNEQGLLDKLKNKWWYDK 793          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:103044872])

HSP 1 Score: 73.559 bits (179), Expect = 4.465e-13
Identity = 103/434 (23.73%), Postives = 179/434 (41.24%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE------NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYK 1898
            +ENRT    +    P++ +  N           G  ++    I K + I   +  +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+L+     SDE    +      N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ + + + E  YK
Sbjct:  414 VENRTIVVTTIMEAPYVMYKRNYMQLEGNERYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPETRTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLD----DSDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGTKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMTVALVEFCYK 842          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:103044872])

HSP 1 Score: 73.1738 bits (178), Expect = 5.764e-13
Identity = 106/440 (24.09%), Postives = 183/440 (41.59%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE------NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELA----------DTMSIRPHVQPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYK 1898
            +ENRT    +    P++ +  N           G  ++    I K + I   +  +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+L+     SDE    +      N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA          D+ S +   + S +  Y  + S M S+         +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ + + + E  YK
Sbjct:  380 VENRTIVVTTIMEAPYVMYKRNYMQLEGNERYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPETRTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLD----DSDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPS------VFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGTKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMTVALVEFCYK 808          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:103044872])

HSP 1 Score: 73.1738 bits (178), Expect = 5.776e-13
Identity = 106/440 (24.09%), Postives = 183/440 (41.59%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE------NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELA----------DTMSIRPHVQPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYK 1898
            +ENRT    +    P++ +  N           G  ++    I K + I   +  +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+L+     SDE    +      N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA          D+ S +   + S +  Y  + S M S+         +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ + + + E  YK
Sbjct:  413 VENRTIVVTTIMEAPYVMYKRNYMQLEGNERYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPETRTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLD----DSDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPS------VFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGTKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMTVALVEFCYK 841          
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Match: gria3a (glutamate receptor 3 [Source:NCBI gene;Acc:103044872])

HSP 1 Score: 72.7886 bits (177), Expect = 7.398e-13
Identity = 106/440 (24.09%), Postives = 181/440 (41.14%), Query Frame = 3
Query:  687 IENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE------NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELA----------DTMSIRPHVQPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYK 1898
            +ENRT    +    P++ +  N           G  ++    I K + I   +  +    YG            V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+L+     SDE    +      N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA          D+ S +   + S +  Y  + S M S+         +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + S  N  + +L E G   K    +W DK         S D    + +  +  +  I     G+ + + + E  YK
Sbjct:  380 VENRTIVVTTIMEAPYVMYKRNYMQLEGNERYEGYCVDLASEIAKHVGIKYKLSIVADGKYGARDPETRTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHLD----DSDEAKDPQSPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPS------VFAKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRSAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMTVALVEFCYK 808          
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005084.1 (pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 gene:ENSPMAG00000004612.1 transcript:ENSPMAT00000005084.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 51.2174 bits (121), Expect = 3.466e-7
Identity = 55/199 (27.64%), Postives = 97/199 (48.74%), Query Frame = 3
Query:  906 DMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRP-DTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTEN--------ILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI 1475
            D+  +  T N  R + +DF  P M   + +L R+P   +  +++ L PLS   W+ +++  + V  +L + +  SP   +N   P   + + +  EN          G+ G+ +QQG +  P  LS+R +  +WW F+ II SSY+A+L +FLT+  ++  I +  +LA    I           T  K S  S+ +K+
Sbjct:   11 DLAVAPLTINYMREKAIDFSKPFMTLGISILYRKPNGTNPGIFSFLNPLSPDIWMYILLAYLGVSCVLFVIARFSPYEWYN---PHPCNPDSDVVENNFTMLNSFWFGV-GALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPISSADDLAKQTRIEYGAVRDGSTMTFFKKSKISTYEKM 205          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO30203 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T1G4])

HSP 1 Score: 57.3806 bits (137), Expect = 1.772e-8
Identity = 63/260 (24.23%), Postives = 122/260 (46.92%), Query Frame = 3
Query:  681 NIIENRTFYACSPWNEPWLYFPANSQTNF---SVFELTGILMESLQRITKILKI----------NLVIQKMDTYDYGKCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMR-QPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLP----------FAVSDEVNYTENILGIYGSFLQQGQD-FYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELA 1385
            +I+ENRT    +    P+++  A +QTN    +   + G  +E L++++++L+           N   Q   T ++   V +V +G  D+  +  T + +R +++DF  P M+  L VL++  P  +   + +LRP     W+ +    I+VG  L LFS+ SP   +   +             + D ++    +      ++ Q  D  +P   S R  ++++W    I+ S+Y+A+L +FLTI      I ++ +LA
Sbjct:  439 HILENRTLKVVTIAEAPFIF--AQTQTNGQGETRVIIEGYCIELLRKLSEMLRFKFEVYLVPDNNFGAQDPVTKEWNGVVREVLNGRADLAVTSLTISPERQKVIDFTQPYMDLGLTVLIKPDPTEEKNPFAILRPFRYDLWMAIGGTMIIVGFFLWLFSTFSPFGFYGRCVQKCHTKIEPRYLKLHDTLSLVRALWSTVVYYVGQSSDHLHPVSSSGRITVAVYWFAMLIVMSTYTANLAAFLTIKRFTSPISSVDDLA 696          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO41291 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4J5])

HSP 1 Score: 52.7582 bits (125), Expect = 3.138e-7
Identity = 80/354 (22.60%), Postives = 146/354 (41.24%), Query Frame = 3
Query:  792 LMESLQRITKILKINLVIQKMDTYD------YGKCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLS--AWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIP-FIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSM--------ACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSA 1799
            LME L R     +  + I K  +Y       +   + ++     D+     T   +R E++DF  P ++  + ++++QP   +  L+  L P     WL  + V  +V +I+      SP               DE + + ++     S LQQG D  P   S R + + +W+F+ I+ S+Y+A+L ++ T    I+ +I ++++L    +++  VQ     +T    S      K+     +F    +  T  N   Y +        A  +D+  L       P    ++   +D+ +  L  R+ S  T+L +  I  L E G   K    +WDD +        STDS+
Sbjct:   34 LMELLSRKLN-FRYEICISKESSYGSKVEGQWQGLIGELVREEADIALGPITITAEREEVIDFSKPFLDFRIAMILQQPTGEEVNLFAFLLPFDEKLWLTTLGVVGLVSLIVWFLDRFSPQGYKTQAEKSGEGEGDEFSLSNSLWFAVASILQQGGDNTPRSTSGRVLAAAFWLFTLILISTYTANLAAYFTGERGIRSKINSLEDLVSQSTVKYGVQEGGSLFTFFSES------KVDIYATMFQQMKSQETFVNGTQYGVLKARTQPFAYLTDQPSLDYYNMRKPCNTMLVKNLLDAKSYALAMRRNSEWTNLISVAILELREEGEIEKSRLRWWDDSSE--CPTGPSTDSS 378          
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Match: EDO46633 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RPU4])

HSP 1 Score: 49.2914 bits (116), Expect = 4.893e-6
Identity = 64/293 (21.84%), Postives = 122/293 (41.64%), Query Frame = 3
Query:  618 NHTDVYLLDSVQKTSLLNHGV-------NIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVI----------QKMDTYDYGKCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWN--------------LNLPFAVSDEVNYTENILGIYGSFLQQGQDF-YPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSI 1400
            N  D  ++DS +    ++ G        N++ +RT    S    P+     N  ++   FE  G +++ L R+++IL  N  I          +   T ++   +N++     D+     T    R +++DF  P M   + V+M         +  L P  S  W+ +    + +G++  LFS  SP   +               L   +++S    +  +I      +L QG D  +P   S R  +++WW    I+ ++Y+A++ +FLT   +Q  I  I++L+    I
Sbjct:  347 NTKDGLMMDSDKTVVWMSGGPGTPRDSENVLADRTIRVVSFKGSPFTMPVGNVSSSVDRFE--GAVIDLLDRLSEILHFNYTIYMSPDGRVGVENPVTGNWDGVINELIQERADLAVGPITITSHRWKVIDFTQPFMTSGIGVVMGTENSPKPYFRFLEPFKSDLWITIFGAVLGMGVVNWLFSVVSPFGFYGRCVQSINKRVKKSYLKQKYSLS----FLNSIWSSAAYYLGQGPDGNHPVSASGRAAVAVWWFVITILGATYTANMAAFLTTTRMQTPIRRIEDLSSQTEI 633          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 82.8037 bits (203), Expect = 5.808e-16
Identity = 122/516 (23.64%), Postives = 220/516 (42.64%), Query Frame = 3
Query:  525 QILTSNIPISR--------LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE---NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELA----------DTMSIRPHVQPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTD-SAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEIDI 1946
            Q LT NI            + +F L +N     ++ ++++   + L+ +  + SLLN   + +ENRT    +    P++    N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P   + E   T+   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA          D+ S +   + S +  Y  + S M S+         +F   T    +    S     F  ES + E  +   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D S+  + +  +  +  I     G+ +L+ + E  YK     R+ A ++++D+
Sbjct:  361 QGLTGNIQFDHYGRRVNYTMDVFELRSNGP--RKIGYWNDIDKLVLVQN--ENSLLNDS-SAMENRTVVVTTIMEGPYVMLKKNWELYEGNDQFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSA------EPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALVEFCYK----SRAEAKRMKVDL 860          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 80.4925 bits (197), Expect = 2.815e-15
Identity = 121/516 (23.45%), Postives = 218/516 (42.25%), Query Frame = 3
Query:  525 QILTSNIPISR--------LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE---NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELA----------DTMSIRPHVQPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTD-SAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEIDI 1946
            Q LT NI            + +F L +N     ++ ++++   + L+ +  + SLLN   + +ENRT    +    P++    N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P   + E   T+   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA          D+ S +   + S +  Y  + S M S+         +F   T    +    S     F  ES + E  +   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S D S+  + +  +  +  I     G+ +L+ + E  YK     R+ A ++++D+
Sbjct:  361 QGLTGNIQFDHYGRRVNYTMDVFELRSNGP--RKIGYWNDIDKLVLVQN--ENSLLNDS-SAMENRTVVVTTIMEGPYVMLKKNWELYEGNDQFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSA------EPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSQLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALVEFCYK----SRAEAKRMKVDL 860          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: gria4b (glutamate receptor 4 [Source:NCBI gene;Acc:101175340])

HSP 1 Score: 80.1073 bits (196), Expect = 3.616e-15
Identity = 113/488 (23.16%), Postives = 205/488 (42.01%), Query Frame = 3
Query:  558 LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSD--EVNYTENILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTD-SAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEI 1940
            + +F L  N     R+ ++++   + L   +Q + LL +    IENRT    +    P++    N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P   +D    +   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T    +    S     F  ES + E  +   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D S+  + +  +  +  I     G+ +L+ + E  YK     R+ A ++++
Sbjct:  312 MDVFELKNNGP--RRIGYWNDADKLVL---IQDSPLLPNDTTGIENRTVIVTTIMEGPYVMLKKNWEMYEGNDQYEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHTEEPEEGTDGQPSDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTDIAYGTLDSGSTKEFFRRSKIAVYEKMWGYMKSAEPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGVATPKGSQLRTPVNLAVLKLSEAGVLDKLKNKWWYDKGECGPKDSGSKDKSSQALSLSNVAGVFYILVGGLGLAMLVALIEFCYK----SRNEAKRMKL 789          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: gria3b (glutamate receptor 3 [Source:NCBI gene;Acc:101171999])

HSP 1 Score: 74.3294 bits (181), Expect = 2.686e-13
Identity = 91/364 (25.00%), Postives = 159/364 (43.68%), Query Frame = 3
Query:  855 DTYDYGKCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE--NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKI-----AQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYK 1898
            +T  +   V ++  G  D+  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   WNL     + D     +  N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA    I      S       + S  +  +K+     +    +F   T +  +    S     F  ES + E I+   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK      +S S D    + +  +  +  I     G+ +++ + E  YK
Sbjct:  475 ETKTWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WNLEEQDEIKDPQTPPDPPNDFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFVKTTPDGVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNLAVLKLSEQGILDKLKNKWWYDKGECGTKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMMVALIEFCYK 837          
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Match: gria4a (glutamate receptor 4 [Source:NCBI gene;Acc:101163507])

HSP 1 Score: 73.559 bits (179), Expect = 3.651e-13
Identity = 110/466 (23.61%), Postives = 193/466 (41.42%), Query Frame = 3
Query:  525 QILTSNIPISR--------LSIFSLNTNNKTLSRLAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQP-RPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTE---NILGIY-------GSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELA----------DTMSIRPHVQPSYLP-YTTLKSSMDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKE-IQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSA 1799
            Q LT NI            + +F L +N     ++ ++++   + L+ +  + SLLN   + +ENRT    +    P++    N +      +  G  ++    I K + I   I  +    YG            V ++  G  ++  +  T    R E++DF  P M   + +++++P +    +++ L PL+   W+ ++   I V ++L L S  SP   W+   P   + E   T+   N  GI+       G+F+QQG D  P  LS R +  +WW F+ II SSY+A+L +FLT+  +   IE+ ++LA          D+ S +   + S +  Y  + S M S+         +F   T    +    S     F  ES + E  +   P     +   +DS   G+   K S + +  N  + +L E G   K    +W DK         S +  
Sbjct:  361 QGLTGNIQFDHYGRRVNYTMDVFELRSNGP--RKIGYWNDIDKLVLVQN--ENSLLNDS-SAMENRTVVVTTIMEGPYVMLKKNWELYEGNDQFEGYCVDLASEIAKHIGIKYKISIVPDGKYGARDPETKIWNGMVGELVYGKAEIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYE-WHAEEPEEGATEPGPTDQPPNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSA------EPTVFTKTTAEGVARVRKSKGKYAFLLESTMNEYTEQRKPCDTMKVGGNLDSKGYGIATPKGSQLRNAVNLAVLKLNEQGLLDKLKNKWWYDKGECGSGGGDSKNPG 814          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000034966.1 (SMESG000034966.1)

HSP 1 Score: 305.449 bits (781), Expect = 6.822e-101
Identity = 166/166 (100.00%), Postives = 166/166 (100.00%), Query Frame = 3
Query: 1452 MDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIYKHIWTQRSNANKVEIDIL 1949
            MDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDIIGIGAILIISFIFYGVGLLILVCEEIYKHIWTQRSNANKVEIDIL
Sbjct:    1 MDSSLQKIAQRIVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAYRVDIIGIGAILIISFIFYGVGLLILVCEEIYKHIWTQRSNANKVEIDIL 166          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 176.022 bits (445), Expect = 1.202e-48
Identity = 132/388 (34.02%), Postives = 206/388 (53.09%), Query Frame = 3
Query:  777 ELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIF---NDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYW-DDKNNMRLSNSSSTD-SAYRVDXXXXXXXXXXXXXXYGVGLLILVCEEIY 1895
            E TG++   LQ + K L    +I +     +G           C+ +V        A ++T   QRNE VDF  P ME++ V L+R+P   +K+W+VLRPL    W++++V    V +    FS  SPLSAWNLNL FA+ DEV   EN   + GS   QGQDFYP+C+SSR +L++WWI + II+S+YSADLTSFLT+    + I  I ELA+   +   V       ++L  S ++  Q++ +R +     +DC   I   +  S ++ C SD S ++ +   N   +Y++ E  + + +G +  K S   ++ ++ I  L+E G   K  + YW DD+   R  + +  D SA  +D  GI  I I++   +  GLL  + E ++
Sbjct:    6 ETTGLVPMILQGLEKFLSFKALIYEAPDKQFGTKIGNSSKFTGCIGEVLEKKTVFSAGMYTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKGTNIDSSLAESHNAVYQELNRRKITIDNVDDCPKKILLPS--STNLVCISDRSGMRYVTNMNCKDVYMVPEIFNIAALGFVLEKDSPYKNMIDSYIQILVENGLITKWVRKYWEDDEVTSRNCDGTEGDNSAEPIDFEGIFGICILTCSLFVCGLLFFIIELLW 391          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000069533.1 (SMESG000069533.1)

HSP 1 Score: 170.629 bits (431), Expect = 2.900e-45
Identity = 124/338 (36.69%), Postives = 188/338 (55.62%), Query Frame = 3
Query:  693 NRTFYACSPWNEPWLYFPANSQTNFSVF-EL---TGILMESLQRITKILKINLV------------IQKMDTYDYGKCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIV---IFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGL 1649
            N+T   CSP   P   FPA + T  + F EL   TG++ E L  ++   K+N +             +K D++++  C+ D+ +     GASLFT N  RNE VDF  P  E++   L+R    ++K+WNV RPL   +WL+++V  I    +  + S +SPLSAWNL L F V DE+   E+I  I GSFL QGQDFYPY +SSRT+L++WWIF+ +I+S+Y+ADLTSFLT+   +H I +++ELA    ++  V+        L++S  +  +++  RI      ++C   I   N  S  + C +D S L  +      ++YI+ E  DS  +G 
Sbjct:  233 NKTINICSP---P--IFPALTYTRKNSFVELNGTTGLIFEILSILSA--KLNFIPLLYEAADSQWGARKNDSFNFTGCIGDIFNKKTLFGASLFTINAMRNEGVDFTAPFFEESNSALLRFSTSNSKIWNVFRPLHWSTWLMILVSTIFASYVSYILSCYSPLSAWNLKLSFTVLDEIRLREHIWNIVGSFLMQGQDFYPYSMSSRTVLAIWWIFTVVIFSTYTADLTSFLTVKTDEHYIHSLEELASRKDLKIIVEDGTSTAIFLQNSNYTVFKELYSRIQYIRAIDECPKLIMEGN--STHLVCIADTSSLTYVIRQFCSQIYIVPETFDSGNIGF 561          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000069533.1 (SMESG000069533.1)

HSP 1 Score: 170.244 bits (430), Expect = 2.959e-45
Identity = 124/338 (36.69%), Postives = 188/338 (55.62%), Query Frame = 3
Query:  693 NRTFYACSPWNEPWLYFPANSQTNFSVF-EL---TGILMESLQRITKILKINLV------------IQKMDTYDYGKCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIV---IFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGL 1649
            N+T   CSP   P   FPA + T  + F EL   TG++ E L  ++   K+N +             +K D++++  C+ D+ +     GASLFT N  RNE VDF  P  E++   L+R    ++K+WNV RPL   +WL+++V  I    +  + S +SPLSAWNL L F V DE+   E+I  I GSFL QGQDFYPY +SSRT+L++WWIF+ +I+S+Y+ADLTSFLT+   +H I +++ELA    ++  V+        L++S  +  +++  RI      ++C   I   N  S  + C +D S L  +      ++YI+ E  DS  +G 
Sbjct:  231 NKTINICSP---P--IFPALTYTRKNSFVELNGTTGLIFEILSILSA--KLNFIPLLYEAADSQWGARKNDSFNFTGCIGDIFNKKTLFGASLFTINAMRNEGVDFTAPFFEESNSALLRFSTSNSKIWNVFRPLHWSTWLMILVSTIFASYVSYILSCYSPLSAWNLKLSFTVLDEIRLREHIWNIVGSFLMQGQDFYPYSMSSRTVLAIWWIFTVVIFSTYTADLTSFLTVKTDEHYIHSLEELASRKDLKIIVEDGTSTAIFLQNSNYTVFKELYSRIQYIRAIDECPKLIMEGN--STHLVCIADTSSLTYVIRQFCSQIYIVPETFDSGNIGF 559          
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Match: SMESG000018611.1 (SMESG000018611.1)

HSP 1 Score: 172.555 bits (436), Expect = 1.289e-44
Identity = 119/341 (34.90%), Postives = 184/341 (53.96%), Query Frame = 3
Query:  771 VFELTGILMESLQRITKILKINLVIQKMDTYDYG----------KCVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIF---NDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDD 1754
            V E TG++   LQ + K L    +I +     +G           C+ +V        A ++T   QRNE VDF  P ME++ V L+R+P   +K+W+VLRPL    W++++V    V +    FS  SPLSAWNLNL FA+ DEV   EN   + GS   QGQDFYP+C+SSR +L++WWI + II+S+YSADLTSFLT+    + I  I ELA+   +   V       ++L  S ++  Q++ +R +     +DC   I   +  S ++ C SD S ++ +   N   +Y++ E  + + +G +  K S   ++ ++ I  L+E G   K  + YW+D
Sbjct:    4 VNETTGLVPMILQGLEKFLSFKALIYEAPDKQFGTKIGNSSKFTGCIGEVLEKKTVFSAGMYTLTSQRNEFVDFSNPYMEESNVPLLRKPLRSSKIWHVLRPLQFSVWMLILVSVAFVSLCCFSFSKFSPLSAWNLNLNFAIIDEVKLKENTWNVIGSLFMQGQDFYPFCISSRIVLAIWWIHALIIFSAYSADLTSFLTVQEKNNFISDINELANRKDLYIIVPKGTNIDSSLAESHNAVYQELNRRKITIDNVDDCPKKILLPS--STNLVCISDRSGMRYVTNMNCKDVYMVPEIFNIAALGFVLEKDSPYKNMIDSYIQILVENGLITKWVRKYWED 342          

HSP 2 Score: 152.14 bits (383), Expect = 5.873e-38
Identity = 105/365 (28.77%), Postives = 189/365 (51.78%), Query Frame = 3
Query:  693 NRTFYACSPWNEPWLYFPANSQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGK----------CVNDVNSGAYDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPXXXXXXXXXXXXXXXXXXXXKLFSSHSPLSAWNLNLPFAVSDEVNYTENILGIYGSFLQQGQDFYPYCLSSRTILSLWWXXXXXXXXXXXADLTSFLTIPFIQHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQR---IVIFNDCTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLIFRKKSLITSLFNTRITRLIEIGFFAKKYQTYW 1748
            N+T + CSP   P + FP N +  + + E  G++ + L+ ++K L   ++I +     +G           CV ++ +      A  FT+  QR E VD+  PIME++ V ++++P+  TK+W++ RP +   WL+ I    ++     +FS ++PLSA+NLNL FA+ DE+   E++    G F+ QGQDFYPY +S+R +L++WW+F  II+S+Y+ADLTSFLT+      + ++  LA    ++  +         L  S + + Q +  R   I   ++C   +   +  S  + C +D S++          +Y + E  +++ +G +  K +      +  I  L+E G  ++  + YW
Sbjct:  538 NKTLFICSPPITPAMIFPGNDKY-YRIEETFGLVSDILKILSKKLNFRMLIYEAPDKQFGARIGNTSNFTGCVGELLNKKATFAAGAFTFTSQRQEFVDYSYPIMEESNVPVLQKPKTQTKMWHIFRPFNWSVWLLSIATIFLISYFCYVFSKYNPLSAYNLNLNFAIVDEIYIKEHLWNAIGGFVLQGQDFYPYTVSARIVLAIWWLFCLIIFSAYTADLTSFLTVSEGNSLLSSLDALAARTDLKIVIPKGTNLDALLIESTNPTYQALNSRKIYIDTIDNCPKKMLELS--STDLVCITDTSVVVYTVNKYCSVIYTVPETFNTAPLGFLTPKDAPFKKKIDQIIQSLVETGIISRWIEFYW 899          
The following BLAST results are available for this feature:
BLAST of PBPe domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GRIA49.021e-1523.25glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA49.021e-1523.25glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA42.880e-1423.05glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA42.880e-1423.05glutamate ionotropic receptor AMPA type subunit 4 ... [more]
GRIA36.423e-1323.86glutamate ionotropic receptor AMPA type subunit 3 ... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
glr-42.738e-1225.97GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-43.119e-1225.97GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-15.661e-1030.00Glutamate receptor 1 [Source:UniProtKB/Swiss-Prot... [more]
glr-51.780e-721.96GLutamate Receptor family (AMPA) [Source:UniProtK... [more]
glr-28.923e-727.98Glutamate receptor 2 [Source:UniProtKB/Swiss-Prot... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
KaiR1D3.039e-1223.29gene:FBgn0038837 transcript:FBtr0083987[more]
GluRIIE4.259e-1024.36gene:FBgn0051201 transcript:FBtr0110837[more]
GluRIID1.598e-925.30gene:FBgn0028422 transcript:FBtr0083938[more]
Grik1.486e-721.01gene:FBgn0038840 transcript:FBtr0335015[more]
Grik3.975e-725.11gene:FBgn0038840 transcript:FBtr0335016[more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria3b2.565e-1523.80glutamate receptor, ionotropic, AMPA 3b [Source:ZF... [more]
gria4a7.740e-1524.04glutamate receptor, ionotropic, AMPA 4a [Source:ZF... [more]
gria4b2.319e-1423.08glutamate receptor, ionotropic, AMPA 4b [Source:ZF... [more]
gria3b7.016e-1423.36glutamate receptor, ionotropic, AMPA 3b [Source:ZF... [more]
gria3b7.016e-1423.36glutamate receptor, ionotropic, AMPA 3b [Source:ZF... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
traf3ip21.625e-1423.97TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip21.077e-1324.18TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip21.697e-1323.75TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip23.288e-1323.03TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
traf3ip24.091e-1323.03TRAF3 interacting protein 2 [Source:Xenbase;Acc:XB... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gria45.036e-1523.25glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria42.772e-1423.05glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria42.772e-1423.05glutamate receptor, ionotropic, AMPA4 (alpha 4) [S... [more]
Gria34.357e-1323.50glutamate receptor, ionotropic, AMPA3 (alpha 3) [S... [more]
Gria17.858e-1322.83glutamate receptor, ionotropic, AMPA1 (alpha 1) [S... [more]
back to top
BLAST of PBPe domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Z2W8|GRIA4_MOUSE3.523e-1423.25Glutamate receptor 4 OS=Mus musculus OX=10090 GN=G... [more]
sp|P48058|GRIA4_HUMAN4.332e-1423.25Glutamate receptor 4 OS=Homo sapiens OX=9606 GN=GR... [more]
sp|Q38PU5|GRIA4_MACFA1.795e-1323.05Glutamate receptor 4 OS=Macaca fascicularis OX=954... [more]
sp|P19493|GRIA4_RAT9.053e-1322.84Glutamate receptor 4 OS=Rattus norvegicus OX=10116... [more]
sp|Q9Z2W9|GRIA3_MOUSE3.048e-1223.50Glutamate receptor 3 OS=Mus musculus OX=10090 GN=G... [more]
back to top
BLAST of PBPe domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8J1L93.085e-4431.63PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A267FSX53.064e-3931.94PBPe domain-containing protein (Fragment) OS=Macro... [more]
A0A1I8J0475.669e-3927.53PBPe domain-containing protein OS=Macrostomum lign... [more]
A0A1I8HR463.047e-3832.11Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HAM94.120e-3832.65CCHC-type domain-containing protein OS=Macrostomum... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4b1.973e-1323.71glutamate receptor 4 [Source:NCBI gene;Acc:1030350... [more]
gria3a4.465e-1323.73glutamate receptor 3 [Source:NCBI gene;Acc:1030448... [more]
gria3a5.764e-1324.09glutamate receptor 3 [Source:NCBI gene;Acc:1030448... [more]
gria3a5.776e-1324.09glutamate receptor 3 [Source:NCBI gene;Acc:1030448... [more]
gria3a7.398e-1324.09glutamate receptor 3 [Source:NCBI gene;Acc:1030448... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005084.13.466e-727.64pep scaffold:Pmarinus_7.0:GL476900:54926:87395:-1 ... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO302031.772e-824.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO412913.138e-722.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO466334.893e-621.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of PBPe domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gria4a5.808e-1623.64glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
gria4a2.815e-1523.45glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
gria4b3.616e-1523.16glutamate receptor 4 [Source:NCBI gene;Acc:1011753... [more]
gria3b2.686e-1325.00glutamate receptor 3 [Source:NCBI gene;Acc:1011719... [more]
gria4a3.651e-1323.61glutamate receptor 4 [Source:NCBI gene;Acc:1011635... [more]
back to top
BLAST of PBPe domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000034966.16.822e-101100.00SMESG000034966.1[more]
SMESG000018611.11.202e-4834.02SMESG000018611.1[more]
SMESG000069533.12.900e-4536.69SMESG000069533.1[more]
SMESG000069533.12.959e-4536.69SMESG000069533.1[more]
SMESG000018611.11.289e-4434.90SMESG000018611.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023852 ID=SMED30023852|Name=PBPe domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1991bp
CAATCTATCAAGTTCCACGAAATATTTCATTTGTTTCTTTTAATTCAAGT
AATTTGATGTCGGCAACAAAAAAATTCATAGAAAACTTAATAAGAAAAAC
TGGTCAGAAAAATTTCAACAAAAAGCTGATTTTTGAGGATGTTAGTCAAG
TGTCACAGCAAAAATTATTTAACATTTGGAATTCCTCTTTGGCAGATTTT
GTTCTGCTTTCAAATGAAAATATTGTATCATTTATTAAAAATGCTTCATC
TATGAACATGTTCTCCGATGGTCATGCTTGGATTGTTGTGGATTTGGATG
AAACTTTACAAACCTTTGTTGACCAGTTTCCGATTTCGTCCAATATAATT
GTTTTGAAAGAAGAATCAACAGTAAGAAAACGCGATGACCCATGTTGGAA
CGTTTCTTATGAAAACCGTAATTTGGTTTTCATTCAACCAAGTCAAATGA
AACTTGCCATTACAAGCCTTATTGTCTCTAATTCAACAAGTATTTGTTTT
AATCAATCAACCGTAACCATAGACCAGATTTTAACATCAAATATTCCAAT
TAGCCGGCTATCCATATTTTCTTTGAATACTAATAATAAGACTTTGTCAA
GATTGGCGTTTTTTGATAATCATACCGACGTCTATCTGTTGGATTCGGTC
CAGAAGACGAGCTTATTAAATCATGGCGTAAATATCATTGAAAATCGAAC
ATTTTACGCATGTTCTCCATGGAATGAGCCATGGCTGTATTTTCCGGCCA
ATTCTCAAACAAATTTCTCGGTATTTGAGTTGACAGGAATTCTCATGGAA
AGCTTGCAAAGGATTACGAAAATTCTTAAGATAAATTTGGTAATTCAGAA
AATGGATACGTATGACTATGGAAAATGTGTCAACGACGTCAACTCAGGGG
CTTATGACATGGGAGCTAGCTTGTTTACTTATAACAAACAACGGAATGAA
TTAGTTGATTTCATCACGCCAATCATGGAAGATAATCTTGTAGTTTTGAT
GCGGCAGCCTAGACCGGATACGAAATTATGGAACGTTTTACGTCCATTAT
CTTCTGTGTCTTGGTTGGTGTTAATTGTGGTTGGAATTGTTGTCGGCATC
ATTCTAAAACTATTTTCCAGCCATAGTCCATTGTCTGCCTGGAACCTAAA
CCTGCCGTTTGCGGTTTCTGATGAAGTAAATTATACTGAAAACATTTTGG
GTATATATGGATCGTTTCTGCAACAAGGACAGGACTTCTACCCTTACTGC
TTATCAAGTAGAACTATTTTGTCTTTGTGGTGGATTTTTTCTTTTATTAT
TTACAGTTCATATTCGGCTGACCTAACATCCTTTTTAACGATTCCTTTCA
TCCAACACCGAATAGAGACCATCAAAGAATTAGCTGATACTATGTCTATC
CGGCCACACGTACAGCCATCTTATTTGCCTTATACAACATTGAAGAGTTC
AATGGACTCATCTTTACAAAAAATTGCTCAGCGAATTGTGATTTTCAATG
ACTGCACAACCAATATTACTTCAGACAACGATTATTCTTATTCAATGGCT
TGCTTCTCTGATGAAAGTCTTCTCAAAGAGATCCAATTTAATAATCCAGA
TAAACTTTATATAATGAATGAAAGAGTAGACTCAAGCACAGTTGGATTAA
TATTTCGAAAGAAATCTTTGATTACAAGTCTATTTAATACAAGAATCACA
AGACTTATAGAAATTGGATTTTTCGCAAAAAAATATCAAACATATTGGGA
CGATAAAAATAATATGAGGTTATCCAACAGCTCCTCGACCGACTCTGCCT
ATCGGGTAGACATAATCGGAATAGGAGCGATTTTGATAATTTCATTCATT
TTCTACGGGGTCGGACTGCTTATTCTCGTCTGTGAGGAAATTTATAAACA
TATTTGGACTCAAAGATCCAATGCAAATAAAGTTGAAATTGACATTCTTT
AACAAAAAATTTTCAATGCACTCAATTTTAAATAAATACAC
back to top

protein sequence of SMED30023852-orf-1

>SMED30023852-orf-1 ID=SMED30023852-orf-1|Name=SMED30023852-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=650bp
IYQVPRNISFVSFNSSNLMSATKKFIENLIRKTGQKNFNKKLIFEDVSQV
SQQKLFNIWNSSLADFVLLSNENIVSFIKNASSMNMFSDGHAWIVVDLDE
TLQTFVDQFPISSNIIVLKEESTVRKRDDPCWNVSYENRNLVFIQPSQMK
LAITSLIVSNSTSICFNQSTVTIDQILTSNIPISRLSIFSLNTNNKTLSR
LAFFDNHTDVYLLDSVQKTSLLNHGVNIIENRTFYACSPWNEPWLYFPAN
SQTNFSVFELTGILMESLQRITKILKINLVIQKMDTYDYGKCVNDVNSGA
YDMGASLFTYNKQRNELVDFITPIMEDNLVVLMRQPRPDTKLWNVLRPLS
SVSWLVLIVVGIVVGIILKLFSSHSPLSAWNLNLPFAVSDEVNYTENILG
IYGSFLQQGQDFYPYCLSSRTILSLWWIFSFIIYSSYSADLTSFLTIPFI
QHRIETIKELADTMSIRPHVQPSYLPYTTLKSSMDSSLQKIAQRIVIFND
CTTNITSDNDYSYSMACFSDESLLKEIQFNNPDKLYIMNERVDSSTVGLI
FRKKSLITSLFNTRITRLIEIGFFAKKYQTYWDDKNNMRLSNSSSTDSAY
RVDIIGIGAILIISFIFYGVGLLILVCEEIYKHIWTQRSNANKVEIDIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0015276ligand-gated ion channel activity
GO:0038023signaling receptor activity
GO:0004970ionotropic glutamate receptor activity
GO:0001640adenylate cyclase inhibiting G-protein coupled glutamate receptor activity
GO:0004872receptor activity
GO:0005216ion channel activity
GO:0005234extracellular-glutamate-gated ion channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR001638Solute-binding_3/MltF_N
IPR001320Iontro_rcpt
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0005886plasma membrane
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0043197dendritic spine
GO:0045202synapse
GO:0045211postsynaptic membrane
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
GO:0007196adenylate cyclase-inhibiting G-protein coupled glutamate receptor signaling pathway
GO:0007216G-protein coupled glutamate receptor signaling pathway
GO:0034220ion transmembrane transport
GO:0035235ionotropic glutamate receptor signaling pathway
GO:0060079excitatory postsynaptic potential
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 261..600
e-value: 7.4E-54
score: 184.8
NoneNo IPR availableGENE3DG3DSA:3.40.190.10coord: 328..547
e-value: 7.4E-54
score: 184.8
NoneNo IPR availableGENE3DG3DSA:1.10.287.70coord: 338..628
e-value: 7.4E-54
score: 184.8
NoneNo IPR availableGENE3DG3DSA:3.40.50.2300coord: 9..132
e-value: 3.2E-5
score: 26.0
NoneNo IPR availablePANTHERPTHR42643FAMILY NOT NAMEDcoord: 136..638
NoneNo IPR availablePANTHERPTHR42643:SF13IONOTROPIC RECEPTOR 40A-RELATEDcoord: 136..638
NoneNo IPR availableSUPERFAMILYSSF53850Periplasmic binding protein-like IIcoord: 228..584
NoneNo IPR availableTMHMMTMhelixcoord: 604..626
NoneNo IPR availableTMHMMTMhelixcoord: 351..373
NoneNo IPR availableTMHMMTMhelixcoord: 422..444
IPR001320Ionotropic glutamate receptorPFAMPF00060Lig_chancoord: 353..498
e-value: 2.1E-20
score: 73.1
IPR001638Solute-binding protein family 3/N-terminal domain of MltFPFAMPF00497SBP_bac_3coord: 259..581
e-value: 3.1E-11
score: 43.1