Membrane-associated phosphatidylinositol transfer protein 1

Overview
NameMembrane-associated phosphatidylinositol transfer protein 1
Smed IDSMED30023840
Length (bp)3653
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Membrane-associated phosphatidylinositol transfer protein 1 (SMED30023840) t-SNE clustered cells

Violin plots show distribution of expression levels for Membrane-associated phosphatidylinositol transfer protein 1 (SMED30023840) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Membrane-associated phosphatidylinositol transfer protein 1 (SMED30023840) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Membrane-associated phosphatidylinositol transfer protein 1 (SMED30023840) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023840

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023840h1SMcG0000669 dd_Smed_v4_7211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023840h1SMcG0000669 dd_Smed_v4_7211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30023840h1SMcG0000669 dd_Smed_v4_7211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023840h1SMcG0000669 dd_Smed_v4_7211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023840h1SMcG0000669 dd_Smed_v4_7211_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Human
Match: PITPNM3 (PITPNM family member 3 [Source:HGNC Symbol;Acc:HGNC:21043])

HSP 1 Score: 387.111 bits (993), Expect = 1.775e-116
Identity = 218/561 (38.86%), Postives = 309/561 (55.08%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLF-NNPGVIENA----------------------PGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI 3406
            +V  FF+ GSP+GLV   R                            L     RP C  +Y+ FH  DPS+ R+EPL+  +FH +PP+ +  + RFP G+  S  L + L  ++P  +E +                      PG  +++ S+    S  S  +  V   ++   WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  AFI+RQ++                 ES+   N  E + +D      +       +        N+TANHRANDV+     PQ+L+ RFMYG  DM+    EKVDI +M  P S G W    +E+T+++GR+ +++   RR+  GVYP++MV++ D +    +L VLP  +E VVFSIDGSFAASVSI G DPKVRPG++DV R WQD GY+++YI+ RP+MQ++ V  WL+QH FP GMI FSDG+  +PL+QK   L  L++E  IK+  AYGS+KD+S+Y  LGL + QIF +GR  +  +     L +GYA+HL  L  + +  S+P +  S + LR+  F +
Sbjct:  357 DVSDFFLFGSPLGLVLAMRRTVLPG----------------------LDGFQVRPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADALHTHSPLFLEGSSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGASRITAKWWGSKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQVMR---------------YESV---NIKESARLDPAALSPANPREKWLRKRTQVKLRNVTANHRANDVIAAEDGPQVLVGRFMYGPLDMVALTGEKVDILVMAEP-SSGRWVHLDTEITNSSGRITYNVPRPRRLGVGVYPVKMVVRGDQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYMILYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKISAAYGSTKDISVYSVLGLPASQIFIVGRPTKKYQTQCQFLSEGYAAHLAAL--EASHRSRPKKNNSRMILRKGSFGL 874          

HSP 2 Score: 97.4413 bits (241), Expect = 8.986e-20
Identity = 51/157 (32.48%), Postives = 84/157 (53.50%), Query Frame = 2
Query: 1142 QSIQKSVFILVVHGGSLLDTNH-EYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
            +S +  V +LV+HGG++LDT   +   K  DI       + V ++ +P     I ++ V CP+I S+  ++++ L P   D+  L SS   Q +VPLAA+PL    +  Y+  +  +    N  Y EF++S +G  F GQV +I D +G +  FD +
Sbjct:   87 RSCKTHVLLLVLHGGNILDTGAGDPSCKAADIHTFSSVLEKVTRAHFPAALGHILIKFVPCPAICSEAFSLVSHLNPYSHDEGCLSSS---QDHVPLAALPLLAISSPQYQDAVATVIERANQVYREFLKSSDGIGFSGQVCLIGDCVGGLLAFDAI 240          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Human
Match: PITPNM3 (PITPNM family member 3 [Source:HGNC Symbol;Acc:HGNC:21043])

HSP 1 Score: 387.111 bits (993), Expect = 2.844e-116
Identity = 218/561 (38.86%), Postives = 309/561 (55.08%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLF-NNPGVIENA----------------------PGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI 3406
            +V  FF+ GSP+GLV   R                            L     RP C  +Y+ FH  DPS+ R+EPL+  +FH +PP+ +  + RFP G+  S  L + L  ++P  +E +                      PG  +++ S+    S  S  +  V   ++   WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  AFI+RQ++                 ES+   N  E + +D      +       +        N+TANHRANDV+     PQ+L+ RFMYG  DM+    EKVDI +M  P S G W    +E+T+++GR+ +++   RR+  GVYP++MV++ D +    +L VLP  +E VVFSIDGSFAASVSI G DPKVRPG++DV R WQD GY+++YI+ RP+MQ++ V  WL+QH FP GMI FSDG+  +PL+QK   L  L++E  IK+  AYGS+KD+S+Y  LGL + QIF +GR  +  +     L +GYA+HL  L  + +  S+P +  S + LR+  F +
Sbjct:  393 DVSDFFLFGSPLGLVLAMRRTVLPG----------------------LDGFQVRPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADALHTHSPLFLEGSSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGASRITAKWWGSKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQVMR---------------YESV---NIKESARLDPAALSPANPREKWLRKRTQVKLRNVTANHRANDVIAAEDGPQVLVGRFMYGPLDMVALTGEKVDILVMAEP-SSGRWVHLDTEITNSSGRITYNVPRPRRLGVGVYPVKMVVRGDQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYMILYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKISAAYGSTKDISVYSVLGLPASQIFIVGRPTKKYQTQCQFLSEGYAAHLAAL--EASHRSRPKKNNSRMILRKGSFGL 910          

HSP 2 Score: 97.4413 bits (241), Expect = 1.061e-19
Identity = 51/157 (32.48%), Postives = 84/157 (53.50%), Query Frame = 2
Query: 1142 QSIQKSVFILVVHGGSLLDTNH-EYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
            +S +  V +LV+HGG++LDT   +   K  DI       + V ++ +P     I ++ V CP+I S+  ++++ L P   D+  L SS   Q +VPLAA+PL    +  Y+  +  +    N  Y EF++S +G  F GQV +I D +G +  FD +
Sbjct:  123 RSCKTHVLLLVLHGGNILDTGAGDPSCKAADIHTFSSVLEKVTRAHFPAALGHILIKFVPCPAICSEAFSLVSHLNPYSHDEGCLSSS---QDHVPLAALPLLAISSPQYQDAVATVIERANQVYREFLKSSDGIGFSGQVCLIGDCVGGLLAFDAI 276          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Human
Match: PITPNM1 (phosphatidylinositol transfer protein membrane associated 1 [Source:HGNC Symbol;Acc:HGNC:9003])

HSP 1 Score: 381.719 bits (979), Expect = 4.813e-112
Identity = 211/564 (37.41%), Postives = 303/564 (53.72%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTS-------------EHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI--PVKYISNSKNL 3439
             V  FF+ GSP+GLV   R     +                      L  +  RP C  +YNLFH  DP + R+EPL+  +F AI P+ +  + +FP G+  S  L +TL  +  +      +L+  + TS             +  +  +A     +V +++  WWG KRIDY L+CP+ + AFP   LPHL HASYWES D  AFI+RQ+I+                E   L    EPS        +  Q       +      N+T+NHRA+D +V  G+PQ+L  RFMYG  D++T   EKVD+YIM  P+S G W   G+EVT+++GR+ F +   R +  GVYP+RMV++ D +  +  L V+    EAVVFSIDGSF ASVSI G DPKVR G++DV R WQD GYL++Y++ RP+MQ+  V  WL+QH FP G++ F DG++ +PL+QK   L  L++EV++ +   YGS KDV++Y +LGL   Q + +GR  R  +     L DGY +HL  L  +  + S  S       L +S + +  PV ++     L
Sbjct:  689 KVSGFFLFGSPLGLVLALRKTVMPA----------------------LEAAQMRPACEQIYNLFHAADPCASRLEPLLAPKFQAIAPLTVPRYQKFPLGDGSSLLLADTLQTHSSLFLEELEMLVPSTPTSTSGAFWKGSELATDPPAQPAAPSTTSEVVKILERWWGTKRIDYSLYCPEALTAFPTVTLPHLFHASYWESADVVAFILRQVIEK---------------ERPQLAECEEPSIYSPAFPREKWQRKRTQVKI-----RNVTSNHRASDTVVCEGRPQVLSGRFMYGPLDVVTLTGEKVDVYIMTQPLS-GKWIHFGTEVTNSSGRLTFPVPPERALGIGVYPVRMVVRGDHTYAECCLTVVARGTEAVVFSIDGSFTASVSIMGSDPKVRAGAVDVVRHWQDSGYLIVYVTGRPDMQKHRVVAWLSQHNFPHGVVSFCDGLTHDPLRQKAMFLQSLVQEVELNIVAGYGSPKDVAVYAALGLSPSQTYIVGRAVRKLQAQCQFLSDGYVAHLGQL--EAGSHSHASSGPPRAALGKSSYGVAAPVDFLRKQSQL 1207          

HSP 2 Score: 366.311 bits (939), Expect = 1.481e-106
Identity = 156/249 (62.65%), Postives = 200/249 (80.32%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEY I +P++++EY++AQLYMIQKKS++ES+G+GSGVEI+ N PY +GPGG GQYT K+YH+GSH+P WFR +LPK+AL VEEE+WNAYPYT+TRY  P ++KF++EIETYY  DGG Q NVFNL+  + +QRI+D +DIV D ++  +Y+ EEDP++Y S KT RGPL+D WA   +TA          +MCAYKLC+VEF+YWGMQ KIE+FI D+GLR+ MLRAHRQAWCWQDEW  LS+ DI
Sbjct:    1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGSGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWA---RTAAQTG-----PLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWTELSMADI 241          

HSP 3 Score: 103.219 bits (256), Expect = 1.754e-21
Identity = 53/156 (33.97%), Postives = 83/156 (53.21%), Query Frame = 2
Query: 1160 VFILVVHGGSLLDTN-HEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRN 1624
               L++H G++LD+   + ++K  D+  L   F++V +  +P     +A+RLV CP I +    +++ L+P   D   L  S   Q ++PLAA+PL  T +S Y+  +  +    N  YS F+RS EG  F GQV +I D +G I  FD L    N
Sbjct:  428 ALFLILHSGNILDSGPGDANSKQADVQTLSSAFEAVTRIHFPEALGHVALRLVPCPPICAAAYALVSNLSPYSHDGDSLSRS---QDHIPLAALPLLATSSSRYQGAVATVIARTNQAYSAFLRSPEGAGFCGQVALIGDGVGGILGFDALCHSAN 580          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Human
Match: PITPNM1 (phosphatidylinositol transfer protein membrane associated 1 [Source:HGNC Symbol;Acc:HGNC:9003])

HSP 1 Score: 381.719 bits (979), Expect = 4.813e-112
Identity = 211/564 (37.41%), Postives = 303/564 (53.72%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTS-------------EHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI--PVKYISNSKNL 3439
             V  FF+ GSP+GLV   R     +                      L  +  RP C  +YNLFH  DP + R+EPL+  +F AI P+ +  + +FP G+  S  L +TL  +  +      +L+  + TS             +  +  +A     +V +++  WWG KRIDY L+CP+ + AFP   LPHL HASYWES D  AFI+RQ+I+                E   L    EPS        +  Q       +      N+T+NHRA+D +V  G+PQ+L  RFMYG  D++T   EKVD+YIM  P+S G W   G+EVT+++GR+ F +   R +  GVYP+RMV++ D +  +  L V+    EAVVFSIDGSF ASVSI G DPKVR G++DV R WQD GYL++Y++ RP+MQ+  V  WL+QH FP G++ F DG++ +PL+QK   L  L++EV++ +   YGS KDV++Y +LGL   Q + +GR  R  +     L DGY +HL  L  +  + S  S       L +S + +  PV ++     L
Sbjct:  689 KVSGFFLFGSPLGLVLALRKTVMPA----------------------LEAAQMRPACEQIYNLFHAADPCASRLEPLLAPKFQAIAPLTVPRYQKFPLGDGSSLLLADTLQTHSSLFLEELEMLVPSTPTSTSGAFWKGSELATDPPAQPAAPSTTSEVVKILERWWGTKRIDYSLYCPEALTAFPTVTLPHLFHASYWESADVVAFILRQVIEK---------------ERPQLAECEEPSIYSPAFPREKWQRKRTQVKI-----RNVTSNHRASDTVVCEGRPQVLSGRFMYGPLDVVTLTGEKVDVYIMTQPLS-GKWIHFGTEVTNSSGRLTFPVPPERALGIGVYPVRMVVRGDHTYAECCLTVVARGTEAVVFSIDGSFTASVSIMGSDPKVRAGAVDVVRHWQDSGYLIVYVTGRPDMQKHRVVAWLSQHNFPHGVVSFCDGLTHDPLRQKAMFLQSLVQEVELNIVAGYGSPKDVAVYAALGLSPSQTYIVGRAVRKLQAQCQFLSDGYVAHLGQL--EAGSHSHASSGPPRAALGKSSYGVAAPVDFLRKQSQL 1207          

HSP 2 Score: 366.311 bits (939), Expect = 1.481e-106
Identity = 156/249 (62.65%), Postives = 200/249 (80.32%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEY I +P++++EY++AQLYMIQKKS++ES+G+GSGVEI+ N PY +GPGG GQYT K+YH+GSH+P WFR +LPK+AL VEEE+WNAYPYT+TRY  P ++KF++EIETYY  DGG Q NVFNL+  + +QRI+D +DIV D ++  +Y+ EEDP++Y S KT RGPL+D WA   +TA          +MCAYKLC+VEF+YWGMQ KIE+FI D+GLR+ MLRAHRQAWCWQDEW  LS+ DI
Sbjct:    1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGSGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWA---RTAAQTG-----PLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWTELSMADI 241          

HSP 3 Score: 103.219 bits (256), Expect = 1.754e-21
Identity = 53/156 (33.97%), Postives = 83/156 (53.21%), Query Frame = 2
Query: 1160 VFILVVHGGSLLDTN-HEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRN 1624
               L++H G++LD+   + ++K  D+  L   F++V +  +P     +A+RLV CP I +    +++ L+P   D   L  S   Q ++PLAA+PL  T +S Y+  +  +    N  YS F+RS EG  F GQV +I D +G I  FD L    N
Sbjct:  428 ALFLILHSGNILDSGPGDANSKQADVQTLSSAFEAVTRIHFPEALGHVALRLVPCPPICAAAYALVSNLSPYSHDGDSLSRS---QDHIPLAALPLLATSSSRYQGAVATVIARTNQAYSAFLRSPEGAGFCGQVALIGDGVGGILGFDALCHSAN 580          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Human
Match: PITPNM1 (phosphatidylinositol transfer protein membrane associated 1 [Source:HGNC Symbol;Acc:HGNC:9003])

HSP 1 Score: 380.948 bits (977), Expect = 7.941e-112
Identity = 211/564 (37.41%), Postives = 303/564 (53.72%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTS-------------EHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI--PVKYISNSKNL 3439
             V  FF+ GSP+GLV   R     +                        E+  RP C  +YNLFH  DP + R+EPL+  +F AI P+ +  + +FP G+  S  L +TL  +  +      +L+  + TS             +  +  +A     +V +++  WWG KRIDY L+CP+ + AFP   LPHL HASYWES D  AFI+RQ+I+                E   L    EPS        +  Q       +      N+T+NHRA+D +V  G+PQ+L  RFMYG  D++T   EKVD+YIM  P+S G W   G+EVT+++GR+ F +   R +  GVYP+RMV++ D +  +  L V+    EAVVFSIDGSF ASVSI G DPKVR G++DV R WQD GYL++Y++ RP+MQ+  V  WL+QH FP G++ F DG++ +PL+QK   L  L++EV++ +   YGS KDV++Y +LGL   Q + +GR  R  +     L DGY +HL  L  +  + S  S       L +S + +  PV ++     L
Sbjct:  689 KVSGFFLFGSPLGLVLALRKTVMPA-----------------------LEAQMRPACEQIYNLFHAADPCASRLEPLLAPKFQAIAPLTVPRYQKFPLGDGSSLLLADTLQTHSSLFLEELEMLVPSTPTSTSGAFWKGSELATDPPAQPAAPSTTSEVVKILERWWGTKRIDYSLYCPEALTAFPTVTLPHLFHASYWESADVVAFILRQVIEK---------------ERPQLAECEEPSIYSPAFPREKWQRKRTQVKI-----RNVTSNHRASDTVVCEGRPQVLSGRFMYGPLDVVTLTGEKVDVYIMTQPLS-GKWIHFGTEVTNSSGRLTFPVPPERALGIGVYPVRMVVRGDHTYAECCLTVVARGTEAVVFSIDGSFTASVSIMGSDPKVRAGAVDVVRHWQDSGYLIVYVTGRPDMQKHRVVAWLSQHNFPHGVVSFCDGLTHDPLRQKAMFLQSLVQEVELNIVAGYGSPKDVAVYAALGLSPSQTYIVGRAVRKLQAQCQFLSDGYVAHLGQL--EAGSHSHASSGPPRAALGKSSYGVAAPVDFLRKQSQL 1206          

HSP 2 Score: 366.311 bits (939), Expect = 1.474e-106
Identity = 156/249 (62.65%), Postives = 200/249 (80.32%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEY I +P++++EY++AQLYMIQKKS++ES+G+GSGVEI+ N PY +GPGG GQYT K+YH+GSH+P WFR +LPK+AL VEEE+WNAYPYT+TRY  P ++KF++EIETYY  DGG Q NVFNL+  + +QRI+D +DIV D ++  +Y+ EEDP++Y S KT RGPL+D WA   +TA          +MCAYKLC+VEF+YWGMQ KIE+FI D+GLR+ MLRAHRQAWCWQDEW  LS+ DI
Sbjct:    1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGSGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYHSVKTGRGPLSDDWA---RTAAQTG-----PLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWTELSMADI 241          

HSP 3 Score: 103.219 bits (256), Expect = 1.798e-21
Identity = 53/156 (33.97%), Postives = 83/156 (53.21%), Query Frame = 2
Query: 1160 VFILVVHGGSLLDTN-HEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRN 1624
               L++H G++LD+   + ++K  D+  L   F++V +  +P     +A+RLV CP I +    +++ L+P   D   L  S   Q ++PLAA+PL  T +S Y+  +  +    N  YS F+RS EG  F GQV +I D +G I  FD L    N
Sbjct:  428 ALFLILHSGNILDSGPGDANSKQADVQTLSSAFEAVTRIHFPEALGHVALRLVPCPPICAAAYALVSNLSPYSHDGDSLSRS---QDHIPLAALPLLATSSSRYQGAVATVIARTNQAYSAFLRSPEGAGFCGQVALIGDGVGGILGFDALCHSAN 580          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Celegans
Match: pitp-1 (PhosphatidylInositol Transfer Protein family [Source:UniProtKB/TrEMBL;Acc:G5EED9])

HSP 1 Score: 363.614 bits (932), Expect = 1.292e-107
Identity = 161/249 (64.66%), Postives = 195/249 (78.31%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEYRI +P+TV+EYRIAQLYMIQKKS+ +S GQ SGVEII N+PY +GPGG GQYTFKIYHIGS +P W R +LP +AL   EE+WNAYP TKTRY  P++D+F+LE+ET YF+D G Q+NVFNLN++D   RIIDY+D V DPISS DY  EEDPK+Y S  TNRGPL D W  E+       +   + IMCAYKLC+VEF+YWGMQT+ E++I D+ LR TM+RAHRQAW WQDEW GL++ DI
Sbjct:    1 MLIKEYRILLPMTVQEYRIAQLYMIQKKSRLDSHGQDSGVEIISNKPYTDGPGGSGQYTFKIYHIGSRIPAWIRTVLPTNALEAHEESWNAYPVTKTRYSTPMMDRFSLEVETLYFDDHGQQENVFNLNEKDKSTRIIDYMDFVKDPISSHDYCAEEDPKLYRSETTNRGPLNDDWVAEH-------LKKGLPIMCAYKLCKVEFRYWGMQTRAERWIHDLALRNTMMRAHRQAWAWQDEWTGLTMNDI 242          

HSP 2 Score: 295.819 bits (756), Expect = 1.285e-83
Identity = 205/779 (26.32%), Postives = 364/779 (46.73%), Query Frame = 2
Query: 1145 SIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSK-------------------FRNDSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQ-----------------------FFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSK 3355
            S + ++ I+V HG      ++   +K  D      T ++ ++  YP L N++ +  V+C   ++ +++ L+ ++P      +    PSL   +P A+          Y + ++      N+ Y+EFI S+    F+G+V ++ D +G I +++ +++                    + D  P  + + ++  ++  + S     +    D  SLQ+   S     +         V +                        F+LG P+GL  + R                           + SE +   +C+ L+NL++  DP   RIEP+++ +   +PP  +  + R+P                           L D  + + +S + A              WG KRID  L+CP+ + A P  ALP++LHASYWES D A+F++RQ +          N +   + S  +NN   P  ID       ++ +    A       N++ANHRAND++V +G    ++A+F YG  D++    E V +++       G W   G   TD++GR+   +A++  +P G++ +++V+  D S +   +A++P   +  VFS+DGS  ASVS++GKDP+VRPG++DV R+WQ++GYL+IY++ARP+MQQR V  WLAQH FP  ++ F++  S EP  ++  +  + I ++ + +H AYGS KDV++Y S G+    + ++      ++ N   + + Y+SHL  L     TL K
Sbjct:  328 STEVALLIMVFHGD--FSPDNPADSKTTDTNTFSSTIETCVQRHYPQLRNRLHIVNVSCGHEMTQVVSKLSNISPS-----FGLLHPSLSLMLPSAS--------HLYNEAVEGTIRRANETYNEFIASQP--LFNGEVFVVGDCVGGIFLYEAMTRKCDSMTLLKRLSSNLSSRIIKEDQSPHQSMTDITITDTSSISSCPQQHNQSVRDHSSLQNGHASRRSARNYSAPPSASYVRKKISLVSVDSVSFGASRLSFQPSTVFLLGCPLGLTLMQRKL-------------------------DGSEIDGLDSCQ-LFNLYYPLDPCGARIEPVLDGQLSCVPPYNVPKYQRYP---------------------------LGDGKSQKFESTIDA-----------TQMWGSKRIDNLLYCPNSMVALPSSALPNILHASYWESCDVASFLLRQFVRGE------ENSVLTTLSS-SMNNI--PLNIDLPTMHWKRKRTRFKIA-------NLSANHRANDILVTAGMDLTVIAKFCYGPMDLVALSREPVSVFVYP---QRGDWYLHGVFDTDSHGRLTLQLAKT--LPCGIHSVKIVVHGDRSYLDAFVAIVPHGTKCAVFSVDGSLTASVSVTGKDPRVRPGAVDVVRYWQEQGYLIIYLTARPDMQQRVVSAWLAQHNFPHALLFFNNSFSTEP-LKQKSLHLRHIVDMGVHIHVAYGSGKDVNVYTSAGVDPEHVISVA---GSRRRNCVQI-ESYSSHLAALNSGQCTLGK 999          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Celegans
Match: Y54F10AR.1 (pep chromosome:WBcel235:III:2572031:2575723:-1 gene:WBGene00021854.1 transcript:Y54F10AR.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y54F10AR.1)

HSP 1 Score: 195.282 bits (495), Expect = 8.352e-56
Identity = 103/258 (39.92%), Postives = 154/258 (59.69%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGP---GGI--GQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVP--IIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDP--ISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            M+IKEYR+ +P++VEEY++ QL+ + + SK E TG G GVE+++NEP++N P   G    GQYT KIYH+ S +P   R I PK +L + EEAWNAYPY KT    P  + + F ++IET +  D G  +N   L  +++ +R +  ++I ND   ++S D   +  P  + S+KT RGPL+ +W            DS   +MCAYKL  V FK++G Q  +E +       +   + HR+ +CW D+WHGL++ DI
Sbjct:    1 MIIKEYRVVLPMSVEEYQVGQLWSVAEASKAE-TGGGEGVEVLKNEPFDNVPLLNGQFTKGQYTHKIYHLQSKVPAILRKIAPKGSLAIHEEAWNAYPYCKTVVTNPDYMKENFYVKIETIHLPDNGTTENAHGLKGDELAKREVVNINIANDHEYLNSGDLHPDSTPSKFQSTKTGRGPLSGNWK-----------DSVQPVMCAYKLVTVYFKWFGFQKIVENYA-HTQYPRLFSKFHREVFCWIDKWHGLTMVDI 245          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Celegans
Match: Y71G12B.17 (pep chromosome:WBcel235:I:1667501:1669792:1 gene:WBGene00022155.1 transcript:Y71G12B.17.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Y71G12B.17)

HSP 1 Score: 140.584 bits (353), Expect = 7.816e-37
Identity = 90/257 (35.02%), Postives = 134/257 (52.14%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENG---PGGI--GQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVP--IIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIV-NDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            M++KEYRI +PLTV+E+    LY +   S++E TG G GVE +  E + +    PG    G YT KIY + S  P   + +LP  A ++ EE+WNAYPY KT    P  + D F   IET + +D G  +N  +      ++R I ++DI  ND   + +Y KE+D +++ +    RGPL + W           +D +  +MC YKL    FK+ G+Q  +EK +     R   L  HR A+   D W  +S+  I
Sbjct:    1 MIVKEYRIPLPLTVDEFERGLLYAVSACSRNE-TGGGEGVEFLVQEDFTSNTLRPGQTVSGTYTKKIYRLRSKAPWVLQKLLPPEAFVIYEESWNAYPYCKTVLTNPGYMKDNFHQIIETIHLDDNGSSENPLD----GPEKREIVFIDIADNDIFGTKNYEKEKDARLFEAETVERGPLDEDW-----------IDEHDPVMCCYKLVSCHFKWTGLQRMVEKTVHKQYPRVFGL-MHRDAYVLLDNWFNMSMESI 240          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Fly
Match: rdgB (gene:FBgn0003218 transcript:FBtr0073823)

HSP 1 Score: 478.404 bits (1230), Expect = 1.111e-147
Identity = 290/778 (37.28%), Postives = 430/778 (55.27%), Query Frame = 2
Query: 1157 SVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYY--VPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSIN-----------FDSSHR--ESDP------ISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGIL----LNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEF--ANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
            ++ ILVVH GS+LD   E   K  D+   R +F++V++  YP L   + +++V CPSI +D L IL+ L+P   D    PS+  +     VP+ AIPL    +  + + ++    + N  Y EF++SEEG  F GQ++++ D++GS+  ++ L +  N S+P  T+S  S        +IN            D   R  E+D       ++    +  SS    S   KLDF V  FFM GSP+ +V   R       A                          RPNC  +YNLFH  DP + R+EPL++ RF  + P+ +  + ++P GN    +L+E + ++P    +   +L    L+D+S     S L   +    +  + N WWG KR+DY L+CP+G+  FP  ALPHL HASYWES D  AFI+RQI     +   F  +ND   D  S H     E  +I K   +K K               N+ ANHRANDV+V  G+ Q L ARFMYG  DM+T   EKVD++IM  P + G W    +EVTD NGR+ + I +   +  G+YP++MV++ D + V  ++AV+P   E VVFSIDGSF AS+S++G+DPKVR G++DV R WQ+ GYLLIYI+ RP+MQQ+ V  WL+QH FP G+I F+DG+S +PL  K   L+ L++   I +  AYGSSKD+S+Y ++G+ + QIF +G++ +  ++N+  L DGYA+HL  L       S+P++  + + + R CF++P
Sbjct:  504 TILILVVHAGSVLDAASELTAKKSDVTTFRGSFEAVMRQHYPSLLTHVTIKMVPCPSICTDALGILSSLSPYSFDAS--PSAADIPNIADVPIGAIPLLSVASPEFHETVNKTVAAANIVYHEFLKSEEGHGFSGQIVMLGDSMGSLLAYEALCR-SNGSQPG-TASGASNSGGDAATNINTHNPLSPRNSRLDDDERFIEADLDAKRLLVAPSPRRRRSSSSSDSRATKLDFEVCDFFMFGSPLSVVLAARKLHDAKAALP------------------------RPNCHQVYNLFHPTDPIASRLEPLLSARFSILAPVNVPRYAKYPLGNGQPLHLLEVIQSHPQHFNDGNNLLAGRRLSDASMQSTISGLIENVSLSTIHALQNKWWGTKRLDYALYCPEGLSNFPAHALPHLFHASYWESPDVIAFILRQI--GKFEGIPFVGSND-DKDNASFHPGQPRE-KWIKKRTSVKLK---------------NVAANHRANDVIVQEGREQRLNARFMYGPLDMITLHGEKVDVHIMKDPPA-GEWTFLSTEVTDKNGRISYSIPDQVSLGYGIYPVKMVVRGDHTSVDCYMAVVPPLTECVVFSIDGSFTASMSVTGRDPKVRAGAVDVCRHWQELGYLLIYITGRPDMQQQRVVSWLSQHNFPHGLISFADGLSTDPLGHKTAYLNNLVQNHGISITAAYGSSKDISVYTNVGMRTDQIFIVGKVGKKLQSNATVLSDGYAAHLAGLQAVGG--SRPAKGNARMVIPRGCFNLP 1231          

HSP 2 Score: 372.089 bits (954), Expect = 6.829e-109
Identity = 175/271 (64.58%), Postives = 210/271 (77.49%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEY---KTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQE 847
            MLIKEYRI +PLTVEEYRIAQLYMI KKS++ES G+GSGVEII NEPY++GPGG GQYT KIYH+G+HLP W +++LPKSAL VEEEAWNAYPYT+TRY  P ++KF+L+IETYY+ D G QDNVF L+  D++ RI+D +DIV D +   DY KEEDPK +VS KT RGPL + W  EY      + +    NM +M AYK+CRVEF+YWGMQTK+EKFI D+ LRK MLRAHRQAW WQDEW GL+I DIR LE +    LA+KM   E
Sbjct:    1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMGGGE 271          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Fly
Match: rdgB (gene:FBgn0003218 transcript:FBtr0301533)

HSP 1 Score: 478.404 bits (1230), Expect = 1.111e-147
Identity = 290/778 (37.28%), Postives = 430/778 (55.27%), Query Frame = 2
Query: 1157 SVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYY--VPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSIN-----------FDSSHR--ESDP------ISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGIL----LNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEF--ANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
            ++ ILVVH GS+LD   E   K  D+   R +F++V++  YP L   + +++V CPSI +D L IL+ L+P   D    PS+  +     VP+ AIPL    +  + + ++    + N  Y EF++SEEG  F GQ++++ D++GS+  ++ L +  N S+P  T+S  S        +IN            D   R  E+D       ++    +  SS    S   KLDF V  FFM GSP+ +V   R       A                          RPNC  +YNLFH  DP + R+EPL++ RF  + P+ +  + ++P GN    +L+E + ++P    +   +L    L+D+S     S L   +    +  + N WWG KR+DY L+CP+G+  FP  ALPHL HASYWES D  AFI+RQI     +   F  +ND   D  S H     E  +I K   +K K               N+ ANHRANDV+V  G+ Q L ARFMYG  DM+T   EKVD++IM  P + G W    +EVTD NGR+ + I +   +  G+YP++MV++ D + V  ++AV+P   E VVFSIDGSF AS+S++G+DPKVR G++DV R WQ+ GYLLIYI+ RP+MQQ+ V  WL+QH FP G+I F+DG+S +PL  K   L+ L++   I +  AYGSSKD+S+Y ++G+ + QIF +G++ +  ++N+  L DGYA+HL  L       S+P++  + + + R CF++P
Sbjct:  504 TILILVVHAGSVLDAASELTAKKSDVTTFRGSFEAVMRQHYPSLLTHVTIKMVPCPSICTDALGILSSLSPYSFDAS--PSAADIPNIADVPIGAIPLLSVASPEFHETVNKTVAAANIVYHEFLKSEEGHGFSGQIVMLGDSMGSLLAYEALCR-SNGSQPG-TASGASNSGGDAATNINTHNPLSPRNSRLDDDERFIEADLDAKRLLVAPSPRRRRSSSSSDSRATKLDFEVCDFFMFGSPLSVVLAARKLHDAKAALP------------------------RPNCHQVYNLFHPTDPIASRLEPLLSARFSILAPVNVPRYAKYPLGNGQPLHLLEVIQSHPQHFNDGNNLLAGRRLSDASMQSTISGLIENVSLSTIHALQNKWWGTKRLDYALYCPEGLSNFPAHALPHLFHASYWESPDVIAFILRQI--GKFEGIPFVGSND-DKDNASFHPGQPRE-KWIKKRTSVKLK---------------NVAANHRANDVIVQEGREQRLNARFMYGPLDMITLHGEKVDVHIMKDPPA-GEWTFLSTEVTDKNGRISYSIPDQVSLGYGIYPVKMVVRGDHTSVDCYMAVVPPLTECVVFSIDGSFTASMSVTGRDPKVRAGAVDVCRHWQELGYLLIYITGRPDMQQQRVVSWLSQHNFPHGLISFADGLSTDPLGHKTAYLNNLVQNHGISITAAYGSSKDISVYTNVGMRTDQIFIVGKVGKKLQSNATVLSDGYAAHLAGLQAVGG--SRPAKGNARMVIPRGCFNLP 1231          

HSP 2 Score: 372.089 bits (954), Expect = 6.829e-109
Identity = 175/271 (64.58%), Postives = 210/271 (77.49%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEY---KTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQE 847
            MLIKEYRI +PLTVEEYRIAQLYMI KKS++ES G+GSGVEII NEPY++GPGG GQYT KIYH+G+HLP W +++LPKSAL VEEEAWNAYPYT+TRY  P ++KF+L+IETYY+ D G QDNVF L+  D++ RI+D +DIV D +   DY KEEDPK +VS KT RGPL + W  EY      + +    NM +M AYK+CRVEF+YWGMQTK+EKFI D+ LRK MLRAHRQAW WQDEW GL+I DIR LE +    LA+KM   E
Sbjct:    1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMGGGE 271          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Fly
Match: rdgB (gene:FBgn0003218 transcript:FBtr0073822)

HSP 1 Score: 478.404 bits (1230), Expect = 1.170e-147
Identity = 290/778 (37.28%), Postives = 430/778 (55.27%), Query Frame = 2
Query: 1157 SVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYY--VPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSIN-----------FDSSHR--ESDP------ISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGIL----LNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEF--ANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
            ++ ILVVH GS+LD   E   K  D+   R +F++V++  YP L   + +++V CPSI +D L IL+ L+P   D    PS+  +     VP+ AIPL    +  + + ++    + N  Y EF++SEEG  F GQ++++ D++GS+  ++ L +  N S+P  T+S  S        +IN            D   R  E+D       ++    +  SS    S   KLDF V  FFM GSP+ +V   R       A                          RPNC  +YNLFH  DP + R+EPL++ RF  + P+ +  + ++P GN    +L+E + ++P    +   +L    L+D+S     S L   +    +  + N WWG KR+DY L+CP+G+  FP  ALPHL HASYWES D  AFI+RQI     +   F  +ND   D  S H     E  +I K   +K K               N+ ANHRANDV+V  G+ Q L ARFMYG  DM+T   EKVD++IM  P + G W    +EVTD NGR+ + I +   +  G+YP++MV++ D + V  ++AV+P   E VVFSIDGSF AS+S++G+DPKVR G++DV R WQ+ GYLLIYI+ RP+MQQ+ V  WL+QH FP G+I F+DG+S +PL  K   L+ L++   I +  AYGSSKD+S+Y ++G+ + QIF +G++ +  ++N+  L DGYA+HL  L       S+P++  + + + R CF++P
Sbjct:  504 TILILVVHAGSVLDAASELTAKKSDVTTFRGSFEAVMRQHYPSLLTHVTIKMVPCPSICTDALGILSSLSPYSFDAS--PSAADIPNIADVPIGAIPLLSVASPEFHETVNKTVAAANIVYHEFLKSEEGHGFSGQIVMLGDSMGSLLAYEALCR-SNGSQPG-TASGASNSGGDAATNINTHNPLSPRNSRLDDDERFIEADLDAKRLLVAPSPRRRRSSSSSDSRATKLDFEVCDFFMFGSPLSVVLAARKLHDAKAALP------------------------RPNCHQVYNLFHPTDPIASRLEPLLSARFSILAPVNVPRYAKYPLGNGQPLHLLEVIQSHPQHFNDGNNLLAGRRLSDASMQSTISGLIENVSLSTIHALQNKWWGTKRLDYALYCPEGLSNFPAHALPHLFHASYWESPDVIAFILRQI--GKFEGIPFVGSND-DKDNASFHPGQPRE-KWIKKRTSVKLK---------------NVAANHRANDVIVQEGREQRLNARFMYGPLDMITLHGEKVDVHIMKDPPA-GEWTFLSTEVTDKNGRISYSIPDQVSLGYGIYPVKMVVRGDHTSVDCYMAVVPPLTECVVFSIDGSFTASMSVTGRDPKVRAGAVDVCRHWQELGYLLIYITGRPDMQQQRVVSWLSQHNFPHGLISFADGLSTDPLGHKTAYLNNLVQNHGISITAAYGSSKDISVYTNVGMRTDQIFIVGKVGKKLQSNATVLSDGYAAHLAGLQAVGG--SRPAKGNARMVIPRGCFNLP 1231          

HSP 2 Score: 371.703 bits (953), Expect = 8.998e-109
Identity = 175/271 (64.58%), Postives = 210/271 (77.49%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEY---KTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQE 847
            MLIKEYRI +PLTVEEYRIAQLYMI KKS++ES G+GSGVEII NEPY++GPGG GQYT KIYH+G+HLP W +++LPKSAL VEEEAWNAYPYT+TRY  P ++KF+L+IETYY+ D G QDNVF L+  D++ RI+D +DIV D +   DY KEEDPK +VS KT RGPL + W  EY      + +    NM +M AYK+CRVEF+YWGMQTK+EKFI D+ LRK MLRAHRQAW WQDEW GL+I DIR LE +    LA+KM   E
Sbjct:    1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMGGGE 271          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Fly
Match: rdgB (gene:FBgn0003218 transcript:FBtr0100194)

HSP 1 Score: 478.404 bits (1230), Expect = 1.170e-147
Identity = 290/778 (37.28%), Postives = 430/778 (55.27%), Query Frame = 2
Query: 1157 SVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYY--VPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSIN-----------FDSSHR--ESDP------ISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGIL----LNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEF--ANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
            ++ ILVVH GS+LD   E   K  D+   R +F++V++  YP L   + +++V CPSI +D L IL+ L+P   D    PS+  +     VP+ AIPL    +  + + ++    + N  Y EF++SEEG  F GQ++++ D++GS+  ++ L +  N S+P  T+S  S        +IN            D   R  E+D       ++    +  SS    S   KLDF V  FFM GSP+ +V   R       A                          RPNC  +YNLFH  DP + R+EPL++ RF  + P+ +  + ++P GN    +L+E + ++P    +   +L    L+D+S     S L   +    +  + N WWG KR+DY L+CP+G+  FP  ALPHL HASYWES D  AFI+RQI     +   F  +ND   D  S H     E  +I K   +K K               N+ ANHRANDV+V  G+ Q L ARFMYG  DM+T   EKVD++IM  P + G W    +EVTD NGR+ + I +   +  G+YP++MV++ D + V  ++AV+P   E VVFSIDGSF AS+S++G+DPKVR G++DV R WQ+ GYLLIYI+ RP+MQQ+ V  WL+QH FP G+I F+DG+S +PL  K   L+ L++   I +  AYGSSKD+S+Y ++G+ + QIF +G++ +  ++N+  L DGYA+HL  L       S+P++  + + + R CF++P
Sbjct:  504 TILILVVHAGSVLDAASELTAKKSDVTTFRGSFEAVMRQHYPSLLTHVTIKMVPCPSICTDALGILSSLSPYSFDAS--PSAADIPNIADVPIGAIPLLSVASPEFHETVNKTVAAANIVYHEFLKSEEGHGFSGQIVMLGDSMGSLLAYEALCR-SNGSQPG-TASGASNSGGDAATNINTHNPLSPRNSRLDDDERFIEADLDAKRLLVAPSPRRRRSSSSSDSRATKLDFEVCDFFMFGSPLSVVLAARKLHDAKAALP------------------------RPNCHQVYNLFHPTDPIASRLEPLLSARFSILAPVNVPRYAKYPLGNGQPLHLLEVIQSHPQHFNDGNNLLAGRRLSDASMQSTISGLIENVSLSTIHALQNKWWGTKRLDYALYCPEGLSNFPAHALPHLFHASYWESPDVIAFILRQI--GKFEGIPFVGSND-DKDNASFHPGQPRE-KWIKKRTSVKLK---------------NVAANHRANDVIVQEGREQRLNARFMYGPLDMITLHGEKVDVHIMKDPPA-GEWTFLSTEVTDKNGRISYSIPDQVSLGYGIYPVKMVVRGDHTSVDCYMAVVPPLTECVVFSIDGSFTASMSVTGRDPKVRAGAVDVCRHWQELGYLLIYITGRPDMQQQRVVSWLSQHNFPHGLISFADGLSTDPLGHKTAYLNNLVQNHGISITAAYGSSKDISVYTNVGMRTDQIFIVGKVGKKLQSNATVLSDGYAAHLAGLQAVGG--SRPAKGNARMVIPRGCFNLP 1231          

HSP 2 Score: 371.703 bits (953), Expect = 8.998e-109
Identity = 175/271 (64.58%), Postives = 210/271 (77.49%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEY---KTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQE 847
            MLIKEYRI +PLTVEEYRIAQLYMI KKS++ES G+GSGVEII NEPY++GPGG GQYT KIYH+G+HLP W +++LPKSAL VEEEAWNAYPYT+TRY  P ++KF+L+IETYY+ D G QDNVF L+  D++ RI+D +DIV D +   DY KEEDPK +VS KT RGPL + W  EY      + +    NM +M AYK+CRVEF+YWGMQTK+EKFI D+ LRK MLRAHRQAW WQDEW GL+I DIR LE +    LA+KM   E
Sbjct:    1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMGGGE 271          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Fly
Match: rdgB (gene:FBgn0003218 transcript:FBtr0100195)

HSP 1 Score: 478.404 bits (1230), Expect = 1.170e-147
Identity = 290/778 (37.28%), Postives = 430/778 (55.27%), Query Frame = 2
Query: 1157 SVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYY--VPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSIN-----------FDSSHR--ESDP------ISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGIL----LNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEF--ANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
            ++ ILVVH GS+LD   E   K  D+   R +F++V++  YP L   + +++V CPSI +D L IL+ L+P   D    PS+  +     VP+ AIPL    +  + + ++    + N  Y EF++SEEG  F GQ++++ D++GS+  ++ L +  N S+P  T+S  S        +IN            D   R  E+D       ++    +  SS    S   KLDF V  FFM GSP+ +V   R       A                          RPNC  +YNLFH  DP + R+EPL++ RF  + P+ +  + ++P GN    +L+E + ++P    +   +L    L+D+S     S L   +    +  + N WWG KR+DY L+CP+G+  FP  ALPHL HASYWES D  AFI+RQI     +   F  +ND   D  S H     E  +I K   +K K               N+ ANHRANDV+V  G+ Q L ARFMYG  DM+T   EKVD++IM  P + G W    +EVTD NGR+ + I +   +  G+YP++MV++ D + V  ++AV+P   E VVFSIDGSF AS+S++G+DPKVR G++DV R WQ+ GYLLIYI+ RP+MQQ+ V  WL+QH FP G+I F+DG+S +PL  K   L+ L++   I +  AYGSSKD+S+Y ++G+ + QIF +G++ +  ++N+  L DGYA+HL  L       S+P++  + + + R CF++P
Sbjct:  504 TILILVVHAGSVLDAASELTAKKSDVTTFRGSFEAVMRQHYPSLLTHVTIKMVPCPSICTDALGILSSLSPYSFDAS--PSAADIPNIADVPIGAIPLLSVASPEFHETVNKTVAAANIVYHEFLKSEEGHGFSGQIVMLGDSMGSLLAYEALCR-SNGSQPG-TASGASNSGGDAATNINTHNPLSPRNSRLDDDERFIEADLDAKRLLVAPSPRRRRSSSSSDSRATKLDFEVCDFFMFGSPLSVVLAARKLHDAKAALP------------------------RPNCHQVYNLFHPTDPIASRLEPLLSARFSILAPVNVPRYAKYPLGNGQPLHLLEVIQSHPQHFNDGNNLLAGRRLSDASMQSTISGLIENVSLSTIHALQNKWWGTKRLDYALYCPEGLSNFPAHALPHLFHASYWESPDVIAFILRQI--GKFEGIPFVGSND-DKDNASFHPGQPRE-KWIKKRTSVKLK---------------NVAANHRANDVIVQEGREQRLNARFMYGPLDMITLHGEKVDVHIMKDPPA-GEWTFLSTEVTDKNGRISYSIPDQVSLGYGIYPVKMVVRGDHTSVDCYMAVVPPLTECVVFSIDGSFTASMSVTGRDPKVRAGAVDVCRHWQELGYLLIYITGRPDMQQQRVVSWLSQHNFPHGLISFADGLSTDPLGHKTAYLNNLVQNHGISITAAYGSSKDISVYTNVGMRTDQIFIVGKVGKKLQSNATVLSDGYAAHLAGLQAVGG--SRPAKGNARMVIPRGCFNLP 1231          

HSP 2 Score: 371.703 bits (953), Expect = 8.998e-109
Identity = 175/271 (64.58%), Postives = 210/271 (77.49%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEY---KTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQE 847
            MLIKEYRI +PLTVEEYRIAQLYMI KKS++ES G+GSGVEII NEPY++GPGG GQYT KIYH+G+HLP W +++LPKSAL VEEEAWNAYPYT+TRY  P ++KF+L+IETYY+ D G QDNVF L+  D++ RI+D +DIV D +   DY KEEDPK +VS KT RGPL + W  EY      + +    NM +M AYK+CRVEF+YWGMQTK+EKFI D+ LRK MLRAHRQAW WQDEW GL+I DIR LE +    LA+KM   E
Sbjct:    1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMGGGE 271          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Zebrafish
Match: pitpnm3 (PITPNM family member 3 [Source:ZFIN;Acc:ZDB-GENE-030131-9216])

HSP 1 Score: 380.948 bits (977), Expect = 2.194e-114
Identity = 226/566 (39.93%), Postives = 318/566 (56.18%), Query Frame = 2
Query: 1796 VHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNP-----------GVI-------ENAPGILLND----SSTSEHDSNLSAFLKCVQVKQVVN---SWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDAS-MQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVK 3415
            V   F+LG P+GLV   R     +                      +  S  RP C  ++NLF+ +DPS+ R+EPL++ +FH +PP  +  + R+P G+  S  + + + + P           GV+       E   G+ +      SS +  DS  S  L+      + N   SWWG KR+DY L+CPD + +FP  ALPHL HASYWES D  AF++RQ++    ++ QE  N  +A         FS  S  +K ++ ++           V  R N+TANHR NDV+      Q L+ RFMYG  DM+T   EKVD+Y+M  P S   W    +EVT+++GRV + I +S+++  GVYPI+MV+K D +  +  L VLP  +E VVFSIDGSFAASVSI G DPKVRPG++DV R WQD GYL+IYI+ RP+MQ++ V  WL+QH FP GMI FS+G+  +PL+QK   L  L++E  IK++CAYGS KD+S+Y  LGL  +QI+ +GR  +  +N    L +GYA HL+ L        K S  +  V LR+  F +  K
Sbjct:  360 VSDCFLLGCPLGLVLAMRRTVLPA----------------------VQVSQLRPACSQIFNLFYPSDPSASRLEPLLHSQFHKLPPFPVPRYQRYPLGDGRSNLIADEIPSYPDAFLPGSVVPVGVLQPSSPQTERTAGVRVGGEVRRSSLTSMDSQSSGCLESRLSSTIANISSSWWGSKRLDYALYCPDVLTSFPTVALPHLFHASYWESTDVVAFLLRQVMHCDYVKAQEMDNCDSAP--------FSPSSPREKWLRRRTH----------VKLR-NVTANHRVNDVIATEDGHQTLVGRFMYGPLDMVTLTGEKVDVYVMTQPQS-SRWVHLDTEVTNSSGRVTYTIPKSKKLAVGVYPIKMVVKGDQTSGEAFLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYLIIYITGRPDMQKQRVVSWLSQHNFPQGMIFFSEGLVHDPLRQKTIFLRNLMQECHIKINCAYGSMKDISVYSILGLSPNQIYIVGRPSKKYQNQCQFLSEGYAVHLSSLQFSHRARPKKSSSVRMV-LRKGSFGLSAK 882          

HSP 2 Score: 77.411 bits (189), Expect = 9.879e-14
Identity = 51/166 (30.72%), Postives = 85/166 (51.20%), Query Frame = 2
Query: 1139 TQSIQKSVFILVVHGGSLLD-TNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSR 1633
             +  Q  V +LVVHGG++LD    E   K  D+  L    + V ++ +      + ++LV CP++ ++   +++ L P   D+  + SS     ++PLAA+PL    A +Y+  +  +    N  Y  F++S EGQ F GQV ++ D +G +  FD L  F N  R
Sbjct:   98 AEKCQTHVLVLVVHGGNILDPAGGEPGAKTTDVNTLSSVLEKVSQAHFQAAAQHVVIKLVPCPAVCAEAFCLVSNLNPYSYDESCVSSSVD---HLPLAALPLLAIAAPHYQDAVATVIARANQVYHRFLQSPEGQGFTGQVCLLGDCVGGVLCFDALC-FSNSPR 259          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Zebrafish
Match: plrdgb (PITP-less RdgB-like protein [Source:ZFIN;Acc:ZDB-GENE-000406-3])

HSP 1 Score: 363.614 bits (932), Expect = 3.994e-108
Identity = 203/502 (40.44%), Postives = 293/502 (58.37%), Query Frame = 2
Query: 1943 SNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNN---PGVIENAPGILLNDSSTSEHDSNLSAFLKC--------VQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVK 3415
            +  RP C  ++NLF+ +DPS+ R+EPL++     +PP  +  + R P G+  ST +++T+  +    GV  +         S S   S+ +  L          V + QV + WWG KR+DY L+CPD +  FP  ALPHL HASYWES D  AFI+RQ++         A+   +D   +  ++  E     +                 V  R N+TANHR +DV+V    PQ L+ RFMYG  DM+T   EKVD+++     S G W    + VT ++GRV + I +++R+  GVYPI+MV+K D +  +  L VLP  +E VVFSIDGSFAASVS+ G DPKVRPG++DV R WQD GYL+IYI+ RP+MQ++ V  WL+QH FP GM+ FS+G+  +PL+QK   L  L+KE  IK+  AYGS KD+S+Y +LGL  +QI+ +GR  +  ++    L +GYA+HL+ L  +  + SK +R +    LR+  F +  K
Sbjct:  386 AQLRPACSQIFNLFYPSDPSASRLEPLLHSVLTQLPPFPVPRYQRCPLGDGRSTLIVDTVLRHVTEGGVSADGAADQCYGGSVSRRGSDRAVPLGSEGTAPSEPVSISQVCSRWWGSKRLDYVLYCPDVLTTFPTIALPHLFHASYWESTDAVAFILRQVMRCDCLKAGEAD--CSDAIPISPSSPREKWLRRRTH---------------VKLR-NITANHRVHDVIVTEDGPQTLVGRFMYGPLDMVTLTGEKVDVFLKTQSGS-GRWVLFDTVVTSSSGRVSYTIPDNKRLGVGVYPIKMVVKGDQTSAEAFLTVLPQGMECVVFSIDGSFAASVSLMGSDPKVRPGAVDVVRHWQDLGYLIIYITGRPDMQKQRVVSWLSQHNFPQGMVFFSEGLVHDPLRQKTIFLKSLVKECHIKISAAYGSMKDMSVYSTLGLAPNQIYIVGRPSKKHQHQCQFLSEGYAAHLSTLEFEHGSRSKKNRMV----LRQGSFGLSSK 864          

HSP 2 Score: 71.633 bits (174), Expect = 5.633e-12
Identity = 46/159 (28.93%), Postives = 81/159 (50.94%), Query Frame = 2
Query: 1136 MTQSIQKSVFILVVHGGSLLDTNHEYHNKNG-DIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
            M +  +  + ILV+HGG +LD+          D   L    + V ++ +    + + +RLV CP + +D  T+++ L P   D+  + +S     ++PLAA+P+    A +Y+  +  +    N  Y  F++S EG  F GQV ++AD +G +  FD L
Sbjct:   96 MERKCRTQLLILVIHGGHILDSGGGDPGGKAGDAATLASVLERVARAHFQAAADSMLVRLVPCPPVCADAFTLVSNLNPYSYDENCVSTSVD---HLPLAALPILAIAAPHYQNAVAAVIAQANQVYRNFLQSPEGVGFTGQVCLVADCVGGVLCFDAL 251          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Zebrafish
Match: PITPNM2 (phosphatidylinositol transfer protein membrane associated 2 [Source:HGNC Symbol;Acc:HGNC:21044])

HSP 1 Score: 366.696 bits (940), Expect = 2.222e-107
Identity = 162/249 (65.06%), Postives = 202/249 (81.12%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEYRI MPL+VEEYRIAQLYMIQKKS++ES G+GSGVEI+ N PY +GPGG GQYT K+YHIG H+P+WFR+ILPK+AL VEEE+WNAYPYT+TR+  P ++KF+++IETYY  D G Q++VFNL+  + +QR ID +DIV D I+  +Y  EEDPK+Y S+KT RGPL+D W TE       N      +MCAYKLC+VEF+YWGMQ+KIE+FI D+GLRK M+RAHRQAWCWQDEW+GL++ DI
Sbjct:    1 MLIKEYRIPMPLSVEEYRIAQLYMIQKKSREESEGEGSGVEILENRPYTDGPGGSGQYTRKVYHIGQHIPSWFRSILPKAALRVEEESWNAYPYTRTRHTCPFVEKFSIDIETYYKPDTGSQNDVFNLSSAEKRQRDIDPIDIVKDFIAPHEYLVEEDPKLYKSNKTQRGPLSDDWITEIN-----NNPGKTPVMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTMEDI 244          

HSP 2 Score: 167.548 bits (423), Expect = 1.589e-41
Identity = 103/284 (36.27%), Postives = 160/284 (56.34%), Query Frame = 2
Query: 2558 NMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISN-VTLRRSCFDI 3406
            N+TANHR ND +      Q++  RFMYG  DM+T   EKVD++IM  P S G W    +E+T+++GRV + I +S+R+  GV       +++S +     A   +N+  V   +       V +               R WQD GYL++Y++ RP+MQ++ V  WL+QH FP G++ F DG+  +PL+ K   L  L+ E  +K+  AYGS+KD+S+Y SLGL   QI+ +GR  +  ++    + DGYASHL+ L  + N  S+P++  S  + LR+  F +
Sbjct:  841 NVTANHRVNDAVFTEDGNQVVTGRFMYGPLDMVTLTGEKVDVHIMTQPPS-GEWVYFSTELTNSSGRVFYEIPDSKRLSIGV-------QSESRIS----ADYQINLCCVFVCVCVCVCVCVCVC-----------VCYRHWQDLGYLIVYVTGRPDMQKQRVVAWLSQHNFPHGIVSFCDGLVHDPLRHKANFLKTLVTEAHMKIFAAYGSTKDISVYTSLGLPPAQIYIVGRPTKKMQHQCQFITDGYASHLSQL--EYNQRSRPAKTGSTRMVLRKGSFGL 1099          

HSP 3 Score: 78.1814 bits (191), Expect = 5.239e-14
Identity = 30/66 (45.45%), Postives = 45/66 (68.18%), Query Frame = 2
Query: 1946 NFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVI 2143
            + RP C+ +YNLFH  DPS+ R+EPL+  RFH +PP  +  + RFP G+  S  L+ET+ +NP ++
Sbjct:  586 HLRPACQQVYNLFHPADPSASRLEPLLEKRFHLMPPFSVPRYQRFPLGDGQSALLVETVQSNPHLL 651          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Zebrafish
Match: pitpnaa (phosphatidylinositol transfer protein, alpha a [Source:ZFIN;Acc:ZDB-GENE-040426-744])

HSP 1 Score: 206.838 bits (525), Expect = 1.517e-59
Identity = 110/251 (43.82%), Postives = 157/251 (62.55%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPII-DKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVN-DPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKE+RI +P++VEEY++ QLY + + SK+E TG G GVE+++NEPYE   G  GQYT KIY + S +P++ R + P SALI+ E+AWNAYPY +T      + D F + IET++  D G+Q+NV NL+ E  KQ  + ++DI +   + + DY+ +EDP  + S KT RGPL   W  E    +      +   MCAYKL  V FK++G+Q K+E FI     ++     HRQ +CW D W  L++ DI
Sbjct:    1 MLIKEFRIVLPVSVEEYQVGQLYSVAEASKNE-TGGGDGVEVLKNEPYEKEDGEKGQYTHKIYRLQSKVPSFVRLLAPSSALIIHEKAWNAYPYCRTVLTNEYMKDNFLIMIETWHKPDLGEQENVHNLDSERWKQVEVIHIDIADRSQVDTKDYKPDEDPATFKSQKTGRGPLGPDWKKELPQKK------DCPHMCAYKLVTVNFKWFGLQKKVEGFIHR-QEKRLFTSFHRQLFCWLDRWIDLTMEDI 243          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Zebrafish
Match: pitpnaa (phosphatidylinositol transfer protein, alpha a [Source:ZFIN;Acc:ZDB-GENE-040426-744])

HSP 1 Score: 206.838 bits (525), Expect = 1.517e-59
Identity = 110/251 (43.82%), Postives = 157/251 (62.55%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPII-DKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVN-DPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKE+RI +P++VEEY++ QLY + + SK+E TG G GVE+++NEPYE   G  GQYT KIY + S +P++ R + P SALI+ E+AWNAYPY +T      + D F + IET++  D G+Q+NV NL+ E  KQ  + ++DI +   + + DY+ +EDP  + S KT RGPL   W  E    +      +   MCAYKL  V FK++G+Q K+E FI     ++     HRQ +CW D W  L++ DI
Sbjct:    1 MLIKEFRIVLPVSVEEYQVGQLYSVAEASKNE-TGGGDGVEVLKNEPYEKEDGEKGQYTHKIYRLQSKVPSFVRLLAPSSALIIHEKAWNAYPYCRTVLTNEYMKDNFLIMIETWHKPDLGEQENVHNLDSERWKQVEVIHIDIADRSQVDTKDYKPDEDPATFKSQKTGRGPLGPDWKKELPQKK------DCPHMCAYKLVTVNFKWFGLQKKVEGFIHR-QEKRLFTSFHRQLFCWLDRWIDLTMEDI 243          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Xenopus
Match: pitpnm2 (phosphatidylinositol transfer protein membrane associated 2 [Source:NCBI gene;Acc:100216221])

HSP 1 Score: 474.552 bits (1220), Expect = 7.025e-147
Identity = 281/767 (36.64%), Postives = 412/767 (53.72%), Query Frame = 2
Query: 1139 TQSIQKSVFILVVHGGSLLDTN-HEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL-------SKFRNDSRPSLTSSSVSQKESVDMKSINFD--SSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
             Q  +  V ILV+HGG++LDT   + ++K GD+  +   FD+V++  YP     IA++LV CP+I ++  ++++ L+P   D+  L +S   Q ++PLAA+PL  T +  Y + +  +    N  Y+EF +S+EG  F GQV ++ D +G I  FD L       S+ +N SR     S    +  +    + F   SS   +DP S +S    S+ L      K DF +  FF+ GSP+GLV   R           T+  L            L     RP C+ +YNLFH  DPS+ R+EPL+  +FH +PP  +  + RFP G+ +S  L E   +                                        WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  +F++RQ+      +++  N +  +V     +   E     +                 V  R N+ ANHR ND +     PQ +  RFMYG  DM+T   EKVDI+IM  P + G W    +E+++++GR+ + I E++R+  GVYP++MV++ D +    +L VLP   E VVFSIDGSFAASVSI G DPKVR G++DV R WQD GYL+IY++ RP+MQ++ V  WLAQH FP G++ F DG+  +PL+ K   L  LI +V +KVH AYGS+KD+++Y SLGL   QI+ +GR  +  ++    + +GYA+HL  L  + N  S+P++  S + LR+  F +P
Sbjct:  399 AQPCKIHVLILVLHGGNILDTGCGDQNSKQGDVNTINSVFDTVMRVHYPAALGHIAVKLVPCPAICAEAFSLVSSLSPYSYDEGCLSNS---QDHIPLAALPLLATSSPQYLEAVATVIHRANQVYAEFTKSQEGMSFTGQVCLVGDCVGGILGFDALCYSNQTVSESQNSSRRGSVVSVAGCRSCIKWLCVFFSLHSSVLRNDPGSRRSSS--STMLDGGSIGKFDFEITDFFLFGSPLGLVLALRK----------TVIPL------------LDVFQLRPGCQQVYNLFHPADPSASRVEPLLEKKFHLLPPFNVPRYQRFPLGDGNSALLGECFLD------------------------------------FAAKWWGTKRIDYALYCPDALTAFPTVALPHLFHASYWESTDVVSFLLRQV------SEKVINLVGKEVSEFSPSKPREKWLRKRTH---------------VKLR-NVAANHRINDAVANEDGPQTMTGRFMYGPLDMVTLTGEKVDIHIMTQPPA-GEWVYFDTEISNSSGRISYVIPENKRLGIGVYPVKMVVRGDHTYADSYLTVLPKGAEFVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHWQDLGYLIIYVTGRPDMQKQRVVAWLAQHNFPHGIVSFCDGLVHDPLRHKANFLKSLIHDVHMKVHAAYGSTKDITVYSSLGLSPMQIYIVGRPTKKLQHQCQFITEGYAAHLAQL--EYNHRSRPAKNTSRMALRKGSFCLP 1077          

HSP 2 Score: 367.081 bits (941), Expect = 1.494e-107
Identity = 161/249 (64.66%), Postives = 202/249 (81.12%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEYRI +P+TVEEYRIAQLYMIQKKS++E+ G+GSGVEI+ N PY +GPGG GQYT K+YHIG H+P+WFR+ILPK+AL VEEE+WNAYPYT+TRY  P ++KF+++IETYY +D GD  NVFNL+  + +Q  +D +DIV DPI   +Y+ EEDPK+Y S KT RGPL+D W  +++     N      IMCAYKLC+VEF+YWGMQ+KIE+FI D+GLRK M+RAHRQAWCWQDEW+GL+I DI
Sbjct:    1 MLIKEYRIPLPMTVEEYRIAQLYMIQKKSREETCGEGSGVEILENRPYTDGPGGTGQYTHKVYHIGMHIPSWFRSILPKAALRVEEESWNAYPYTRTRYTCPFVEKFSIDIETYYKSDYGDLANVFNLSPAEKRQTTLDPIDIVKDPIPPHEYKPEEDPKLYKSIKTKRGPLSDDWIEDHR-----NNIGKYPIMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTIEDI 244          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Xenopus
Match: pitpnm2 (phosphatidylinositol transfer protein membrane associated 2 [Source:NCBI gene;Acc:100216221])

HSP 1 Score: 469.929 bits (1208), Expect = 3.545e-145
Identity = 282/779 (36.20%), Postives = 413/779 (53.02%), Query Frame = 2
Query: 1139 TQSIQKSVFILVVHGGSLLDTN-HEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL-------SKFRNDSR--------------PSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
             Q  +  V ILV+HGG++LDT   + ++K GD+  +   FD+V++  YP     IA++LV CP+I ++  ++++ L+P   D+  L +S   Q ++PLAA+PL  T +  Y + +  +    N  Y+EF +S+EG  F GQV ++ D +G I  FD L       S+ +N SR              PS   S +S  ++      +  SS   +DP S +S    S+ L      K DF +  FF+ GSP+GLV   R           T+  L            L     RP C+ +YNLFH  DPS+ R+EPL+  +FH +PP  +  + RFP G+ +S  L E   +                                        WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  +F++RQ+ +  +  +E +    +      L   +                        V  R N+ ANHR ND +     PQ +  RFMYG  DM+T   EKVDI+IM  P + G W    +E+++++GR+ + I E++R+  GVYP++MV++ D +    +L VLP   E VVFSIDGSFAASVSI G DPKVR G++DV R WQD GYL+IY++ RP+MQ++ V  WLAQH FP G++ F DG+  +PL+ K   L  LI +V +KVH AYGS+KD+++Y SLGL   QI+ +GR  +  ++    + +GYA+HL  L  + N  S+P++  S + LR+  F +P
Sbjct:  399 AQPCKIHVLILVLHGGNILDTGCGDQNSKQGDVNTINSVFDTVMRVHYPAALGHIAVKLVPCPAICAEAFSLVSSLSPYSYDEGCLSNS---QDHIPLAALPLLATSSPQYLEAVATVIHRANQVYAEFTKSQEGMSFTGQVCLVGDCVGGILGFDALCYSNQTVSESQNSSRRGSVVSVQVQIIGRPSPIESILSNNKTWLCVFFSLHSSVLRNDPGSRRSSS--STMLDGGSIGKFDFEITDFFLFGSPLGLVLALRK----------TVIPL------------LDVFQLRPGCQQVYNLFHPADPSASRVEPLLEKKFHLLPPFNVPRYQRFPLGDGNSALLGECFLD------------------------------------FAAKWWGTKRIDYALYCPDALTAFPTVALPHLFHASYWESTDVVSFLLRQVSEKVIIGKEVSEFSPSKPREKWLRKRTH-----------------------VKLR-NVAANHRINDAVANEDGPQTMTGRFMYGPLDMVTLTGEKVDIHIMTQPPA-GEWVYFDTEISNSSGRISYVIPENKRLGIGVYPVKMVVRGDHTYADSYLTVLPKGAEFVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHWQDLGYLIIYVTGRPDMQKQRVVAWLAQHNFPHGIVSFCDGLVHDPLRHKANFLKSLIHDVHMKVHAAYGSTKDITVYSSLGLSPMQIYIVGRPTKKLQHQCQFITEGYAAHLAQL--EYNHRSRPAKNTSRMALRKGSFCLP 1087          

HSP 2 Score: 367.466 bits (942), Expect = 1.329e-107
Identity = 161/249 (64.66%), Postives = 202/249 (81.12%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEYRI +P+TVEEYRIAQLYMIQKKS++E+ G+GSGVEI+ N PY +GPGG GQYT K+YHIG H+P+WFR+ILPK+AL VEEE+WNAYPYT+TRY  P ++KF+++IETYY +D GD  NVFNL+  + +Q  +D +DIV DPI   +Y+ EEDPK+Y S KT RGPL+D W  +++     N      IMCAYKLC+VEF+YWGMQ+KIE+FI D+GLRK M+RAHRQAWCWQDEW+GL+I DI
Sbjct:    1 MLIKEYRIPLPMTVEEYRIAQLYMIQKKSREETCGEGSGVEILENRPYTDGPGGTGQYTHKVYHIGMHIPSWFRSILPKAALRVEEESWNAYPYTRTRYTCPFVEKFSIDIETYYKSDYGDLANVFNLSPAEKRQTTLDPIDIVKDPIPPHEYKPEEDPKLYKSIKTKRGPLSDDWIEDHR-----NNIGKYPIMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTIEDI 244          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Xenopus
Match: pitpnm2 (phosphatidylinositol transfer protein membrane associated 2 [Source:NCBI gene;Acc:100216221])

HSP 1 Score: 457.988 bits (1177), Expect = 4.099e-141
Identity = 266/770 (34.55%), Postives = 402/770 (52.21%), Query Frame = 2
Query: 1103 SNLTLNMDPSTMTQSIQKSVFILVVHGGSLLDTN-HEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
              +T +  P    Q  +  V ILV+HGG++LDT   + ++K GD+  +   FD+V++  YP     IA++LV CP+I ++  ++++ L+P   D+  L +S   Q ++PLAA+PL  T +  Y + +  +    N  Y+EF +S+EG  F GQV ++ D +G I  FD L           ++ +VS+ ++          S R    +S+Q +                       ++G P  +  +  N      A   +L  L    +             RP C+ +YNLFH  DPS+ R+EPL+  +FH +PP  +  + RFP G+ +S  L E   +                                        WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  +F++RQ+      +++  N +  +V     +   E     +                 V  R N+ ANHR ND +     PQ +  RFMYG  DM+T   EKVDI+IM  P + G W    +E+++++GR+ + I E++R+  GVYP++MV++ D +    +L VLP   E VVFSIDGSFAASVSI G DPKVR G++DV R WQD GYL+IY++ RP+MQ++ V  WLAQH FP G++ F DG+  +PL+ K   L  LI +V +KVH AYGS+KD+++Y SLGL   QI+ +GR  +  ++    + +GYA+HL  L  + N  S+P++  S + LR+  F +P
Sbjct:  379 GEITQHSTPDVSAQPCKIHVLILVLHGGNILDTGCGDQNSKQGDVNTINSVFDTVMRVHYPAALGHIAVKLVPCPAICAEAFSLVSSLSPYSYDEGCLSNS---QDHIPLAALPLLATSSPQYLEAVATVIHRANQVYAEFTKSQEGMSFTGQVCLVGDCVGGILGFDALC---------YSNQTVSESQN----------SSRRGSVVSVQVQ-----------------------IIGRPSPIESILSNNKTSPYAMLISLFCLLCVFLV---------FQLRPGCQQVYNLFHPADPSASRVEPLLEKKFHLLPPFNVPRYQRFPLGDGNSALLGECFLD------------------------------------FAAKWWGTKRIDYALYCPDALTAFPTVALPHLFHASYWESTDVVSFLLRQV------SEKVINLVGKEVSEFSPSKPREKWLRKRTH---------------VKLR-NVAANHRINDAVANEDGPQTMTGRFMYGPLDMVTLTGEKVDIHIMTQPPA-GEWVYFDTEISNSSGRISYVIPENKRLGIGVYPVKMVVRGDHTYADSYLTVLPKGAEFVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHWQDLGYLIIYVTGRPDMQKQRVVAWLAQHNFPHGIVSFCDGLVHDPLRHKANFLKSLIHDVHMKVHAAYGSTKDITVYSSLGLSPMQIYIVGRPTKKLQHQCQFITEGYAAHLAQL--EYNHRSRPAKNTSRMALRKGSFCLP 1033          

HSP 2 Score: 367.466 bits (942), Expect = 5.809e-108
Identity = 161/249 (64.66%), Postives = 202/249 (81.12%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEYRI +P+TVEEYRIAQLYMIQKKS++E+ G+GSGVEI+ N PY +GPGG GQYT K+YHIG H+P+WFR+ILPK+AL VEEE+WNAYPYT+TRY  P ++KF+++IETYY +D GD  NVFNL+  + +Q  +D +DIV DPI   +Y+ EEDPK+Y S KT RGPL+D W  +++     N      IMCAYKLC+VEF+YWGMQ+KIE+FI D+GLRK M+RAHRQAWCWQDEW+GL+I DI
Sbjct:    1 MLIKEYRIPLPMTVEEYRIAQLYMIQKKSREETCGEGSGVEILENRPYTDGPGGTGQYTHKVYHIGMHIPSWFRSILPKAALRVEEESWNAYPYTRTRYTCPFVEKFSIDIETYYKSDYGDLANVFNLSPAEKRQTTLDPIDIVKDPIPPHEYKPEEDPKLYKSIKTKRGPLSDDWIEDHR-----NNIGKYPIMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTIEDI 244          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Xenopus
Match: PITPNM3 (PITPNM family member 3 [Source:NCBI gene;Acc:100495900])

HSP 1 Score: 378.637 bits (971), Expect = 8.368e-114
Identity = 221/563 (39.25%), Postives = 314/563 (55.77%), Query Frame = 2
Query: 1796 VHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLF------------NNPGVIENAPGILLNDSSTSEHDSNLSAF-------------LKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIID-ASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI 3406
            V  FF+ GSP+GLV   R                            L   +  P C  +Y+ FH  DPS+ R+EPL+   FH +PP  +  + + P G+  S  L++ +             NN    + +P  L + S+ ++  +  S+              L   ++  +  +WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  AFI+RQ++   S+Q Q+         E +   N S  S  +K ++ ++           V  R N+TANHRANDV+ + G PQ+L+ RFMYG  DM+    EKVD+ IM  P S G W    +E+++++GRV + + + +R+  GVYPI+MV++ D S  Q +L VLP  +E VVFSIDGSFAASVSI G DPKVR G++DV R WQD G+L+IYI+ RP+MQ++ V  WL+QH FP GMI FSDG+  +PL+QK   L  L++E  IK+  AYGS KD+S+Y  LGL   QI+ +GR  +  +N    + DGYA+HL  L    +  S+P +  S + LR+  F +
Sbjct:  324 VSDFFLFGSPLGLVLAMRRTV-------------------------LPGLDAHPACSQVYSFFHSADPSASRLEPLLEKSFHMLPPFNVPRYQKNPLGDGKSYLLVDAIQACSAAFVEQGTPNNTASADTSP--LASLSTPTQRKARRSSLVSMSSEMSGSSESLPSAKIANITANWWGSKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQLMRYESVQIQQ--------KEGIDCMNMSPSSRQEKWLRKRNH----------VKLR-NVTANHRANDVIAVEGGPQVLVGRFMYGPLDMVALTGEKVDVLIMTEP-SSGRWVYFETEISNSSGRVSYSVPKDKRLGVGVYPIKMVVRGDQSSAQSYLTVLPPGMECVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHWQDLGFLIIYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKTIFLRNLMQECHIKISAAYGSMKDISVYSVLGLSPPQIYIVGRPAKKYQNQCQFVSDGYAAHLASLEFSHH--SRPKKNNSRMILRKGSFGL 837          

HSP 2 Score: 101.293 bits (251), Expect = 5.632e-21
Identity = 53/156 (33.97%), Postives = 86/156 (55.13%), Query Frame = 2
Query: 1145 SIQKSVFILVVHGGSLLDTNH-EYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
            S +  V  LV+HGGS+LDT   + ++K  D+      F+ V ++ +P     I +RLV CP+I S+  +++  L P   D+  L  S   + ++PLAA+PL    +  Y+  +  +    N  Y+EF++S +G  F+GQV +I D +G I  FD L
Sbjct:   54 SCKTQVLALVLHGGSILDTGGGDINSKLADVNTFSSVFEKVTRAHFPAALGHILIRLVPCPAICSEAFSLVYNLNPYSYDENCLNIS---EDHIPLAALPLLAISSPQYQDAVAMVINRANQVYNEFLKSPDGASFNGQVCLIGDCVGGILGFDAL 206          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Xenopus
Match: PITPNM3 (PITPNM family member 3 [Source:NCBI gene;Acc:100495900])

HSP 1 Score: 377.867 bits (969), Expect = 7.265e-113
Identity = 221/563 (39.25%), Postives = 314/563 (55.77%), Query Frame = 2
Query: 1796 VHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLF------------NNPGVIENAPGILLNDSSTSEHDSNLSAF-------------LKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIID-ASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI 3406
            V  FF+ GSP+GLV   R                            L   +  P C  +Y+ FH  DPS+ R+EPL+   FH +PP  +  + + P G+  S  L++ +             NN    + +P  L + S+ ++  +  S+              L   ++  +  +WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  AFI+RQ++   S+Q Q+         E +   N S  S  +K ++ ++           V  R N+TANHRANDV+ + G PQ+L+ RFMYG  DM+    EKVD+ IM  P S G W    +E+++++GRV + + + +R+  GVYPI+MV++ D S  Q +L VLP  +E VVFSIDGSFAASVSI G DPKVR G++DV R WQD G+L+IYI+ RP+MQ++ V  WL+QH FP GMI FSDG+  +PL+QK   L  L++E  IK+  AYGS KD+S+Y  LGL   QI+ +GR  +  +N    + DGYA+HL  L    +  S+P +  S + LR+  F +
Sbjct:  391 VSDFFLFGSPLGLVLAMRRTV-------------------------LPGLDAHPACSQVYSFFHSADPSASRLEPLLEKSFHMLPPFNVPRYQKNPLGDGKSYLLVDAIQACSAAFVEQGTPNNTASADTSP--LASLSTPTQRKARRSSLVSMSSEMSGSSESLPSAKIANITANWWGSKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQLMRYESVQIQQ--------KEGIDCMNMSPSSRQEKWLRKRNH----------VKLR-NVTANHRANDVIAVEGGPQVLVGRFMYGPLDMVALTGEKVDVLIMTEP-SSGRWVYFETEISNSSGRVSYSVPKDKRLGVGVYPIKMVVRGDQSSAQSYLTVLPPGMECVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHWQDLGFLIIYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKTIFLRNLMQECHIKISAAYGSMKDISVYSVLGLSPPQIYIVGRPAKKYQNQCQFVSDGYAAHLASLEFSHH--SRPKKNNSRMILRKGSFGL 904          

HSP 2 Score: 101.293 bits (251), Expect = 6.313e-21
Identity = 53/156 (33.97%), Postives = 86/156 (55.13%), Query Frame = 2
Query: 1145 SIQKSVFILVVHGGSLLDTNH-EYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
            S +  V  LV+HGGS+LDT   + ++K  D+      F+ V ++ +P     I +RLV CP+I S+  +++  L P   D+  L  S   + ++PLAA+PL    +  Y+  +  +    N  Y+EF++S +G  F+GQV +I D +G I  FD L
Sbjct:  121 SCKTQVLALVLHGGSILDTGGGDINSKLADVNTFSSVFEKVTRAHFPAALGHILIRLVPCPAICSEAFSLVYNLNPYSYDENCLNIS---EDHIPLAALPLLAISSPQYQDAVAMVINRANQVYNEFLKSPDGASFNGQVCLIGDCVGGILGFDAL 273          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Mouse
Match: Pitpnm3 (PITPNM family member 3 [Source:MGI Symbol;Acc:MGI:2685726])

HSP 1 Score: 388.267 bits (996), Expect = 9.113e-117
Identity = 220/561 (39.22%), Postives = 309/561 (55.08%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNP-----GVIENAPGIL------------------LNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI 3406
            +V  FF+ GSP+GLV   R                    +  I   ++     RP C  +Y+ FH  DPS+ R+EPL+  +FH +PP+ +  + RFP G+  S  L + L  +      G    +P +L                  L+  S+    S  S  L  +   ++   WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  AFI+RQ++    ++         D  +L   N  E     +                 V  R N+TANHRANDV+     PQ+L+ RFMYG  DM+    EKVDI +M  P S G W    +E+T+N+GR+ +++   RR+  GVYP++MV++ D +    +L VLP  +E VVFSIDGSFAASVSI G DPKVRPG++DV R WQD GY+++YI+ RP+MQ++ V  WL+QH FP GMI FSDG+  +PL+QK   L  L++E  IK+  AYGS+KD+S+Y  LGL + QIF +GR  +  +     L +GYA+HL  L  + +  S+P +  S + LR+  F +
Sbjct:  393 DVSDFFLFGSPLGLVLAMRRTV-----------------LPGIDGFQM-----RPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADALHTHSPLFLEGSSRGSPPLLDAPASPPQAPRFQRTERRLSKGSSHSDSSESSDSLAPMGASRITAKWWGTKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQVM--RYESASVKESTGLDPTALSPANPREKWLRKRTQ---------------VKLR-NVTANHRANDVIAAEDGPQVLVGRFMYGPLDMVALTGEKVDILVMTEP-SSGRWVHLDTEITNNSGRITYNVPRPRRLGVGVYPVKMVVRGDQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYMILYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKITAAYGSTKDISVYSVLGLPASQIFIVGRSTKKYQTQCQFLSEGYAAHLAAL--EASHRSRPKKNNSRMILRKGSFGL 910          

HSP 2 Score: 97.0561 bits (240), Expect = 7.862e-20
Identity = 50/157 (31.85%), Postives = 86/157 (54.78%), Query Frame = 2
Query: 1142 QSIQKSVFILVVHGGSLLDTNH-EYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
            +S +  V +LV+HGG++LDT   +   K  DI       + V+++ +P     I ++ V CP+I S+  ++++ L P   D+  L +S   Q +VPLAA+PL    +  Y+  +  +    N  Y EF++S +G  F+GQV +I D +G +  FD +
Sbjct:  123 RSCKTHVLLLVLHGGNVLDTGSGDPSCKAADIHTFSSVLEKVMRAHFPAALGHILIKFVPCPAICSEAFSLVSNLNPYSHDEGCLGTS---QDHVPLAALPLLAISSPQYQDAVATVIERANHIYGEFLKSSDGIGFNGQVCLIGDCVGGLLAFDAI 276          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Mouse
Match: Pitpnm3 (PITPNM family member 3 [Source:MGI Symbol;Acc:MGI:2685726])

HSP 1 Score: 387.882 bits (995), Expect = 9.773e-117
Identity = 218/561 (38.86%), Postives = 307/561 (54.72%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNP-----GVIENAPGIL------------------LNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI 3406
            +V  FF+ GSP+GLV   R                    +  I   ++     RP C  +Y+ FH  DPS+ R+EPL+  +FH +PP+ +  + RFP G+  S  L + L  +      G    +P +L                  L+  S+    S  S  L  +   ++   WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  AFI+RQ++    ++         D  +L   N  E     +                      N+TANHRANDV+     PQ+L+ RFMYG  DM+    EKVDI +M  P S G W    +E+T+N+GR+ +++   RR+  GVYP++MV++ D +    +L VLP  +E VVFSIDGSFAASVSI G DPKVRPG++DV R WQD GY+++YI+ RP+MQ++ V  WL+QH FP GMI FSDG+  +PL+QK   L  L++E  IK+  AYGS+KD+S+Y  LGL + QIF +GR  +  +     L +GYA+HL  L  + +  S+P +  S + LR+  F +
Sbjct:  377 DVSDFFLFGSPLGLVLAMRRTV-----------------LPGIDGFQM-----RPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADALHTHSPLFLEGSSRGSPPLLDAPASPPQAPRFQRTERRLSKGSSHSDSSESSDSLAPMGASRITAKWWGTKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQVM--RYESASVKESTGLDPTALSPANPREKWLRKRTQVKLR----------------NVTANHRANDVIAAEDGPQVLVGRFMYGPLDMVALTGEKVDILVMTEP-SSGRWVHLDTEITNNSGRITYNVPRPRRLGVGVYPVKMVVRGDQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYMILYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKITAAYGSTKDISVYSVLGLPASQIFIVGRSTKKYQTQCQFLSEGYAAHLAAL--EASHRSRPKKNNSRMILRKGSFGL 894          

HSP 2 Score: 97.0561 bits (240), Expect = 8.673e-20
Identity = 50/157 (31.85%), Postives = 86/157 (54.78%), Query Frame = 2
Query: 1142 QSIQKSVFILVVHGGSLLDTNH-EYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
            +S +  V +LV+HGG++LDT   +   K  DI       + V+++ +P     I ++ V CP+I S+  ++++ L P   D+  L +S   Q +VPLAA+PL    +  Y+  +  +    N  Y EF++S +G  F+GQV +I D +G +  FD +
Sbjct:  107 RSCKTHVLLLVLHGGNVLDTGSGDPSCKAADIHTFSSVLEKVMRAHFPAALGHILIKFVPCPAICSEAFSLVSNLNPYSHDEGCLGTS---QDHVPLAALPLLAISSPQYQDAVATVIERANHIYGEFLKSSDGIGFNGQVCLIGDCVGGLLAFDAI 260          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Mouse
Match: Pitpnm1 (phosphatidylinositol transfer protein, membrane-associated 1 [Source:MGI Symbol;Acc:MGI:1197524])

HSP 1 Score: 358.607 bits (919), Expect = 9.287e-115
Identity = 156/249 (62.65%), Postives = 200/249 (80.32%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEY I +P++++EY++AQLYMIQKKS++ES+G+GSGVEI+ N PY +GPGG GQYT K+YH+GSH+P WFR +LPK+AL VEEE+WNAYPYT+TRY  P ++KF++EIETYY  DGG Q NVFNL+  + +QRI+D +DIV D ++  +Y+ EEDP++Y S+KT RGPL D WA   +TA          +MCAYKLC+VEF+YWGMQ KIE+FI D+GLR+ MLRAHRQAWCWQDEW  LS+ DI
Sbjct:    1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGNGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSAKTGRGPLADDWA---RTAAQTGP-----LMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWIELSMADI 241          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Mouse
Match: Pitpnm1 (phosphatidylinositol transfer protein, membrane-associated 1 [Source:MGI Symbol;Acc:MGI:1197524])

HSP 1 Score: 358.607 bits (919), Expect = 9.287e-115
Identity = 156/249 (62.65%), Postives = 200/249 (80.32%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEY I +P++++EY++AQLYMIQKKS++ES+G+GSGVEI+ N PY +GPGG GQYT K+YH+GSH+P WFR +LPK+AL VEEE+WNAYPYT+TRY  P ++KF++EIETYY  DGG Q NVFNL+  + +QRI+D +DIV D ++  +Y+ EEDP++Y S+KT RGPL D WA   +TA          +MCAYKLC+VEF+YWGMQ KIE+FI D+GLR+ MLRAHRQAWCWQDEW  LS+ DI
Sbjct:    1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGNGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSAKTGRGPLADDWA---RTAAQTGP-----LMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWIELSMADI 241          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Mouse
Match: Pitpnm1 (phosphatidylinositol transfer protein, membrane-associated 1 [Source:MGI Symbol;Acc:MGI:1197524])

HSP 1 Score: 383.259 bits (983), Expect = 7.638e-113
Identity = 214/566 (37.81%), Postives = 303/566 (53.53%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNN------------PGVIENAPGILLNDSSTS-EHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNT--LSKPSRCISNVTLRRSCFDI--PVKYISNSKNL 3439
             V  FF+ GSP+GLV   R     +                      L  +  RP C  +YNLFH  DP + R+EPL+  +F AI P+ +  + +FP G+  S  L +TL  +            P    +A G     S    E  S  +A     +V ++++ WWG KRIDY L+CP+ + AFP   LPHL HASYWES D  AFI+RQ+I+                E   L    EPS        +  Q       +      N+T+NHRA+D +V  G+PQ+L  RFMYG  D++T   EKVD+Y+M  P+S G W   G+EVT+++GR+ F +   R +  GVYP+RMV++ D +  +  L V+    EAVVFSIDGSF ASVSI G DPKVR G++DV R WQD GYL++Y++ RP+MQ+  V  WL+QH FP G++ F DG++ +PL+QK   L  L++EV++ +   YGS KDV++Y +LGL   Q + +GR  R  +     L DGY +HL  L    ++   S P R      L +S + +  PV ++     L
Sbjct:  688 KVSGFFLFGSPLGLVLALRKTVMPA----------------------LEVAQLRPACEQIYNLFHAADPCASRLEPLLAPKFQAIAPLAVPRYQKFPLGDGSSLLLADTLQTHSSLFLEELEMMVPSTPTSASGAFWKGSELGNEPASQTAAPSTTSEVVKILDRWWGNKRIDYSLYCPEALTAFPTVTLPHLFHASYWESADVVAFILRQVIEK---------------ERPQLTECEEPSIYSPAFPREKWQRKRTQVKI-----RNVTSNHRASDTVVCEGRPQVLNGRFMYGPLDVVTLTGEKVDVYVMTQPLS-GKWIHFGTEVTNSSGRLTFPVPSERALGIGVYPVRMVVRGDHTYAECCLTVVSRGTEAVVFSIDGSFTASVSIMGSDPKVRAGAVDVVRHWQDSGYLIVYVTGRPDMQKHRVVAWLSQHNFPHGVVSFCDGLTHDPLRQKAMFLQSLVQEVELNIVAGYGSPKDVAVYAALGLSPSQTYIVGRAVRKLQAQCQFLSDGYVAHLGQLEAGSHSHAPSGPPR----AALAKSSYAVAAPVDFLRKQSQL 1206          

HSP 2 Score: 366.311 bits (939), Expect = 7.838e-107
Identity = 156/249 (62.65%), Postives = 200/249 (80.32%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEY I +P++++EY++AQLYMIQKKS++ES+G+GSGVEI+ N PY +GPGG GQYT K+YH+GSH+P WFR +LPK+AL VEEE+WNAYPYT+TRY  P ++KF++EIETYY  DGG Q NVFNL+  + +QRI+D +DIV D ++  +Y+ EEDP++Y S+KT RGPL D WA   +TA          +MCAYKLC+VEF+YWGMQ KIE+FI D+GLR+ MLRAHRQAWCWQDEW  LS+ DI
Sbjct:    1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGNGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSAKTGRGPLADDWA---RTAAQTG-----PLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWIELSMADI 241          

HSP 3 Score: 105.145 bits (261), Expect = 3.366e-22
Identity = 52/151 (34.44%), Postives = 83/151 (54.97%), Query Frame = 2
Query: 1160 VFILVVHGGSLLDTN-HEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
               L++H GS+LD+   + ++K  D+  L   F++V +  +P     +A+RLV CP I +    +++ L+P   D   L  S   Q ++PLAA+PL  T +S Y+  +  +    N  Y+ F+RS EG  F GQV++I D +G I  FD L
Sbjct:  428 ALFLILHSGSILDSGPGDTNSKQADVQTLSTAFEAVTRVHFPEALGHVALRLVPCPPICAAAYALVSNLSPYSHDGDSLSRS---QDHIPLAALPLLATSSSRYQGAVATVIARTNQAYAAFLRSSEGTGFCGQVVLIGDGVGGILGFDAL 575          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. UniProt/SwissProt
Match: sp|P43125|RDGB_DROME (Protein retinal degeneration B OS=Drosophila melanogaster OX=7227 GN=rdgB PE=1 SV=2)

HSP 1 Score: 478.404 bits (1230), Expect = 1.173e-146
Identity = 290/778 (37.28%), Postives = 430/778 (55.27%), Query Frame = 2
Query: 1157 SVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYY--VPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSIN-----------FDSSHR--ESDP------ISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGIL----LNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEF--ANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
            ++ ILVVH GS+LD   E   K  D+   R +F++V++  YP L   + +++V CPSI +D L IL+ L+P   D    PS+  +     VP+ AIPL    +  + + ++    + N  Y EF++SEEG  F GQ++++ D++GS+  ++ L +  N S+P  T+S  S        +IN            D   R  E+D       ++    +  SS    S   KLDF V  FFM GSP+ +V   R       A                          RPNC  +YNLFH  DP + R+EPL++ RF  + P+ +  + ++P GN    +L+E + ++P    +   +L    L+D+S     S L   +    +  + N WWG KR+DY L+CP+G+  FP  ALPHL HASYWES D  AFI+RQI     +   F  +ND   D  S H     E  +I K   +K K               N+ ANHRANDV+V  G+ Q L ARFMYG  DM+T   EKVD++IM  P + G W    +EVTD NGR+ + I +   +  G+YP++MV++ D + V  ++AV+P   E VVFSIDGSF AS+S++G+DPKVR G++DV R WQ+ GYLLIYI+ RP+MQQ+ V  WL+QH FP G+I F+DG+S +PL  K   L+ L++   I +  AYGSSKD+S+Y ++G+ + QIF +G++ +  ++N+  L DGYA+HL  L       S+P++  + + + R CF++P
Sbjct:  504 TILILVVHAGSVLDAASELTAKKSDVTTFRGSFEAVMRQHYPSLLTHVTIKMVPCPSICTDALGILSSLSPYSFDAS--PSAADIPNIADVPIGAIPLLSVASPEFHETVNKTVAAANIVYHEFLKSEEGHGFSGQIVMLGDSMGSLLAYEALCR-SNGSQPG-TASGASNSGGDAATNINTHNPLSPRNSRLDDDERFIEADLDAKRLLVAPSPRRRRSSSSSDSRATKLDFEVCDFFMFGSPLSVVLAARKLHDAKAALP------------------------RPNCHQVYNLFHPTDPIASRLEPLLSARFSILAPVNVPRYAKYPLGNGQPLHLLEVIQSHPQHFNDGNNLLAGRRLSDASMQSTISGLIENVSLSTIHALQNKWWGTKRLDYALYCPEGLSNFPAHALPHLFHASYWESPDVIAFILRQI--GKFEGIPFVGSND-DKDNASFHPGQPRE-KWIKKRTSVKLK---------------NVAANHRANDVIVQEGREQRLNARFMYGPLDMITLHGEKVDVHIMKDPPA-GEWTFLSTEVTDKNGRISYSIPDQVSLGYGIYPVKMVVRGDHTSVDCYMAVVPPLTECVVFSIDGSFTASMSVTGRDPKVRAGAVDVCRHWQELGYLLIYITGRPDMQQQRVVSWLSQHNFPHGLISFADGLSTDPLGHKTAYLNNLVQNHGISITAAYGSSKDISVYTNVGMRTDQIFIVGKVGKKLQSNATVLSDGYAAHLAGLQAVGG--SRPAKGNARMVIPRGCFNLP 1231          

HSP 2 Score: 371.703 bits (953), Expect = 9.020e-108
Identity = 175/271 (64.58%), Postives = 210/271 (77.49%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEY---KTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQE 847
            MLIKEYRI +PLTVEEYRIAQLYMI KKS++ES G+GSGVEII NEPY++GPGG GQYT KIYH+G+HLP W +++LPKSAL VEEEAWNAYPYT+TRY  P ++KF+L+IETYY+ D G QDNVF L+  D++ RI+D +DIV D +   DY KEEDPK +VS KT RGPL + W  EY      + +    NM +M AYK+CRVEF+YWGMQTK+EKFI D+ LRK MLRAHRQAW WQDEW GL+I DIR LE +    LA+KM   E
Sbjct:    1 MLIKEYRIPLPLTVEEYRIAQLYMIAKKSREESHGEGSGVEIIINEPYKDGPGGNGQYTKKIYHVGNHLPGWIKSLLPKSALTVEEEAWNAYPYTRTRYTCPFVEKFSLDIETYYYPDNGYQDNVFQLSGSDLRNRIVDVIDIVKDQLWGGDYVKEEDPKHFVSDKTGRGPLAEDWLEEYWREVKGKKQPTPRNMSLMTAYKICRVEFRYWGMQTKLEKFIHDVALRKMMLRAHRQAWAWQDEWFGLTIEDIRELERQTQLALAKKMGGGE 271          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. UniProt/SwissProt
Match: sp|Q5U2N3|PITM1_RAT (Membrane-associated phosphatidylinositol transfer protein 1 OS=Rattus norvegicus OX=10116 GN=Pitpnm1 PE=1 SV=1)

HSP 1 Score: 456.447 bits (1173), Expect = 1.279e-138
Identity = 275/828 (33.21%), Postives = 411/828 (49.64%), Query Frame = 2
Query: 1160 VFILVVHGGSLLDTN-HEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL----------------SKFRND--------------------SRPSLTSSSV-SQKESVDMKSINFDSSHRE---------SDPISLQSEQCXXXXXXXXXXXXXXX----NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTS-------------EHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNT--LSKPSRCISNVTLRRSCFDI--PVKYISNSKNL 3439
               L++H GS+LD+   + ++K  D+  L   F++V +  +P     +A+RLV CP I +    +++ L+P   D   L  S   Q ++PLAA+PL  T +S Y+  +  +    N  Y+ F+RS EG  F GQV++I D +G I  FD L                    N+                     R S   S++ +Q+ S DM + + D S             +P    +  C  +   +             V  FF+ GSP+GLV   R     +                      L  +  RP C  +YNLFH  DP + R+EPL+  +F AI P+ +  + +FP G+  S  L +TL  +  +      +++  + TS             E  +  +A     +V ++++ WWG KRIDY L+CP+ + AFP   LPHL HASYWES D  AFI+RQ+I+                E   L    EPS        +  Q       +      N+T+NHRA+D +V  G+PQ+L  RFMYG  D++T   EKVD+Y+M  P+S G W   G+EVT+++GR+ F +   R +  GVYP+RMV++ D +  +  L V+    EAVVFSIDGSF ASVSI G DPKVR G++DV R WQD GYL++Y++ RP+MQ+  V  WL+QH FP G++ F DG++ +PL+QK   L  L++EV++ +   YGS KDV++Y +LGL   Q + +GR  R  +     L DGY +HL  L    ++   S P R      L +S + +  PV ++     L
Sbjct:  428 ALFLILHSGSILDSGPGDTNSKQADVQTLSTAFEAVTRVHFPEALGHVALRLVPCPPICAAAYALVSNLSPYSHDGDSLSRS---QDHIPLAALPLLATSSSRYQGAVATVIARTNQAYAAFLRSSEGTGFCGQVVLIGDGVGGILGFDALCHSASAGTGSRGSSRRGSMNNEMLSPEVGPVRDPLADGVEVLGRASPEPSALPAQRTSSDMANPDPDGSQNSLQVAPTVTSGEPRRASTASCPPASSEAPDGPTNAARLDFKVSGFFLFGSPLGLVLALRKTVMPA----------------------LEVAQMRPACEQIYNLFHAADPCASRLEPLLAPKFQAIAPLAVPRYQKFPLGDGSSLLLADTLQTHSSLFLEELEMMVPSTPTSASGAFWKGNELGNEPAAQPAAPSTTSEVVKILDRWWGNKRIDYSLYCPEALTAFPTVTLPHLFHASYWESADVVAFILRQVIEK---------------ERPQLTECEEPSIYSPAFPREKWQRKRTQVKI-----RNVTSNHRASDTVVCEGRPQVLNGRFMYGPLDVVTLTGEKVDVYVMTQPLS-GKWIHFGTEVTNSSGRLTFPVPSERALGIGVYPVRMVVRGDHTYAECCLTVVSRGTEAVVFSIDGSFTASVSIMGSDPKVRAGAVDVVRHWQDSGYLIVYVTGRPDMQKHRVVAWLSQHNFPHGVVSFCDGLTHDPLRQKAMFLQSLVQEVELNIVAGYGSPKDVAVYAALGLSPSQTYIVGRAVRKLQAQCQFLSDGYVAHLGQLEAGSHSHAPSGPPR----AALAKSSYAVAAPVDFLRKQSQL 1205          

HSP 2 Score: 364.385 bits (934), Expect = 2.607e-105
Identity = 156/249 (62.65%), Postives = 199/249 (79.92%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEY I +P++++EY++AQLYMIQKKS++ES+G+GSGVEI+ N PY +GPGG GQYT K+YH+GSH+P WFR +LPK+AL VEEE+WNAYPYT+TRY  P ++KF++EIETYY  DGG Q NVFNL+  + +QRI+D +DIV D ++  +Y+ EEDP++Y S KT RGPL D WA   +TA          +MCAYKLC+VEF+YWGMQ KIE+FI D+GLR+ MLRAHRQAWCWQDEW  LS+ DI
Sbjct:    1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGNGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRILDTIDIVRDAVAPGEYKAEEDPRLYRSVKTGRGPLADDWA---RTAAQTG-----PLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWIELSMADI 241          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. UniProt/SwissProt
Match: sp|Q3UHE1|PITM3_MOUSE (Membrane-associated phosphatidylinositol transfer protein 3 OS=Mus musculus OX=10090 GN=Pitpnm3 PE=1 SV=2)

HSP 1 Score: 388.267 bits (996), Expect = 6.375e-116
Identity = 220/561 (39.22%), Postives = 309/561 (55.08%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNP-----GVIENAPGIL------------------LNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI 3406
            +V  FF+ GSP+GLV   R                    +  I   ++     RP C  +Y+ FH  DPS+ R+EPL+  +FH +PP+ +  + RFP G+  S  L + L  +      G    +P +L                  L+  S+    S  S  L  +   ++   WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  AFI+RQ++    ++         D  +L   N  E     +                 V  R N+TANHRANDV+     PQ+L+ RFMYG  DM+    EKVDI +M  P S G W    +E+T+N+GR+ +++   RR+  GVYP++MV++ D +    +L VLP  +E VVFSIDGSFAASVSI G DPKVRPG++DV R WQD GY+++YI+ RP+MQ++ V  WL+QH FP GMI FSDG+  +PL+QK   L  L++E  IK+  AYGS+KD+S+Y  LGL + QIF +GR  +  +     L +GYA+HL  L  + +  S+P +  S + LR+  F +
Sbjct:  393 DVSDFFLFGSPLGLVLAMRRTV-----------------LPGIDGFQM-----RPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADALHTHSPLFLEGSSRGSPPLLDAPASPPQAPRFQRTERRLSKGSSHSDSSESSDSLAPMGASRITAKWWGTKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQVM--RYESASVKESTGLDPTALSPANPREKWLRKRTQ---------------VKLR-NVTANHRANDVIAAEDGPQVLVGRFMYGPLDMVALTGEKVDILVMTEP-SSGRWVHLDTEITNNSGRITYNVPRPRRLGVGVYPVKMVVRGDQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYMILYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKITAAYGSTKDISVYSVLGLPASQIFIVGRSTKKYQTQCQFLSEGYAAHLAAL--EASHRSRPKKNNSRMILRKGSFGL 910          

HSP 2 Score: 97.0561 bits (240), Expect = 5.500e-19
Identity = 50/157 (31.85%), Postives = 86/157 (54.78%), Query Frame = 2
Query: 1142 QSIQKSVFILVVHGGSLLDTNH-EYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
            +S +  V +LV+HGG++LDT   +   K  DI       + V+++ +P     I ++ V CP+I S+  ++++ L P   D+  L +S   Q +VPLAA+PL    +  Y+  +  +    N  Y EF++S +G  F+GQV +I D +G +  FD +
Sbjct:  123 RSCKTHVLLLVLHGGNVLDTGSGDPSCKAADIHTFSSVLEKVMRAHFPAALGHILIKFVPCPAICSEAFSLVSNLNPYSHDEGCLGTS---QDHVPLAALPLLAISSPQYQDAVATVIERANHIYGEFLKSSDGIGFNGQVCLIGDCVGGLLAFDAI 276          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. UniProt/SwissProt
Match: sp|Q9BZ71|PITM3_HUMAN (Membrane-associated phosphatidylinositol transfer protein 3 OS=Homo sapiens OX=9606 GN=PITPNM3 PE=1 SV=2)

HSP 1 Score: 387.111 bits (993), Expect = 1.366e-115
Identity = 218/561 (38.86%), Postives = 309/561 (55.08%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLF-NNPGVIENA----------------------PGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDI 3406
            +V  FF+ GSP+GLV   R                            L     RP C  +Y+ FH  DPS+ R+EPL+  +FH +PP+ +  + RFP G+  S  L + L  ++P  +E +                      PG  +++ S+    S  S  +  V   ++   WWG KRIDY L+CPD + AFP  ALPHL HASYWES D  AFI+RQ++                 ES+   N  E + +D      +       +        N+TANHRANDV+     PQ+L+ RFMYG  DM+    EKVDI +M  P S G W    +E+T+++GR+ +++   RR+  GVYP++MV++ D +    +L VLP  +E VVFSIDGSFAASVSI G DPKVRPG++DV R WQD GY+++YI+ RP+MQ++ V  WL+QH FP GMI FSDG+  +PL+QK   L  L++E  IK+  AYGS+KD+S+Y  LGL + QIF +GR  +  +     L +GYA+HL  L  + +  S+P +  S + LR+  F +
Sbjct:  393 DVSDFFLFGSPLGLVLAMRRTVLPG----------------------LDGFQVRPACSQVYSFFHCADPSASRLEPLLEPKFHLVPPVSVPRYQRFPLGDGQSLLLADALHTHSPLFLEGSSRDSPPLLDAPASPPQASRFQRPGRRMSEGSSHSESSESSDSMAPVGASRITAKWWGSKRIDYALYCPDVLTAFPTVALPHLFHASYWESTDVVAFILRQVMR---------------YESV---NIKESARLDPAALSPANPREKWLRKRTQVKLRNVTANHRANDVIAAEDGPQVLVGRFMYGPLDMVALTGEKVDILVMAEP-SSGRWVHLDTEITNSSGRITYNVPRPRRLGVGVYPVKMVVRGDQTCAMSYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYMILYITGRPDMQKQRVVSWLSQHNFPQGMIFFSDGLVHDPLRQKAIFLRNLMQECFIKISAAYGSTKDISVYSVLGLPASQIFIVGRPTKKYQTQCQFLSEGYAAHLAAL--EASHRSRPKKNNSRMILRKGSFGL 910          

HSP 2 Score: 97.4413 bits (241), Expect = 5.094e-19
Identity = 51/157 (32.48%), Postives = 84/157 (53.50%), Query Frame = 2
Query: 1142 QSIQKSVFILVVHGGSLLDTNH-EYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
            +S +  V +LV+HGG++LDT   +   K  DI       + V ++ +P     I ++ V CP+I S+  ++++ L P   D+  L SS   Q +VPLAA+PL    +  Y+  +  +    N  Y EF++S +G  F GQV +I D +G +  FD +
Sbjct:  123 RSCKTHVLLLVLHGGNILDTGAGDPSCKAADIHTFSSVLEKVTRAHFPAALGHILIKFVPCPAICSEAFSLVSHLNPYSHDEGCLSSS---QDHVPLAALPLLAISSPQYQDAVATVIERANQVYREFLKSSDGIGFSGQVCLIGDCVGGLLAFDAI 276          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. UniProt/SwissProt
Match: sp|O35954|PITM1_MOUSE (Membrane-associated phosphatidylinositol transfer protein 1 OS=Mus musculus OX=10090 GN=Pitpnm1 PE=1 SV=1)

HSP 1 Score: 383.259 bits (983), Expect = 5.342e-112
Identity = 214/566 (37.81%), Postives = 303/566 (53.53%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNN------------PGVIENAPGILLNDSSTS-EHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNT--LSKPSRCISNVTLRRSCFDI--PVKYISNSKNL 3439
             V  FF+ GSP+GLV   R     +                      L  +  RP C  +YNLFH  DP + R+EPL+  +F AI P+ +  + +FP G+  S  L +TL  +            P    +A G     S    E  S  +A     +V ++++ WWG KRIDY L+CP+ + AFP   LPHL HASYWES D  AFI+RQ+I+                E   L    EPS        +  Q       +      N+T+NHRA+D +V  G+PQ+L  RFMYG  D++T   EKVD+Y+M  P+S G W   G+EVT+++GR+ F +   R +  GVYP+RMV++ D +  +  L V+    EAVVFSIDGSF ASVSI G DPKVR G++DV R WQD GYL++Y++ RP+MQ+  V  WL+QH FP G++ F DG++ +PL+QK   L  L++EV++ +   YGS KDV++Y +LGL   Q + +GR  R  +     L DGY +HL  L    ++   S P R      L +S + +  PV ++     L
Sbjct:  688 KVSGFFLFGSPLGLVLALRKTVMPA----------------------LEVAQLRPACEQIYNLFHAADPCASRLEPLLAPKFQAIAPLAVPRYQKFPLGDGSSLLLADTLQTHSSLFLEELEMMVPSTPTSASGAFWKGSELGNEPASQTAAPSTTSEVVKILDRWWGNKRIDYSLYCPEALTAFPTVTLPHLFHASYWESADVVAFILRQVIEK---------------ERPQLTECEEPSIYSPAFPREKWQRKRTQVKI-----RNVTSNHRASDTVVCEGRPQVLNGRFMYGPLDVVTLTGEKVDVYVMTQPLS-GKWIHFGTEVTNSSGRLTFPVPSERALGIGVYPVRMVVRGDHTYAECCLTVVSRGTEAVVFSIDGSFTASVSIMGSDPKVRAGAVDVVRHWQDSGYLIVYVTGRPDMQKHRVVAWLSQHNFPHGVVSFCDGLTHDPLRQKAMFLQSLVQEVELNIVAGYGSPKDVAVYAALGLSPSQTYIVGRAVRKLQAQCQFLSDGYVAHLGQLEAGSHSHAPSGPPR----AALAKSSYAVAAPVDFLRKQSQL 1206          

HSP 2 Score: 366.311 bits (939), Expect = 5.483e-106
Identity = 156/249 (62.65%), Postives = 200/249 (80.32%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEY I +P++++EY++AQLYMIQKKS++ES+G+GSGVEI+ N PY +GPGG GQYT K+YH+GSH+P WFR +LPK+AL VEEE+WNAYPYT+TRY  P ++KF++EIETYY  DGG Q NVFNL+  + +QRI+D +DIV D ++  +Y+ EEDP++Y S+KT RGPL D WA   +TA          +MCAYKLC+VEF+YWGMQ KIE+FI D+GLR+ MLRAHRQAWCWQDEW  LS+ DI
Sbjct:    1 MLIKEYHILLPMSLDEYQVAQLYMIQKKSREESSGEGSGVEILANRPYTDGPGGNGQYTHKVYHVGSHIPGWFRALLPKAALQVEEESWNAYPYTRTRYTCPFVEKFSIEIETYYLPDGGQQPNVFNLSGAERRQRIVDTIDIVRDAVAPGEYKAEEDPRLYRSAKTGRGPLADDWA---RTAAQTG-----PLMCAYKLCKVEFRYWGMQAKIEQFIHDVGLRRVMLRAHRQAWCWQDEWIELSMADI 241          

HSP 3 Score: 105.145 bits (261), Expect = 2.354e-21
Identity = 52/151 (34.44%), Postives = 83/151 (54.97%), Query Frame = 2
Query: 1160 VFILVVHGGSLLDTN-HEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
               L++H GS+LD+   + ++K  D+  L   F++V +  +P     +A+RLV CP I +    +++ L+P   D   L  S   Q ++PLAA+PL  T +S Y+  +  +    N  Y+ F+RS EG  F GQV++I D +G I  FD L
Sbjct:  428 ALFLILHSGSILDSGPGDTNSKQADVQTLSTAFEAVTRVHFPEALGHVALRLVPCPPICAAAYALVSNLSPYSHDGDSLSRS---QDHIPLAALPLLATSSSRYQGAVATVIARTNQAYAAFLRSSEGTGFCGQVVLIGDGVGGILGFDAL 575          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. TrEMBL
Match: A0A5K4FA65 (Uncharacterized protein OS=Schistosoma mansoni OX=6183 PE=4 SV=1)

HSP 1 Score: 866.685 bits (2238), Expect = 0.000e+0
Identity = 517/1291 (40.05%), Postives = 745/1291 (57.71%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDS----------------------NMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQESSELPIYLNQ------PTVSSFDVSINEAPFVMETTNDPLEQSNANNSVHK-----------------NMKYIQNHXXXXXXXXXXYDAKSDFPSETDSFMTCRNNFSSNL--------------------TLNMDP-STMTQSIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSK-------FRNDSRPSLTSSSVSQKESVDMKS-INFDSSHRESDPISLQSE-------------------QCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLK------CVQVK----------------------QVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDA---SMQNQEFANDIAADVE-------SLHLNNFSEPSF--IDXXXXXX-----------------------------XXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSS-VVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISN 3427
            ML+KEYRICMPLTV EYRIAQLYMIQKKS++ESTG+GSGVEI++NEPYENGPGG GQYTFKIYH+GSHLPTW RNILP SAL VEEEAWNAYPYT+T YKVP ++K  L++ETY+F+D G+QD+VFNL+ ++ K RIID++DIV D I+ SDY+ EEDP IYVS  T RGPL+ +W  E+  AQ    ++                      + RIMCAYKLCRVEF+YWG QT++E+FI D  LRKTMLRAHRQ W WQDEW+GL+I +IRRLEEE A+ LA KM   +S++LP   ++       T  S + ++N      + + +  E  ++  +  K                 + K ++ ++F  +D E F    ++   +T SF+TC ++ + N                       N  P S + Q+  K V ILV+HGG +LD+ ++   K  DI   R+T ++V  + YP L+N+IA++LV CP+ + D+  + +KL     D      +  L+ ++PL +IPLF+  +  Y ++L+ +  +LN  Y+EF+RS EG HF G+V ++AD++GSI   D+L+K         N++  S+T   + +++   + + I  D   + S  I+  SE                     +      S    +DF V  FFMLGSP+GL+  +R Q  +  +   T   +TN +  N++ +   E   + +    YNLFHL DP  +RIEPL+++RF  I P+ I  + R+P G+  ST LIETL      I+ A     N S  S + SN   F        CV VK                      +V  SWWG KR+DY +HCP+ +Q     A P +LHASYWESKD A+FIIRQI+D    S+    ++ D++ ++        SL+ N     ++  +D +                                  + SS + K+ C+PY +N  ANHRANDV+  +G   ++  RF +G  D+++  +EK+ + I ++    G W    +EVTD++GR+ F + E   +P+G+YPI+M  ++D    V   LA++P   E VVFS+DGSFAAS+S+ GKDPKV PG++DVAR WQ  GYLLIY+SARP+MQ+R V  W+A H FPFGM  F +G+ ++PLKQK Q+L  +++   ++VHC YGS KD+++YRSLGL +  IF +G++ R +  N  PL  GY+SHL+ L+   +TLS+P+    +V +R   FD+P  Y S+
Sbjct:    1 MLLKEYRICMPLTVAEYRIAQLYMIQKKSREESTGRGSGVEILKNEPYENGPGGKGQYTFKIYHVGSHLPTWLRNILPSSALRVEEEAWNAYPYTRTIYKVPFVEKLVLDVETYFFDDAGEQDDVFNLSPDERKARIIDFIDIVKDSITGSDYKPEEDPSIYVSEATGRGPLSPNWREEFIDAQQVTHETYEKPPTRTYDNSPATVECLKPLHKRIMCAYKLCRVEFRYWGTQTRVEQFIHDTALRKTMLRAHRQVWAWQDEWYGLTIEEIRRLEEETAQALASKM--ADSNQLPNNGDELSKEVRSTTPSGNATMNAIEVKCDQSGEKCESDSSTATSEKFHLPVNSTDITEQNLWADFKKLEANNFELDDFEPFTAPCAESDDDTRSFITCCSDLTGNTDYASPLASNFQSFDNPGIKSCFNQKPVSGIQQNCGKLVLILVIHGGCILDSTYDLTTKRSDILTFRKTIETVTANHYPTLHNRIAVKLVPCPTEIGDIFRLFSKLKASP-DPTRPIETQLLRDFMPLGSIPLFLINSPGYSRMLEQLAFNLNTHYAEFLRSPEGIHFSGKVCLVADSVGSILAHDLLTKSSISHESISNNNDTSITDIGLMRRKQFGIHNLIQSDKEIKTSTLINSPSEVTLCPPESNTSLGNVESSSPENEESKSCSRMSSIDFQVQNFFMLGSPIGLILAYRYQKHQLASSTKTTNLITNSSY-NMTYHLSKE--IKLSVDQAYNLFHLTDPCGFRIEPLLDNRFSCISPILIPQYVRYPLGDGQSTNLIETL------IQQAELFSANVSEKSYNLSNSDNFTTNENNDGCVNVKRQLTNQQLNWEKKSIVALEALKKVQQSWWGPKRVDYNVHCPEAMQNILARARPSILHASYWESKDVASFIIRQILDTLGLSVLETSYSADLSDEIAVTELAKLSLNPNQIKSQTYEVMDDSSTQISQQSEKSSSSQSRFSNFSHTLSFGPRNFLKRTSSERLKSACIPYHVNFKANHRANDVITTTGSTPLITGRFAFGGLDLMSFSSEKIRVEIQSI---SGSWAYVCTEVTDSSGRIRFSLPEQIHLPDGLYPIKMTAESDPDHPVIITLAIVPPQTEVVVFSVDGSFAASLSLMGKDPKVHPGAVDVARHWQGLGYLLIYLSARPDMQRRRVTNWMANHNFPFGMTFFLNGLYSDPLKQKAQMLKTVVENANLRVHCGYGSGKDINLYRSLGLSTQNIFLVGKISRSQATNGTPLSQGYSSHLSSLI-NGHTLSRPAIGSMSVAVRCCPFDLPSVYPSS 1275          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. TrEMBL
Match: A0A4E0RI28 (Membrane-associated phosphatidylinositol transfer protein 1 OS=Fasciola hepatica OX=6192 GN=D915_001984 PE=4 SV=1)

HSP 1 Score: 854.358 bits (2206), Expect = 0.000e+0
Identity = 505/1268 (39.83%), Postives = 718/1268 (56.62%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQS----------------ENMDSNM-----RIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQESSELP-----------------------------IYLNQPTVSSFD-----VSINEAPFVMETTNDPLEQSNANNSVHKNMKYIQNHXXXXXXXXXXYDAKSDFPSETDSFMTCRNNFSSNLTLNMDPSTMTQSI----------------------------QKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQY-YVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSINFD-----SSHRESDPISLQSEQCXXXXXXXXXXXXXXXN-------------------VHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLF--------------NNP-GVIENAPGILLND--SSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDA---SMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXX-------XXXXAMCVPYRI---------NMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSS-VVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPV 3412
            MLIKEYRIC+PLTVEEY+IAQL+MIQKKS++ESTG+ SGVEII+NEPYE GPGG GQYT+KIYH+GSHLP W RNILP SAL VEEEAWNAYPYT+T Y+VP +DK TL+IET+YF+DGG QD+VF LN E+   RI+D++DIVNDP++  +Y+ EED  +Y+S  T RGPLT +W  E+  AQ+                +  D  +     RIMCAYKLCRVEF+YWGMQ ++E+FI D  LRKTM+RAHRQ W WQDEW+GL+I +IR+LEEE AR LA KM   E+   P                             +    P+  + D       I  A   +    DP+E  +   +  K       H+ ++  D   Y   SD   +T SF++CR+NF+         +++T+ +                            +K V I+VVHGG LLD  ++   K  D+   R+T D+VI + YP L  ++A+ LV CPS + D   +L +L    ID + LP+   +    +PL +IP F+T +  Y ++LD++ + LN RY+EF+RS EGQ+F G V ++AD++G+I   D+L+     +  +L+ S+      +D  +  +       + RE D  S ++   +              +                   V  F MLGSPVGL+  FRNQ  K       + D  N+  + + N EL  +        + NLFH+NDP S+RIEP+++ RF  I P+ +  +  +P G+   T LIETL               N P G +   PG ++++  +  S   + + AF     +K++ ++WWG+ R+DY +HCP+GVQA   GA   + HASYWES D AAF++RQ+++    S+    +A D+  DV    L + +  S    N  + +  SS           ++   +R+         N+ +NHRANDV+V  G+PQIL ARF++G  D+ +  NEKV I   +L    G W   G+E TD++GR+ + + + RR   G++ I +  ++D    +Q  LAV+P + EAVVFS+DGSFAAS+SI GKDPK+RPG++DVAR W   GYL+IY+SARP+MQQR V  WLA H FP G+ LF +G+S +PL+QK Q+L  + ++VQ+K+HCAYGS KDVS+YRS  +    IF +GR+ R +   S PL  GYA HL+ L    + LS+P     N  + +  FD P 
Sbjct:    1 MLIKEYRICLPLTVEEYKIAQLFMIQKKSREESTGRESGVEIIKNEPYEEGPGGRGQYTYKIYHVGSHLPAWLRNILPPSALRVEEEAWNAYPYTRTIYRVPFVDKLTLDIETHYFDDGGQQDDVFKLNAEEKAARIVDFIDIVNDPVARGEYKTEEDTTLYISEATGRGPLTPTWRDEFIRAQTVTHERWTRAPNRTPGNQQADGPLTPLPKRIMCAYKLCRVEFRYWGMQKRVEQFIHDSALRKTMVRAHRQVWTWQDEWYGLTIEEIRQLEEETARALASKMAEGEAPNEPDAESTNVNDRGKVLTASTLSPASVPQSASLTFPDPSSVALDNQFPGSRIRSASQTLCCDMDPVEAQHLWQTFKK-----LEHNDAELVDYEPYGVLSD-DDDTQSFVSCRSNFTGQTAYASASTSVTEGLHVIAGDEDLNVVNASDEKSTVAHTPDHAEKLVLIMVVHGGCLLDAGNDLITKRNDVNTWRRTLDTVIANHYPVLRRRVAVCLVPCPSGLDDTFRLLAQLKTSPIDPR-LPTEMQISRDLIPLGSIPFFLTGSPKYPQMLDELVSRLNSRYAEFLRSPEGQNFHGAVCLMADSVGAILTHDVLNIVARQNDGALSESNPDGLSLIDAGARRWRQPIRIGNSREMDQFSQETVSTNHETSTLVQPESNSSDSPLLKRHSTTVRLCTLDFHVQCFIMLGSPVGLLLAFRNQMSK-------IPDPLNKDEQPLLNAELCIA-----ADQVCNLFHMNDPCSFRIEPILHPRFDQIAPLYVPQYAFYPLGDSQPTSLIETLVRQAKLFESDLCAQPNQPDGNLMGTPGTVVSNPKNGRSWEKATMIAF---EALKKIRHNWWGQHRVDYSVHCPEGVQALLAGARAPIFHASYWESSDVAAFVLRQLLEILGFSLPETSYAVDLDDDVAVSGLMDLTRESHSGLNDTINTTSSSVSVGNRPSANLSLGSRFRLRRQGSEGSKNVKSNHRANDVIVGEGEPQILTARFVFGLLDLASMINEKVLIQTRSL---SGTWTPIGTETTDSSGRIHYQVPDQRRFGVGLHSILLSAESDREHPIQLTLAVIPPHTEAVVFSVDGSFAASLSIMGKDPKIRPGAVDVARHWYALGYLIIYLSARPDMQQRRVTSWLANHNFPQGITLFVEGISTDPLRQKCQLLKNICQKVQLKIHCAYGSGKDVSMYRSFNVPPQNIFVVGRISRSQAAQSTPLTRGYAVHLSQLT-AGHVLSRPVVRSVNRAMGQLPFDRPA 1242          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. TrEMBL
Match: A0A4S2M7P9 (DDHD domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_003078 PE=4 SV=1)

HSP 1 Score: 853.588 bits (2204), Expect = 0.000e+0
Identity = 501/1246 (40.21%), Postives = 706/1246 (56.66%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQ--------------SENMDSN-------MRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKM---------HTQESSELPIY--------LNQPTVSSFDVSINEAPFVMETTNDPL---EQSNANNSVHKNMKYIQNHXXXXXXXXXXYDAKSDFPSETDSFMTCRNNFSSNLTLNMDP----------------------------STMTQSIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYV-PLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILS----------KFRNDSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQS---------EQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIE--------NAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIID----------------------------ASMQNQEFANDIAADVESLHLNNFSEPSF---------IDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSS-VVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISN 3376
            MLIKEYRIC+PLTV EYRIAQLYMIQKKS++ESTG+GSGVEII+NEPYE+GPGG GQYTFK+YH+GSHLP W R+ILP SAL VEEEAWNAYPYT+T YKVP +DK TL+IET YF+D G Q+NVF L+ +++  RI+DY+DIV D IS S+Y+ EEDP +YVS  T RGPL+ +W  E+  AQ              S+N   N        RIMCAYKLCRVEF+YWGMQ+++E+FI D  LRKTM+RAHRQ W WQDEW+GL+I +IR+LE E A+ LA +M          T    +LP+          N  +   F  ++N A     T+  P    E  N   ++   +K +++     +          DF  +T SF++CR++ +   +  +                              S ++ + +K   I+VVHGG LLDT ++   K  D    RQT +++I + Y  L N+IA+ LV CPS ++++   + +L    +D + +P    L + V PL ++PLF+T + NY ++L ++   LN  Y+EF+RS EG  F+G V ++AD++G +   D+L+           F +    SLT +   +     +   N     RE D  SL++         ++  +  + ++    LDF+V  F MLGSPVGL+  FR Q         +LKD T   I++  ++ L  ++       +YN F+  DP  +R+EPL++ RF  I P++   +  +P G+     L+ETL     +          NA   +  ++  S   + + AF    +V+Q    WWG++R+DY LHCP  VQ+    A P + HASYWESKD  AFI+RQ++                             +S Q Q   +  AA+ +   ++N+    F         I    K+K  + S   K  C+P  +++ +NHRANDV+VL GQPQ++ ARFM+G  D+L+  NEK+ I   +     G W   G+EVTD++GR+ F + + R    G++PI +  ++D    V   LAVLP   EAVVFS+DGSFAAS+SI GKDPK+RPGSIDVAR WQ  GYLLIY+SARP+MQQR V  WL  H FP G+ LF +G+S +PL+QK Q+L  +    Q+K+HCAYGS KDV++YRSLG+    IF +GR  R + + S PL  GY +HL  LL       + S CIS 
Sbjct:    1 MLIKEYRICLPLTVAEYRIAQLYMIQKKSREESTGRGSGVEIIKNEPYEDGPGGKGQYTFKVYHVGSHLPAWLRSILPPSALRVEEEAWNAYPYTRTIYKVPFVDKLTLDIETLYFDDAGQQENVFKLSTDELNGRIVDYIDIVQDAISKSEYKIEEDPTVYVSKATGRGPLSTNWREEFDHAQRVTHEIHVNSPTRTSDNQQVNGPLSPLPKRIMCAYKLCRVEFRYWGMQSRVEQFIQDSALRKTMVRAHRQVWTWQDEWYGLTIEEIRKLEAETAKTLASRMAGSKGSVAEETAAGEDLPVVRPIASCGARNNASEPLFGTAMNSAGSC--TSRAPSLKPEDDNEGLNLWNTLKQLEDTDREADL--------CDFDDDTLSFVSCRSHVTGQTSCYLSATASAVDGLNTLDGAEDLNFPVAHYSTNNSNVSGNEEKLALIMVVHGGCLLDTGNDLATKRSDTNTFRQTLETIIANHYIVLRNRIAVCLVPCPSELAEIFQTIARLKTFPMDPK-IPIEVQLAHDVMPLGSVPLFLTNSPNYSQLLQELACRLNTHYAEFLRSPEGIGFNGCVYLVADSVGGVLTHDLLNVVACRSSGIPSFVDGDGVSLTDAGARRWREPFLAIAN----GREGDSNSLETISVGSSAADKKSLNPTVPANAPPLLDFHVQTFVMLGSPVGLLLAFRQQ---------SLKDGTRTMIEDAHSDYLVAAD------QVYNFFYPTDPCGFRVEPLLHPRFEQIAPVQTPQYAHYPLGDGQPISLVETLVRQSRLFAPLDSDADGNATSTIAIETERSWEKATMIAFEALKEVRQ---QWWGQQRLDYSLHCPQAVQSLLARARPPIFHASYWESKDVVAFILRQVLGTLGLCLPETSYSLELEDEIPLTNVAAHLSSAQVQLSRHQSAAETDVSVMSNWWNHHFGTRSGDTDTIGPRSKVKRLRGSETTKHTCIPANLSVKSNHRANDVVVLEGQPQVITARFMFGLLDLLSMSNEKISIQTRSY---GGSWTSLGTEVTDSSGRIRFRVPDQRLFGIGLHPILLTPESDPDHPVHLTLAVLPPKTEAVVFSVDGSFAASISIMGKDPKIRPGSIDVARHWQGLGYLLIYLSARPDMQQRRVTSWLMSHNFPQGISLFVEGISTDPLRQKAQLLKTVCDHAQLKIHCAYGSGKDVNLYRSLGVAPQNIFVVGRASRGQAHYSTPLTSGYTAHLAALLSGHPASRQASSCIST 1210          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. TrEMBL
Match: A0A4Z2DVR1 (Membrane-associated phosphatidylinositol transfer protein isoform 4 OS=Schistosoma japonicum OX=6182 GN=EWB00_003648 PE=4 SV=1)

HSP 1 Score: 850.892 bits (2197), Expect = 0.000e+0
Identity = 508/1286 (39.50%), Postives = 734/1286 (57.08%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDS----------------NM-----RIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQESS------ELPIYLNQPTVSSFDVSIN--------------EAPFVMETTNDPLEQSNANNSVHKNM----KYIQNHXXXXXXXXXXYDAKSDFPSETDSFMTCRNNFSSNL--------------------TLNMDPSTMTQ-SIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILS-KFRNDSRPSLTSS----SVSQKESVDMKSINFDSS------------------------HRESDPISLQSEQCXXXXXXXXXXXXXXX-NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELS----ESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLF--------------------NNPGVIENAPGILLNDSSTSEHDSNL--SAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDA---SMQNQEFANDIAADVESLHL----------------------NNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRI----------NMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSS-VVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISN 3427
            ML+KEYRICMPLTV EYRIAQLYMIQKKS++ESTG+GSGVEI++NEPYENGPGG GQYTFKIYH+GSHLPTW RNILP SAL VEEEAWNAYPYT+T YKVP ++K  L+IETY+++D G+QD+VF L+ ++ K RI+D++DIV DP++ SDY++EEDP  YVS  T RGPL+ +W  E+  AQ    ++                N+     RIMCAYKLCRVEF+YWG QT++E+FI D  LRKTM+RAHRQ W WQDEW+GL+I +IRRLEEE A+ LA KM    +S      +L      PT  S +  +N              EA  V   + +P    N  +   +N+    K ++ ++F  +D E F     +   +T SF+TC +N + N                       +  P + TQ +  K V ILV+HGG +LD+ ++   K  DI   R+T ++V  + YP L+N+IA++LV CP+ + DL  + +KL     D      +  L+ ++PL +IP+F+  +  Y ++L+ +  +LN  Y+EF+RS EG +F G+V I+AD++GSI   D+LS K   D R  ++S+    SV+    +  K +NF  +                           S  ++++S    + +  S  +       V  FFMLGSPVGL+  +R Q  +S +   T     + + + ++++           + +    YNLFHL DP  +RIEPL+++RF  I P+ I  + R+P G+  ST LIETL                     +N   IEN    L      ++H  N    + +    +K+V  SWWG KR+DY +HCP+ +Q+    A P +LHASYWESKD A+F+IRQ+++    S+    ++ D++ ++    L                         S+ SF   +   +SK S+        P             N   NHRANDV+  +G   ++  RF++G  D+++   EK+ + I ++    G W    +EVTD++GR+ F + E   +P+G+YPIRM  ++D    V   LA++P   E VVFS+DGSFAAS+S+ GKDPKV PG++DVAR WQ  GYLLIY+SARP+MQ+R V  W+A H FPFGM  F +G+  +PLKQK Q+L  +I+   +++HC YGS KD+++YRSLGL +H IF +G++ R + +N  PL  GY+SHL+ LL   + LS+P+    +V +R   FD+P  Y S+
Sbjct:    1 MLLKEYRICMPLTVAEYRIAQLYMIQKKSREESTGRGSGVEILKNEPYENGPGGKGQYTFKIYHVGSHLPTWIRNILPSSALRVEEEAWNAYPYTRTIYKVPFVEKLVLDIETYFYDDAGEQDDVFELSPDEKKTRIVDFIDIVKDPVTGSDYKEEEDPSTYVSEATGRGPLSPNWREEFSHAQRVTHEAYERPPTRAHDNSPVIGNLEPLPKRIMCAYKLCRVEFRYWGTQTRVEQFIHDTALRKTMVRAHRQVWAWQDEWYGLTIDEIRRLEEETAQALASKMADLNNSVNNAVNQLSNEAQVPTKPSDNTPVNNVAQSTCNQSVEELEANSVTTASEEPRITCNTTDIEEQNLWADFKKLEANNFELDDFEPFTAPYLESDDDTRSFITCCSNLTDNTDYSTPLGSNFQSFDAPGILSCFSQKPVSGTQLNRSKLVLILVIHGGCVLDSTYDLTTKRSDILTFRKTIETVTANHYPTLHNRIAVKLVPCPTEIGDLFRLFSKLKAPP-DPNRPVEAQLLRDFIPLGSIPIFLINSPGYSRMLEQLAFNLNTHYAEFLRSSEGINFSGKVCIVADSVGSILAHDLLSTKPLTDHRSMISSNNDNLSVTDIGLMRRKRLNFHCTTEMEKQLNSPTLINSPSEITLCPPESNSGVVNIESSNVENRESQSYSRVYALDFQVQNFFMLGSPVGLILAYRYQKTQSASSTTTTLTPISGSNQFVNSSPYMTYHISQEIKLSVYQAYNLFHLTDPYGFRIEPLLDNRFSYISPIFIPQYARYPLGDGQSTNLIETLVQQAELFSSDASEKSFYLPDNDNAKTIENDDITLNVKRQLTDHQLNWEKKSIIALEALKKVQQSWWGPKRVDYNVHCPEAIQSILARARPSILHASYWESKDVASFVIRQLLETLGLSVLETSYSADMSDEIAVTELAKVSLNPNQIKSQTYELLDDASTQMSQQSFKSGSNSYQSKFSTFSHSLSLGPRSFLKRTSSERLKNFKPNHRANDVITATGSAPLITGRFVFGGLDLMSFSGEKIRVEIQSI---SGTWAYVCTEVTDSSGRIRFFLPEQLHLPDGLYPIRMTAESDPDHPVIITLAIVPAQTEVVVFSVDGSFAASLSLMGKDPKVHPGAVDVARHWQGLGYLLIYLSARPDMQRRRVTNWMANHNFPFGMTFFLNGLYTDPLKQKAQMLKTIIENASLRIHCGYGSGKDINLYRSLGLSTHNIFLVGKVSRSQSSNGTPLTQGYSSHLSSLL-NGHPLSRPAIGAVSVAVRCCPFDLPSIYPSS 1281          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. TrEMBL
Match: A0A430QPI4 (DDHD domain-containing protein (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0005613 PE=4 SV=1)

HSP 1 Score: 848.966 bits (2192), Expect = 0.000e+0
Identity = 521/1301 (40.05%), Postives = 749/1301 (57.57%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDS----------------------NMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQESSELPIYLNQP---------TVSSFDVSINEAPFVMET-TNDPLEQSNANNSVHKNMKYIQNHXXXXXXXXXXYDAKSDFP-------------------SETD----SFMTCRNNFSSNL--------------------TLNMDP-STMTQSIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSK-------FRNDSRPSLTSSSVSQKESVDMKS-------------INFDSSHRESDPIS-----------LQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFR-NQTKKSEAWCGTLKDLTNETIKNISNNELS--ESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFN-----NPGVIENAPGILLNDSST--SEHDSNLS---------------AFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDA---SMQNQEFANDIAADVE-------SLHLNNFSEPSF--IDXXXXXXXXXXXXXXXAMCVPYRINMT-----------------ANHRAN----DVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSS-VVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDND 3448
            ML+KEYRICMPLTV EYRIAQLYMIQKKS++ESTG+GSGVEI++NEPYENGPGG GQYTFKIYH+GSHLPTW RNILP SAL VEEEAWNAYPYT+T YKVP ++K  L++ETY+F+D G+QD+VFNL+ ++ K RIID++DIV DPI+ SDYR EEDP IYVS  T RGPL+ +W  E+  AQ    ++                      + RIMCAYKLCRVEF+YWG QT++E+FI D  LRKTMLRAHRQ W WQ+EW+GL+I +IRRLEEE A+ LA KM            NQP          V S   +INE    +E   N   E+  + +S   + K+   H   +  D +  +  +DF                    +E+D    SF+TC ++ + N                       N +P S++ Q+  K V ILV+HGG +LD+ ++   K  DI   R+T ++V  + YP L+N+IA++LV CP+ + D+  + +KL     D      +  L+  +PL +IPLF+  +S Y ++L+ +  +LN  Y+EF+RS EG HF G+V I+AD++GSI   D+L+K         N++  S+T   + +++   + S             IN  S      P S           L++E+        S    LDF V  FFMLGSPVGL+  +R  Q + + +   + K  TN+ I N S N +       + +    YNLFHL DP  +RIEPL+++RF  I P+ I  + R+P G+  ST LIETL       +  V E +  +  +D+ST    +DS ++               + +    +K+V  SWWG KR+DY +HCP+ +Q     A P +LHASYWESKD A+FIIRQI+D    S+    ++ D++ ++        SL+ N     ++  +D +    S+QS     +      ++ T                  N +AN    DV+  +G   ++  RF +G  D+++  +EK+ + I ++    G W    +EVTD++GR+ F + E   +P+G+YPI+M  ++D    V   LA++P   E VVFS+DGSFAAS+S+ GKDPKV PG++DVAR WQ  GYLLIY+SARP+MQ+R V  W+A H FPFGM  F +G+ ++PLKQK Q+L  +++   ++VHC YGS KD+++YRSLGL +  IF +G++ R + +N  PL  GY+SHL+ L+   +TLS+P+    ++ +R   FD+P  Y S+   +D++
Sbjct:    4 MLLKEYRICMPLTVAEYRIAQLYMIQKKSREESTGRGSGVEILKNEPYENGPGGKGQYTFKIYHVGSHLPTWLRNILPSSALRVEEEAWNAYPYTRTIYKVPFVEKLVLDVETYFFDDAGEQDDVFNLSPDERKARIIDFIDIVKDPITGSDYRPEEDPSIYVSEATGRGPLSPNWREEFIHAQQATHETYEKPPTRTHDNSPAIVENLKPLHKRIMCAYKLCRVEFRYWGTQTRVEQFIHDTALRKTMLRAHRQVWAWQNEWYGLTIEEIRRLEEETAQALAFKMADS---------NQPPNNDGELSKQVRSTTSNINETMNAIEVKCNQSDEKCESKSSTATSEKF---HLPVNSTDIAEQNLWADFKKLEANNFELDDFEPFTAPCAESDDDARSFVTCCSDLTGNTDYATPLASNFQSFDIPGIKSCFNQNPVSSIQQNCGKLVLILVIHGGCILDSTYDLTTKRSDILTFRKTIETVTANHYPTLHNRIAVKLVPCPTEIGDIFRLFSKLKASP-DPTRPIETQLLRDLMPLGSIPLFLINSSGYSRMLEQLSFNLNSHYAEFLRSPEGIHFSGKVCIVADSVGSILAHDLLTKPSTNHESVSNNNDTSMTDIGLMRRKQFGIHSLIQPDKQIKTPTLINSPSEVTLCPPESNTSLGNVELSNLENEE----SKSHSRMSSLDFQVQNFFMLGSPVGLILAYRYQQNQLTSSIVSSSK--TNQLITNSSYNMVYHLSKEIKLSVGQAYNLFHLTDPCGFRIEPLLDNRFSCISPIFIPQYVRYPLGDGQSTNLIETLIQQAELFSANVSEKSYNLSDSDNSTINENNDSTVNVKRQLTNQQLNWEKKSIVALEALKKVQQSWWGPKRVDYNVHCPEAMQNILARARPSILHASYWESKDVASFIIRQILDTLGLSVLETSYSADLSDEIAVTELAKLSLNPNQIKSQTYEVMDDSSIQISQQSEKSSSSQSRFSNLSHTLSFGPRNFLKRTSSERLKNFKANHRANDVITTTGSTPLITGRFAFGGLDLMSFSSEKIRVEIQSI---SGSWSYVCTEVTDSSGRIRFSLPEQIHLPDGLYPIKMTAESDPDHPVIITLAIVPPQTEVVVFSVDGSFAASLSLMGKDPKVHPGAVDVARHWQGLGYLLIYLSARPDMQRRRVTNWMANHNFPFGMTFFLNGLYSDPLKQKAQMLKTVVENANLRVHCGYGSGKDINLYRSLGLSTQNIFLVGKVSRSQASNGTPLLQGYSSHLSSLI-NGHTLSRPAVGSMSIAVRCCPFDLPSVYPSSPLLMDSN 1281          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Cavefish
Match: PITPNM2 (membrane-associated phosphatidylinositol transfer protein 2-like [Source:NCBI gene;Acc:103035112])

HSP 1 Score: 806.594 bits (2082), Expect = 0.000e+0
Identity = 475/1164 (40.81%), Postives = 670/1164 (57.56%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSN-MRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQESSELPIYLNQPTVSSFDVS-INEAPFVMETT------NDPLEQSN----------------------ANNSVHKNMKYIQNHXXXXXXXXXXYDAKSDFPSETDSFMTCRNNFSSNLTLNMDPSTMTQSIQKS-------VFILVVHGGSLLDTNH-EYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKS---------INFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNS-WWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRR 3391
            MLIKEYRI MP++VEEYRIAQLYMIQKKS++ES G+GSGVEI+ N PY +GPGGIGQYT K+YHIG H+P+WFR+ILPK+AL VEEE+WNAYPYT+TRY  P ++KF+++IETYY  D G Q++VF+L+  + +QR ID +DIV D I+  +Y  EEDPK+Y S KT RGPL D W  E       N++   M +MCAYKLC+VEF+YWGMQ+KIE+FI D+GLRK M+RAHRQAWCWQDEW+GL++ DIR+LE E    LA+KM     +E     N  T S        EA   MET        D L+                         + +S+ +           D  D+ F+DA  DF S+ + F      +SSN  ++   +    S Q         V +LV+HGG++LDT   +  +K GD+  +   F++V++  YP     IA+RLV CP++  +  ++++ L+P   D+  L +S   Q ++PLAA+PL  T A  Y+  +  +    N  Y +FI+S EG  F GQV +I D +G I  FD L         S  SS      SV +++          +  SS   +DP S +S   S+         K DF V  FF+ GSP+GLV   R     +                      L  ++ RP C+ +YNLFH  DPS+ R+EPL+  +FH + P  +  + RFP G+  S  L + +        +A G +  ++S     +++ AF    +  +V+ + WWG KRID+ L+CPD + AFP  ALPHL HASYWES D  +F++RQ++          N    +++   ++ F+ PS           +     K   V  R N+TANHR ND +      Q++  RFMYG  DM+T   EKVDI+IM  P S G W    +E+T+++GR+ + I ES+R+  GVYP++MV++ D +    +L VLP   + VVFSIDGSFAASVSI G DPKVR G++DV R WQD GYL++Y++ RP+MQ++ V  WL+QH FP G++ F DG+  +PL+ K   L  LI E  +K+  AYGS+KD+S+Y SLGL   QI+ +GR  +  ++    + DGYASHL+ L  + +  S+P++  S   + R
Sbjct:    1 MLIKEYRIPMPMSVEEYRIAQLYMIQKKSREESEGEGSGVEILENRPYTDGPGGIGQYTHKVYHIGQHIPSWFRSILPKAALRVEEESWNAYPYTRTRYTCPFVEKFSIDIETYYKPDTGTQNDVFSLSSAEKRQRDIDPIDIVKDIIAPHEYLAEEDPKLYKSLKTQRGPLNDDWIEEI------NINPGAMPVMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTMEDIRQLELETQLALAKKMAQFSLNEEGGETNGATASPDKTQDAKEAIGAMETEGQARGLGDTLQTRGELTKQWSTSSRSSRSSKRGGSPSRHSISEWRMQSIARDSDDSTDDEFFDAHEDF-SDEEIFAKEITKWSSNDLMDKIETAEDGSAQAGLQASKIHVLLLVLHGGNILDTGAGDQSSKQGDVNTISTVFETVMRVHYPAALGHIAIRLVPCPAVCVEAFSLVSNLSPYSYDEGCLSNS---QDHIPLAALPLLATSAPQYQDAVAAVIVRANQVYGDFIKSLEGAAFSGQVCLIGDCVGGILGFDALCSSNVTVSESQNSSRRGSIVSVQVRTRVNLYICVWCSLHSSVLRNDPGSRRSSN-STMLEGGGALGKFDFEVSDFFLFGSPLGLVLALRKTVVPT----------------------LDVAHLRPACQQVYNLFHPADPSASRLEPLLEKKFHLLAPFSVPRYQRFPLGDGHSALLADVM--------HAHGGMFVENSYPSSPASVPAFRIPRRSSEVIAARWWGTKRIDFALYCPDALTAFPTVALPHLFHASYWESTDVVSFLLRQVM-------RHENSSILELDGKEVSEFT-PS---------KPREKWLRKRTHVKIR-NVTANHRVNDAVFTEDGMQVVTGRFMYGPLDMVTLTGEKVDIHIMTQPPS-GEWVHFDTELTNSSGRISYVIPESKRLGIGVYPVKMVVRGDHTSADSYLTVLPRGTDFVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHWQDLGYLIVYVTGRPDMQKQRVVAWLSQHNFPHGIVSFCDGLVHDPLRHKANFLKSLICEAHMKIFAAYGSTKDISVYTSLGLPPSQIYIVGRPTKKMQHQCQFVSDGYASHLSQL--EYSQRSRPAKAGSTRMVLR 1102          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Cavefish
Match: ENSAMXT00000009284.2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000873.1:143926:219322:1 gene:ENSAMXG00000009034.2 transcript:ENSAMXT00000009284.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 444.121 bits (1141), Expect = 1.159e-135
Identity = 276/761 (36.27%), Postives = 408/761 (53.61%), Query Frame = 2
Query: 1175 VHGGSLLDTNHEY--HNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMK-----------SINFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNS-WWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAE--SRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISN-VTLRRSCFDI 3406
            +  G L ++   Y  ++K GD+  +   FD+V+   YP     +A+RLV CP I ++  ++++ L+P   D+  L SS   Q ++PLAA+PL  T +  Y+  +  + +  N  YS+F+RS +G  F GQV +I D +G I  FD L         S +SS      SV ++             N  SS    DP S +S    S+ L S    K DF V  FF+ GSP+GLV   R                  +T+  +    L  +  RP C+ +YNLFH  DPS+ R+EPL+  +FH +PP  +  + RFP G+ +S  L +       ++++  G+ +  S  S             +  +V+ + WWG KR+D+ L+CPD + AFP  ALPHL HASYWES D  +F++RQ+                  +  HL       F     + K  +         V  R N+TANHR ND +      +++  RFMYG  DM+T   EKVDI IM  P S G WE   +EVT+++GR+ + I+E   +R+  GVYPI+MV++ D +    +L VLP   E VVFSIDGSFAASVSI G DPKVR G++DV R WQD GY++IY++ RP+MQ++ V  WL+QH FP G++ F DG+  +PL+ K   L  LI EV +     YGS+KD+S+Y S+GL   QI+ +GR  +  ++    + DGYA+HL+ L  +    S+P++  S  + LR++ F +
Sbjct:  382 IEAGDLEESTGAYNLYSKQGDVNTITSAFDTVMHVHYPSALGHVAIRLVPCPPICAEAFSLVSNLSPYSYDEGCLSSS---QDHIPLAALPLLATSSPQYQDAVATVISRANQVYSDFLRSLDGASFSGQVCLIGDCVGGILGFDALCSSSQTVCESQSSSRRGSVVSVQVRLEATLINLLQGVSNLHSSVLRHDPGSRRSSN--STMLESGALGKFDFEVTDFFLFGSPLGLVLALR------------------KTVIPM----LDVAQLRPACQQVYNLFHPADPSASRLEPLLEKKFHLLPPFNVPRYQRFPLGDGNSALLAD-------IVQSHGGVFMESSYPSSPIMAPQCLGPVRRASEVIAARWWGTKRLDFALYCPDALTAFPTVALPHLFHASYWESTDVVSFLLRQVRS----------------DKPHLTQLEVSEFTPSRPREKWMRKRTH-----VKIR-NVTANHRVNDAVFTEDAQKVVTGRFMYGPLDMVTLAGEKVDILIMTQPPS-GEWEYLHTEVTNSSGRISYTISEQEGKRLGVGVYPIKMVVRGDHTFADSYLTVLPPATEFVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHWQDLGYVIIYVTGRPDMQKQRVVAWLSQHNFPHGIVSFCDGLVHDPLRHKANFLKSLITEVCMFSCAGYGSTKDISVYTSVGLSPSQIYIVGRPSKKMQHQCQFITDGYAAHLSQL--EYTQRSRPAKASSTRMVLRKASFGL 1083          

HSP 2 Score: 372.859 bits (956), Expect = 1.063e-109
Identity = 172/273 (63.00%), Postives = 221/273 (80.95%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKM--HTQESSE 856
            MLIKEYRI MPL+VEEYRIAQLYMIQKKS++ES G+GSGVEI+ N PY +GPGG GQYT K+YHIG H+P+WFR+ILPK+AL VEEE+WNAYPYT+TRY  P ++KF+++IETYY +D G+Q +VFNL+  + +QR +D +DIV DPI   +Y+ EEDP+IY S KT+RGPL D W  E+    S++      +MCAYKLC+VEF+YWGMQ+KIE+FI D+GLRK M+RAHRQAWCWQDEW+GL++ DIR+LE E    LA+KM  + +E++E
Sbjct:    1 MLIKEYRIPMPLSVEEYRIAQLYMIQKKSREESCGEGSGVEILENRPYTDGPGGTGQYTHKVYHIGMHIPSWFRSILPKAALRVEEESWNAYPYTRTRYTCPFVEKFSIDIETYYKSDTGNQADVFNLSLAERRQRTLDPIDIVKDPIPPHEYKAEEDPRIYRSIKTSRGPLNDDWIEEFVKDPSKS-----PVMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTMEDIRQLELETQLALAQKMAQYAEEATE 268          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Cavefish
Match: plrdgb (membrane-associated phosphatidylinositol transfer protein 3 [Source:NCBI gene;Acc:103040177])

HSP 1 Score: 407.527 bits (1046), Expect = 2.727e-124
Identity = 272/815 (33.37%), Postives = 412/815 (50.55%), Query Frame = 2
Query: 1136 MTQSIQKSVFILVVHGGSLLDTNHEYHNKNG-DIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL------------SKFRNDSRPSL-------TSSSVSQKESVDMKSINFD-SSHRESDP------ISLQSEQCXXXXXXXXXXXXXXX-----------------NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLF-------NNPGVIEN----APGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVK 3415
            M +  +  + ILVVHGG +LD+          D   L    + V ++ +    + + +RLV CP + ++  ++++ L P   D+  + SS     ++PLAA+P+    A  Y+  +  +    N  Y  F++S EG  F GQV ++AD +G +  FD L            +  RN+S  SL       +S S + + S  +   N D S+  ES P      I  QS+ C +                               V   F+LG P+GLV   R     +                      +  +   P C  ++NLF+ +DPS+ R+EPL++     +PP  +  + R+P G+  S  + +T+        + P  I+       G     ++T   +S  +       + Q+ + WWG KR+DY L+CPD + AFP  ALP L HASYWES D  AFI+RQ++         A+    D   +  ++  E     +                 V  R N+TANHR +DV+     PQ L+ RFMYG  DM+T   EKVD+++ + P S G W    +EVT ++GRV + I  ++R+P GVYPI+MV+K D +  +  L VLP  +E+VVFSIDGSFAASVS+ G DPKVRPG++DV R WQD G+L+IYI+ RP+MQ++ V  WL+QH FP GM+ FS+G+  +PL+QK   L  L+KE  IK+  AYGS KD+S+Y +LGL   QI+ +GR  +  ++    L +GYA+HL+ L  +  + SK +R    + LR+  F +  K
Sbjct:   98 MERKCRTQLLILVVHGGHILDSGGGDPGGKAGDAATLASVLERVARAHFQKAADGMLVRLVPCPPVCAEAFSLVSHLNPYSYDESCVSSSVD---HLPLAALPILAIAAPRYQDAVASVIAQANQVYHNFLQSPEGVGFSGQVCLVADCVGGVLCFDALCFSGDQRQVSPNANSRNNSTESLKEKPGVMSSLSPNLRGSKRLSKSNIDVSTPCESGPGIRHPLIRKQSDSCDADVAGGQRGVFFSSLSQEEQSSLRHPGCFDFEVADCFLLGCPLGLVLAMRRTVLPA----------------------VQVAQLHPACSQIFNLFYPSDPSASRLEPLLHPSLTQLPPFPVPRYQRYPLGDGRSALISDTVVKHLSDGSSTPDAIQTPCCPGGGCRAGRAATDPENSTSAPDQLDSTISQLCSRWWGCKRLDYVLYCPDVLSAFPTVALPPLFHASYWESTDAMAFILRQVLRCDCLKAGEAD--CKDAIPISPSSPREKWLRRRTH---------------VKLR-NVTANHRVHDVIATEDCPQTLVGRFMYGPLDMVTLTGEKVDVFLKSQPAS-GRWVLFDTEVTSSSGRVTYTIPANKRLPLGVYPIKMVVKGDQTSAEAFLTVLPRGMESVVFSIDGSFAASVSLMGSDPKVRPGAVDVVRHWQDLGFLIIYITGRPDMQKQRVVSWLSQHNFPQGMVFFSEGLVHDPLRQKTIFLKSLVKECHIKISAAYGSMKDMSVYSALGLEPSQIYIVGRPSKKHQHQCQFLSEGYAAHLSTLEFEHGSRSKKNR----MVLRQGSFGLSSK 864          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Cavefish
Match: plrdgb (membrane-associated phosphatidylinositol transfer protein 3 [Source:NCBI gene;Acc:103040177])

HSP 1 Score: 400.593 bits (1028), Expect = 1.673e-122
Identity = 272/823 (33.05%), Postives = 411/823 (49.94%), Query Frame = 2
Query: 1130 STMTQSIQKS----VFILVVHGGSLLDTNHEYHNKNG-DIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL------------SKFRNDSR-----------------PSLTSSSVSQKESVDMKSINFDSSHRESDP------ISLQSEQCXXXXXXXXXXXXXXX---------------------NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVK 3415
            S+ + S+Q+     + ILVVHGG +LD+          D   L    + V ++ +    + + +RLV CP + ++  ++++ L P   D+  + SS     ++PLAA+P+    A  Y+  +  +    N  Y  F++S EG  F GQV ++AD +G +  FD L            +  RN+S                  P+L  S    K ++D+      S+  ES P      I  QS+ C +                                   V   F+LG P+GLV   R     +                      +  +   P C  ++NLF+ +DPS+ R+EPL++     +PP  +  + R+P G+  S  + +  F     +E+   ++LN      H  + S   K      + + WWG KR+DY L+CPD + AFP  ALP L HASYWES D  AFI+RQ++         A+    D   +  ++  E     +                 V  R N+TANHR +DV+     PQ L+ RFMYG  DM+T   EKVD+++ + P S G W    +EVT ++GRV + I  ++R+P GVYPI+MV+K D +  +  L VLP  +E+VVFSIDGSFAASVS+ G DPKVRPG++DV R WQD G+L+IYI+ RP+MQ++ V  WL+QH FP GM+ FS+G+  +PL+QK   L  L+KE  IK+  AYGS KD+S+Y +LGL   QI+ +GR  +  ++    L +GYA+HL+ L  +  + SK +R    + LR+  F +  K
Sbjct:   41 SSFSLSVQRKCRTQLLILVVHGGHILDSGGGDPGGKAGDAATLASVLERVARAHFQKAADGMLVRLVPCPPVCAEAFSLVSHLNPYSYDESCVSSSVD---HLPLAALPILAIAAPRYQDAVASVIAQANQVYHNFLQSPEGVGFSGQVCLVADCVGGVLCFDALCFSGDQRQVSPNANSRNNSTESLKVKIQKDTHFFLELPNLRGSKRLSKSNIDV------STPCESGPGIRHPLIRKQSDSCDADVAGGQRGCFCSSLVLSLSQEEQSSLRHPGCFDFEVADCFLLGCPLGLVLAMRRTVLPA----------------------VQVAQLHPACSQIFNLFYPSDPSASRLEPLLHPSLTQLPPFPVPRYQRYPLGDGRSALICKNSF-----MEDLLSLILN-----LHGGSASRMFK---NSSICSRWWGCKRLDYVLYCPDVLSAFPTVALPPLFHASYWESTDAMAFILRQVLRCDCLKAGEAD--CKDAIPISPSSPREKWLRRRTH---------------VKLR-NVTANHRVHDVIATEDCPQTLVGRFMYGPLDMVTLTGEKVDVFLKSQPAS-GRWVLFDTEVTSSSGRVTYTIPANKRLPLGVYPIKMVVKGDQTSAEAFLTVLPRGMESVVFSIDGSFAASVSLMGSDPKVRPGAVDVVRHWQDLGFLIIYITGRPDMQKQRVVSWLSQHNFPQGMVFFSEGLVHDPLRQKTIFLKSLVKECHIKISAAYGSMKDMSVYSALGLEPSQIYIVGRPSKKHQHQCQFLSEGYAAHLSTLEFEHGSRSKKNR----MVLRQGSFGLSSK 796          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Cavefish
Match: PITPNM2 (membrane-associated phosphatidylinositol transfer protein 2-like [Source:NCBI gene;Acc:103035112])

HSP 1 Score: 372.859 bits (956), Expect = 5.567e-109
Identity = 209/545 (38.35%), Postives = 307/545 (56.33%), Query Frame = 2
Query: 1796 VHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGV-IENA--------PGILL----NDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRR 3391
            V  FF+ GSP+GLV   R     +                      L  ++ RP C+ +YNLFH  DPS+ R+EPL+  +FH + P  +  + RFP G+  S  L + +  + G+ +EN+        P   +    ++ S +   S L+       +  +   WWG KRID+ L+CPD + AFP  ALPHL HASYWES D  +F++RQ++          N    +++   ++ F+ PS           +     K   V  R N+TANHR ND +      Q++  RFMYG  DM+T   EKVDI+IM  P S G W    +E+T+++GR+ + I ES+R+  GVYP++MV++ D +    +L VLP   + VVFSIDGSFAASVSI G DPKVR G++DV R WQD GYL++Y++ RP+MQ++ V  WL+QH FP G++ F DG+  +PL+ K   L  LI E  +K+  AYGS+KD+S+Y SLGL   QI+ +GR  +  ++    + DGYASHL+ L  + +  S+P++  S   + R
Sbjct:  709 VSDFFLFGSPLGLVLALRKTVVPT----------------------LDVAHLRPACQQVYNLFHPADPSASRLEPLLEKKFHLLAPFSVPRYQRFPLGDGHSALLADVMHAHGGMFVENSYPSSPASVPAFRIPRRSSEVSIASQVSGLADSYTASNIANIAARWWGTKRIDFALYCPDALTAFPTVALPHLFHASYWESTDVVSFLLRQVM-------RHENSSILELDGKEVSEFT-PS---------KPREKWLRKRTHVKIR-NVTANHRVNDAVFTEDGMQVVTGRFMYGPLDMVTLTGEKVDIHIMTQPPS-GEWVHFDTELTNSSGRISYVIPESKRLGIGVYPVKMVVRGDHTSADSYLTVLPRGTDFVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHWQDLGYLIVYVTGRPDMQKQRVVAWLSQHNFPHGIVSFCDGLVHDPLRHKANFLKSLICEAHMKIFAAYGSTKDISVYTSLGLPPSQIYIVGRPTKKMQHQCQFVSDGYASHLSQL--EYSQRSRPAKAGSTRMVLR 1210          

HSP 2 Score: 365.925 bits (938), Expect = 2.086e-106
Identity = 162/250 (64.80%), Postives = 203/250 (81.20%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSN-MRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEYRI MP++VEEYRIAQLYMIQKKS++ES G+GSGVEI+ N PY +GPGGIGQYT K+YHIG H+P+WFR+ILPK+AL VEEE+WNAYPYT+TRY  P ++KF+++IETYY  D G Q++VF+L+  + +QR ID +DIV D I+  +Y  EEDPK+Y S KT RGPL D W  E       N++   M +MCAYKLC+VEF+YWGMQ+KIE+FI D+GLRK M+RAHRQAWCWQDEW+GL++ DI
Sbjct:    1 MLIKEYRIPMPMSVEEYRIAQLYMIQKKSREESEGEGSGVEILENRPYTDGPGGIGQYTHKVYHIGQHIPSWFRSILPKAALRVEEESWNAYPYTRTRYTCPFVEKFSIDIETYYKPDTGTQNDVFSLSSAEKRQRDIDPIDIVKDIIAPHEYLAEEDPKLYKSLKTQRGPLNDDWIEEI------NINPGAMPVMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTMEDI 244          

HSP 3 Score: 114.39 bits (285), Expect = 4.317e-25
Identity = 61/168 (36.31%), Postives = 96/168 (57.14%), Query Frame = 2
Query: 1115 LNMDPSTMT--QSIQKSVFILVVHGGSLLDTNH-EYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL 1609
            LN D S     Q+ +  V +LV+HGG++LDT   +  +K GD+  +   F++V++  YP     IA+RLV CP++  +  ++++ L+P   D+  L +S   Q ++PLAA+PL  T A  Y+  +  +    N  Y +FI+S EG  F GQV +I D +G I  FD L
Sbjct:  413 LNEDGSAQAGLQASKIHVLLLVLHGGNILDTGAGDQSSKQGDVNTISTVFETVMRVHYPAALGHIAIRLVPCPAVCVEAFSLVSNLSPYSYDEGCLSNS---QDHIPLAALPLLATSAPQYQDAVAAVIVRANQVYGDFIKSLEGAAFSGQVCLIGDCVGGILGFDAL 577          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Sea Lamprey
Match: pitpnm3 (PITPNM family member 3 [Source:ZFIN;Acc:ZDB-GENE-030131-9216])

HSP 1 Score: 332.028 bits (850), Expect = 3.486e-103
Identity = 172/394 (43.65%), Postives = 242/394 (61.42%), Query Frame = 2
Query: 2228 VKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
            V  V   WWG KR+D+ L+CPD + AFP  ALPHL HASYWES D  AFI+RQ         +   + +A   S     +  P                     CV    N+TANHRA+DV+V+   PQ+L  RFMYG  DM+T   EKVD++IM  P + G W    +EVT+++GR+ + I ESRR+  G+YP++MV++ D +    +L VLP   E VVFSIDGSFAASVSI G DPKVR G++DV R WQD GYL++Y++ RP+MQ++ V  WLAQH FP G++ F DG+  +PL+ K   L  L+ E  ++VH AYGS+KD+++Y +L L  +QI+ +GR  +  ++    L DGYA+HL  L  + +  S+P++  + + LR+  F +P
Sbjct:    1 VVAVTARWWGTKRLDFALYCPDALTAFPTMALPHLFHASYWESTDVVAFILRQPHTKDKPESQDGRETSAFSPSQPREKWLRPD-------------------TCVEIIKNVTANHRASDVLVVEDGPQLLAGRFMYGPLDMVTLTGEKVDVHIMTQPPA-GEWVHFDTEVTNSSGRINYLIPESRRLGIGMYPVKMVVRGDHTFADCYLTVLPRGTECVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHWQDLGYLIVYVTGRPDMQKQRVVAWLAQHNFPHGLVSFCDGLVHDPLRHKANFLRSLMMEKHVRVHAAYGSTKDIAVYSALNLAPNQIYIVGRPTKKYQHLCQFLADGYAAHLAQL--EYHHRSRPAKSNARMVLRKGSFGLP 372          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Sea Lamprey
Match: plrdgb (PITP-less RdgB-like protein [Source:ZFIN;Acc:ZDB-GENE-000406-3])

HSP 1 Score: 330.102 bits (845), Expect = 4.828e-102
Identity = 182/473 (38.48%), Postives = 261/473 (55.18%), Query Frame = 2
Query: 1949 FRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNN--------PGVIE-----NAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDL 3328
             RP C+ +YN+FH  D S+ R+EPL + R   IPP ++  +         ST + +    N          + E     N+           EH    +A      +  +++ WWG KRIDY LHCP+ V+ FP  +   L H SY ES D AAF+++Q++                 + +  +  S P                  K   V  R N+TANHRANDV+V+ G  Q L  RFMYGT DM+T   EKVD++IM  P   G W    ++VT+++GRV + I + + +  G+YP++MV++ D +     LAVLP   E VVFSIDGSFAASVS++G DPKVRPG+IDV R WQ+ G+LLIY++ RP+MQ++ V  WLAQH FP G++ F DG+  +PL+ K   L  L +E  +++H +YGSSKD+ +Y +LGL   QI+ +GR  +        + +GYA+HL  L
Sbjct:    1 LRPACQQIYNIFHPADLSACRLEPLFDQRLTQIPPHRVPRYPSLQMVERHSTLMGDVCSTNFEFSLQVAKAMYEYTTRSNSSSFTTRQCLAKEHSPMPAAIFTTADISGILSRWWGVKRIDYWLHCPEAVRPFPAVSSAQLSHTSYLESMDVAAFLLQQVLGPGR---------VGATQQMSQDGSSSPC---------KPLEKWLKKRTSVKIR-NVTANHRANDVIVVEGSAQSLAGRFMYGTLDMVTLTGEKVDMFIMTKP-PEGEWVYFDTQVTNSSGRVSYVIPDIQHIGIGLYPVKMVVRGDRTFADSFLAVLPKGTECVVFSIDGSFAASVSLTGTDPKVRPGAIDVVRHWQELGFLLIYVTGRPDMQKQRVVAWLAQHNFPHGLMSFCDGLVHDPLRHKTNFLRSLQQEAHMRIHTSYGSSKDIGVYHALGLSPSQIYIVGRPSKKHHLQCQYISEGYAAHLVQL 453          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Sea Lamprey
Match: pitpnm3 (PITPNM family member 3 [Source:ZFIN;Acc:ZDB-GENE-030131-9216])

HSP 1 Score: 328.561 bits (841), Expect = 1.366e-101
Identity = 174/398 (43.72%), Postives = 245/398 (61.56%), Query Frame = 2
Query: 2228 VKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRI----NMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIP 3409
            V  V   WWG KR+D+ L+CPD + AFP  ALPHL HASYWES D  AFI+RQI+       E    +  D       + S+P                  +    P R     N+TANHRA+DV+V+   PQ+L  RFMYG  DM+T   EKVD++IM  P + G W    +EVT+++GR+ + I ESRR+  G+YP++MV++ D +    +L VLP   E VVFSIDGSFAASVSI G DPKVR G++DV R WQD GYL++Y++ RP+MQ++ V  WLAQH FP G++ F DG+  +PL+ K   L  L+ E  ++VH AYGS+KD+++Y +L L  +QI+ +GR  +  ++    L DGYA+HL  L  + +  S+P++  + + LR+  F +P
Sbjct:    1 VVAVTARWWGTKRLDFALYCPDALTAFPTMALPHLFHASYWESTDVVAFILRQIV-----RHESGGVLEQDGRETSAFSPSQPR-----------------EKWLRPDRHLRGNNVTANHRASDVLVVEDGPQLLAGRFMYGPLDMVTLTGEKVDVHIMTQPPA-GEWVHFDTEVTNSSGRINYLIPESRRLGIGMYPVKMVVRGDHTFADCYLTVLPRGTECVVFSIDGSFAASVSIMGSDPKVRAGAVDVVRHWQDLGYLIVYVTGRPDMQKQRVVAWLAQHNFPHGLVSFCDGLVHDPLRHKANFLRSLMMEKHVRVHAAYGSTKDIAVYSALNLAPNQIYIVGRPTKKYQHLCQFLADGYAAHLAQL--EYHHRSRPAKSNARMVLRKGSFGLP 373          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003232.1 (pep scaffold:Pmarinus_7.0:GL486150:7644:10272:1 gene:ENSPMAG00000002952.1 transcript:ENSPMAT00000003232.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 292.352 bits (747), Expect = 1.338e-91
Identity = 134/224 (59.82%), Postives = 172/224 (76.79%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQ------RIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFI 697
            MLIKEYRI +P++VEEYRIAQLYMIQKKS+DE++G+GSGVEI+ N PYE+GPGG GQYT K+YHIG H+P WFR ILPK+AL VEE++WNAYPYT+TRY  P ++KF+++IET+Y  DGGDQ NVFNL   + +Q       + D +DIV DP++  +Y  +EDP++Y S +T RGPL D WA+   +           IMCAYKLC+VEF+YWGMQ+KIE+FI
Sbjct:    1 MLIKEYRIPLPMSVEEYRIAQLYMIQKKSRDETSGEGSGVEILENRPYEDGPGGTGQYTHKLYHIGMHIPGWFRAILPKAALRVEEQSWNAYPYTRTRYTCPFVEKFSIDIETHYQQDGGDQLNVFNLGAAEKRQCSVGAGPVADTIDIVRDPMAPHEYVVDEDPRVYRSERTGRGPLGDDWASLNPSP----------IMCAYKLCKVEFRYWGMQSKIERFI 214          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004160.1 (pep scaffold:Pmarinus_7.0:GL481899:12693:18585:1 gene:ENSPMAG00000003779.1 transcript:ENSPMAT00000004160.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 194.126 bits (492), Expect = 8.274e-56
Identity = 104/254 (40.94%), Postives = 158/254 (62.20%), Query Frame = 2
Query:   41 IMLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVP---IIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVN-DPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            ++L+KE+R+ +P +VEEY++ QL+ + + SK+E TG G G+E++RNEPYE   G  GQYT KIYH+ S +P + R   P+ +L+  E+A        T   V    + D F ++IET++  D G Q+NV  L++   KQ  + ++DI + + + SSDY+ EEDP ++ S+KT+RGPL  +W  E +  +      +   MCAYKL  V+FK+WG+QTK+E FI     R+     HRQ +CW D W GL++ DI
Sbjct:    1 MVLVKEFRVLLPCSVEEYQVGQLFSVAEASKNE-TGGGEGIEVLRNEPYEKEGGEKGQYTHKIYHVHSKVPNFVRLFAPEGSLVFHEKALFPTLINITSQVVTNEYMKDDFFVKIETWHKPDMGTQENVHGLDELTWKQVEVMHIDIGDRNQVLSSDYKTEEDPALFKSTKTSRGPLGPNWKAELENRE------DCPHMCAYKLVTVKFKWWGLQTKMESFIQK-QERRIFTNFHRQLFCWIDRWVGLTMEDI 246          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Yeast
Match: DDL1 (DDHD domain-containing phospholipase A1; mitochondrial matrix enzyme with sn-1-specific activity, hydrolyzing cardiolipin, PE, PC, PG and PA; implicated in remodeling of mitochondrial phospholipids; antagonistically regulated by Aft1p and Aft2p; in humans, mutations in DDHD1 and DDHD2 genes cause specific types of hereditary spastic paraplegia, while DDL1-defective yeast share similar phenotypes such as mitochondrial dysfunction and defects in lipid metabolism [Source:SGD;Acc:S000005548])

HSP 1 Score: 65.4698 bits (158), Expect = 3.408e-11
Identity = 67/306 (21.90%), Postives = 123/306 (40.20%), Query Frame = 2
Query: 1475 ILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQII 2392
            IL  + + LN  Y  F   E    FDG+V ++  ++GS+ +FDIL              S  +K  ++ +                                     V   F +GSP+GL++L + +TK      G   +  N+  + ++         RP C+ +YN++H+ DP SYR+EPL++        M        PH ++      + L     + ++ PG   N+  + +             + +++       R+DY +  P  ++   + A+    H SY+E  D AAFI+++I+
Sbjct:  469 ILQQVTSQLNKTYRIF--KEFNPEFDGKVHLVGHSLGSMILFDIL--------------SKQKKYELEFQ-------------------------------------VDNLFFIGSPIGLLKLIQ-RTK-----IGDRPEFPNDLERKLTVQ-------RPQCKDIYNVYHVCDPISYRMEPLVSKE------MAHYEQTYLPHCSEAYGLTSKVLEFGENIWKDLPGTDENNLQSKKTSPEKKEVKLSENLTRMLTGLNYTGRLDYAM-SPSLLEVDFISAIKS--HVSYFEEPDIAAFILKEIL 699          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Nematostella
Match: EDO41887 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S326])

HSP 1 Score: 452.981 bits (1164), Expect = 8.467e-139
Identity = 283/796 (35.55%), Postives = 430/796 (54.02%), Query Frame = 2
Query: 1157 SVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPS----LQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDIL-SKFRNDSRPSL--------------------TSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVI--ENAPGILLND------SSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGR--LPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNL 3439
            +  +LVVHGGS LD   +  +K+ D  +L+++F +VI + Y     +IA+RLVACPSI S  L +L++L P         S  S    +    P++AIPL V+ +  Y  I+  +  + N  Y EF+RS+EG  F G+V ++ D +G++  +D L   F  D   S+                     + + S +     + I  D+ H   D +SL  +     D            V +FF  GSP+GLV  +R                     K I  +E   +  RP+C   YNLFH  DPS+ RIEPLI  +F  I P+ +  +++FP G+  S  L   L  +P +   + +P +   D           HDSN+S    C      V++WWG KR+DY L+CP+G+Q FP   L  L H SYWES D AAF++RQ   +++ + E+  DIA+          + PS           +     +   +  + N+ +NHRAND++VL   PQ+L ARFMYG  DM++   EKVDIYIM  P S G +    + VT + GR+ + +++ +R+P G+YP++MV++ D + V  +LAV+P   EAVVFSIDGSF ASVSI GKDPKVRPG++DV R WQ+ G+L++Y+++RP+ Q+  V  WLA+H FP+G++ F DG++ +  + K + L  L KE  I +H AYG+ KD+ +Y S+GL  +QI+ +G+    +++K   F LK+GYA+HL  L    ++ S+ +   S + LRR CF +P +   +   L
Sbjct:  484 TTLLLVVHGGSQLDWGQDNQSKHVDCELLKESFQAVINAHYKGAVGRIAIRLVACPSICSKALNMLSQLCPYSETDSDTASCNSGFSPISSSFPISAIPLMVSSSPVYDDIVSAMIAATNIVYQEFLRSDEGHGFSGEVNLLGDCMGTLLAYDALCGTFFRDRSTSIPLNSSFSSNHSSNSLNGEHEQTLNASPRLERKPRRIKHDNKH-SFDAMSLSLDSIPDRDSTFDFP------VSKFFAFGSPIGLVLAYR---------------------KFIQGDEEKAAPPRPSCNQFYNLFHPFDPSASRIEPLILPQFSHIIPVNVPRYHKFPLGDGQSHQLHNVLGAHPELFLTQLSPRLTPRDVGNISRPGIKRHDSNMSTTSICST--DSVSAWWGTKRLDYALYCPEGLQQFPTAVLSPLFHVSYWESSDVAAFVVRQA--SNILHGEW--DIASA---------ASPSKRGLTFCPSQPREKWLKRRTAIKIK-NLNSNHRANDIVVLENSPQVLTARFMYGPLDMVSLSGEKVDIYIMVQPPS-GEYVLYDTVVTSSGGRLSYTLSDDKRLPVGIYPVKMVVRGDHTWVDNNLAVVPPKTEAVVFSIDGSFTASVSIRGKDPKVRPGAVDVVRHWQELGFLIVYVTSRPDFQKYKVMSWLAEHNFPYGLVAFGDGITHDLQRHKTEFLKNLSKEAHIVIHSAYGAVKDIGVYASIGLKPNQIYCVGKHHTRKYEKQAQF-LKEGYAAHLTAL----SSSSRAAIGNSRLILRRGCFGLPTRSTRSKHKL 1229          

HSP 2 Score: 317.39 bits (812), Expect = 2.929e-90
Identity = 146/249 (58.63%), Postives = 181/249 (72.69%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEYRI +P++V+EYRIAQLYMIQKKS+ ES G+GSGVEI+ N PY N  GG GQ+T KIYHIGSHLP W + ILPKSAL VEEEAWNAYPYTK R   P ++KF +++ET+Y  D G   NVFNL   ++  R +D++D + + ++S DY  EEDP IY S KT RGP+   W   Y+T      +    +MCAYKL +VEF+YWGMQ+KIE FI   GLR+ ML  HRQAW WQDEW+GL++ DI
Sbjct:    1 MLIKEYRIPLPMSVDEYRIAQLYMIQKKSRLESVGEGSGVEILENRPYMNKDGGSGQFTKKIYHIGSHLPGWLKAILPKSALRVEEEAWNAYPYTKMRTTCPFVEKFFVDVETHYLPDAGQTANVFNLTPAELNSREVDFIDPIAEVVASGDYLAEEDPLIYQSKKTGRGPMKADWLEAYQTD-----NPPTPVMCAYKLIKVEFRYWGMQSKIEHFIHS-GLRRPMLMGHRQAWVWQDEWYGLTMGDI 243          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Nematostella
Match: EDO43279 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ09])

HSP 1 Score: 198.749 bits (504), Expect = 3.994e-57
Identity = 105/261 (40.23%), Postives = 162/261 (62.07%), Query Frame = 2
Query:   41 IMLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIG---------QYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYK-VPIIDKFTLEIETYYFNDGGDQ-DNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            +++IKEYRI +P++VEEY+IAQLY + + SK+E TG G G+E++ NEPY  G GG G         QYT K+ H+ S +P++ R + P  +L V E+AWNAYP+ +T Y    + + F++ I+T++     D+  NV NL + ++++R I  +DIVND +   +Y+ +EDP    S K  RGPL   W  + +   S++ +    + C YKL RVEFK+WG+QTK+E  I    + + +   HRQ +CW D W G+++ DI
Sbjct:    1 MVVIKEYRIPLPISVEEYQIAQLYAVAEASKNE-TGGGEGIEVLVNEPYTAGEGGHGKNMPPGMDGQYTHKLIHLHSKVPSFVRMLAPSGSLEVHEKAWNAYPFCRTEYSNTYMKEHFSVIIDTWHKPGHKDEFHNVHNLGNPELQKREIVNIDIVNDKVDPHEYKADEDPSKVGSEKAKRGPLKKDWQQKNEEDPSKSKEGYPMMTC-YKLYRVEFKWWGLQTKVESIIMK-AVHRLLRNFHRQMFCWMDRWFGMTMDDI 258          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Nematostella
Match: EDO47917 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ2])

HSP 1 Score: 194.126 bits (492), Expect = 7.780e-56
Identity = 100/249 (40.16%), Postives = 151/249 (60.64%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            M++KEYRICMPL+V+EYR+ QLYMI + S D+S   G GV +++NE  E+   G GQ+T K  ++ S LP+W R+ +PK   IVE+ AWN YP+T T      + +F+++IET Y ND G  +N FNL+ E+++ R +  +DI  D +    Y  EED + + S+ T RGPL   W            D++  IMC+YKL  V F  WG+  ++E ++  + ++  +L  HRQA+ W D W+ + I D+
Sbjct:    1 MMLKEYRICMPLSVDEYRVGQLYMINRHSHDQSE-TGEGVHVVKNEACEDKEHGNGQFTEKRVYLSSRLPSWVRSYIPKIFYIVEK-AWNFYPFTITGI-CSFLPRFSIKIETRYLNDKGCTENCFNLSPEELESREVIPVDIAFDELPEKYYVAEEDCRTFKSAVTGRGPLEPGWR-----------DTSDPIMCSYKLVNVSFDVWGLSQRVEAYVHKV-VQDILLVGHRQAFAWIDLWYEMDINDV 234          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Nematostella
Match: EDO43322 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ10])

HSP 1 Score: 177.178 bits (448), Expect = 1.380e-49
Identity = 103/259 (39.77%), Postives = 148/259 (57.14%), Query Frame = 2
Query:   50 IKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIG-------QYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPII-DKFTLEIETYYFNDGGDQ-DNVFNLNDEDMKQRIIDYLDIVNDP--ISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRA-HRQAWCWQDEWHGLSITDI 790
            +KEYR+ +P++VE YRIAQLY + + S +E TG G G+E+++NEPY  G G  G       QYT KI H+ S +P W   + P+ AL V EEAWNAYPY KT Y  P + + F + I+T++      +  NV  LN+ ++ +R +  +DI  +   +   DY+++EDP +  S K N GPLT  W        S+       +M  YKL  V FK+  +QT +E  I     R  +LR  HRQ +CW D W+GL++ DI
Sbjct:    4 LKEYRVELPISVENYRIAQLYTVTEASMNE-TGGGEGIEVVKNEPYVEGKGEFGNDVTEPGQYTLKIMHLKSKVPQWIVKLAPEGALEVHEEAWNAYPYCKTVYTNPYMGENFHVIIKTWHKEGPSSRHSNVHELNESELAKREVIDIDIAAEKKLVGPHDYKEDEDPLLVRSEKANCGPLTPDW----NKGASDTTKDGYPMMTCYKLYDVRFKWCLLQTVVESEIGKAVYR--LLRNFHRQMFCWMDRWYGLTLDDI 255          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Nematostella
Match: EDO47918 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKJ5])

HSP 1 Score: 53.9138 bits (128), Expect = 4.037e-9
Identity = 22/61 (36.07%), Postives = 38/61 (62.30%), Query Frame = 2
Query:  608 DSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            D++  IMC+YKL  V F  WG+  ++E ++  + ++  +L  HRQA+ W D W+ + I D+
Sbjct:    2 DTSDPIMCSYKLVNVSFDVWGLSQRVEAYVHKV-VQDILLVGHRQAFAWIDLWYEMDINDV 61          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Medaka
Match: pitpnm3 (PITPNM family member 3 [Source:NCBI gene;Acc:101165164])

HSP 1 Score: 378.252 bits (970), Expect = 2.522e-114
Identity = 222/565 (39.29%), Postives = 316/565 (55.93%), Query Frame = 2
Query: 1796 VHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVI---ENAPGILLNDSSTSEHD--------------SNLSAFLKCVQVKQVVN-------SWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDA-SMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVK 3415
            V   F+LG P+GLV   R     +                      +  S  RP C  ++NLF+ +DPS+ R+EPL+   FH +PP  +  + R+P G+  +  + E++ ++  V    E + G      S                   +++ + +    + Q+ N       SWWG KR+DY L+CPD + +FP  ALPHL HASYWES D AAF++RQ++    ++ QE  N        L    FS  S  +K ++ ++           V  R N+TANHR NDV+     PQ L+ RFMYG  DM+T   EKVDI +M  P S G W    +EVT+N+GRV++ I+ S+++  GVYP++MV+K D +  + +L VLP  +E VVFSIDGSFAASVSI G DPKVRPG++DV R WQD GYL+IYI+ RP+MQ++ V  WL+QH FP GMI FS+G+  +PL+QK   L  L++E  IK++ AYGS KD+S+Y  LGL   QI+ +GR  +  +N    L +GYA+HL+ L        K S  +  V LR+  F +  K
Sbjct:  290 VSDCFLLGCPLGLVLAMRRTVLPA----------------------VQVSQLRPACSQIFNLFYPSDPSASRLEPLLQPLFHKLPPFAVPRYQRYPLGDGRTQLIAESIQSHQSVFLETERSHGTKAPQRSYETKSEGGREVGGGRSASMTSVESEMSVCSLSQLGNTIANISSSWWGSKRLDYALYCPDVLTSFPTVALPHLFHASYWESTDVAAFVLRQLMQCDCVKTQEGDN--------LDSAPFSPSSPREKWLRRRTH----------VKLR-NVTANHRVNDVIATEDGPQTLVGRFMYGPLDMVTLTGEKVDILVMTQPQS-GRWVHFDTEVTNNSGRVVYTISPSKKLGLGVYPVKMVVKGDQTSAEAYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYLIIYITGRPDMQKQRVVSWLSQHNFPHGMIFFSEGLVHDPLRQKTIFLRNLMQECHIKINSAYGSMKDISVYNMLGLSPSQIYIVGRPSKKYQNQCQFLSEGYAAHLSTLQFGHRARPKKSPSVRMV-LRKGSFGLSAK 811          

HSP 2 Score: 79.337 bits (194), Expect = 2.022e-14
Identity = 50/161 (31.06%), Postives = 86/161 (53.42%), Query Frame = 2
Query: 1160 VFILVVHGGSLLDT-NHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPS 1639
            V +L+VHGG++LDT   +   K  D+  L    + V ++ +      + ++LV CP++ S+  ++++ L P   D+  + SS     ++PLAA+PL    +  Y+  +  +    N  Y  F++SE+GQ F GQV ++ D +G +  FD L  F N  RP 
Sbjct:   36 VLLLMVHGGNILDTAGGDPSTKARDVATLASVLEKVTRAHFQAAAEHVMIKLVPCPAVCSEAFSLVSNLNPYSYDESCVSSSVD---HLPLAALPLLAIVSPRYQDAVATVIDRANQVYRSFLQSEDGQGFAGQVCLMGDCVGGVLCFDALC-FSNQPRPG 192          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Medaka
Match: pitpnm3 (PITPNM family member 3 [Source:NCBI gene;Acc:101165164])

HSP 1 Score: 379.022 bits (972), Expect = 1.058e-113
Identity = 222/565 (39.29%), Postives = 316/565 (55.93%), Query Frame = 2
Query: 1796 VHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVI---ENAPGILLNDSSTSEHD--------------SNLSAFLKCVQVKQVVN-------SWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDA-SMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVK 3415
            V   F+LG P+GLV   R     +                      +  S  RP C  ++NLF+ +DPS+ R+EPL+   FH +PP  +  + R+P G+  +  + E++ ++  V    E + G      S                   +++ + +    + Q+ N       SWWG KR+DY L+CPD + +FP  ALPHL HASYWES D AAF++RQ++    ++ QE  N        L    FS  S  +K ++ ++           V  R N+TANHR NDV+     PQ L+ RFMYG  DM+T   EKVDI +M  P S G W    +EVT+N+GRV++ I+ S+++  GVYP++MV+K D +  + +L VLP  +E VVFSIDGSFAASVSI G DPKVRPG++DV R WQD GYL+IYI+ RP+MQ++ V  WL+QH FP GMI FS+G+  +PL+QK   L  L++E  IK++ AYGS KD+S+Y  LGL   QI+ +GR  +  +N    L +GYA+HL+ L        K S  +  V LR+  F +  K
Sbjct:  369 VSDCFLLGCPLGLVLAMRRTVLPA----------------------VQVSQLRPACSQIFNLFYPSDPSASRLEPLLQPLFHKLPPFAVPRYQRYPLGDGRTQLIAESIQSHQSVFLETERSHGTKAPQRSYETKSEGGREVGGGRSASMTSVESEMSVCSLSQLGNTIANISSSWWGSKRLDYALYCPDVLTSFPTVALPHLFHASYWESTDVAAFVLRQLMQCDCVKTQEGDN--------LDSAPFSPSSPREKWLRRRTH----------VKLR-NVTANHRVNDVIATEDGPQTLVGRFMYGPLDMVTLTGEKVDILVMTQPQS-GRWVHFDTEVTNNSGRVVYTISPSKKLGLGVYPVKMVVKGDQTSAEAYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYLIIYITGRPDMQKQRVVSWLSQHNFPHGMIFFSEGLVHDPLRQKTIFLRNLMQECHIKINSAYGSMKDISVYNMLGLSPSQIYIVGRPSKKYQNQCQFLSEGYAAHLSTLQFGHRARPKKSPSVRMV-LRKGSFGLSAK 890          

HSP 2 Score: 79.337 bits (194), Expect = 1.793e-14
Identity = 45/161 (27.95%), Postives = 80/161 (49.69%), Query Frame = 2
Query: 1160 VFILVVHGGSLLDT-NHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPS 1639
            V +L+VHGG++LDT   +   K  D+  L    + V ++ +      + ++LV CP++ S+  ++++ L P   D+  + SS        L  + +    +  Y+  +  +    N  Y  F++SE+GQ F GQV ++ D +G +  FD L  F N  RP 
Sbjct:  110 VLLLMVHGGNILDTAGGDPSTKARDVATLASVLEKVTRAHFQAAAEHVMIKLVPCPAVCSEAFSLVSNLNPYSYDESCVSSSVDHLPLAALPLLAIV---SPRYQDAVATVIDRANQVYRSFLQSEDGQGFAGQVCLMGDCVGGVLCFDALC-FSNQPRPG 266          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Medaka
Match: pitpnm3 (PITPNM family member 3 [Source:NCBI gene;Acc:101165164])

HSP 1 Score: 378.637 bits (971), Expect = 1.317e-113
Identity = 222/565 (39.29%), Postives = 316/565 (55.93%), Query Frame = 2
Query: 1796 VHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVI---ENAPGILLNDSSTSEHD--------------SNLSAFLKCVQVKQVVN-------SWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDA-SMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVK 3415
            V   F+LG P+GLV   R     +                      +  S  RP C  ++NLF+ +DPS+ R+EPL+   FH +PP  +  + R+P G+  +  + E++ ++  V    E + G      S                   +++ + +    + Q+ N       SWWG KR+DY L+CPD + +FP  ALPHL HASYWES D AAF++RQ++    ++ QE  N        L    FS  S  +K ++ ++           V  R N+TANHR NDV+     PQ L+ RFMYG  DM+T   EKVDI +M  P S G W    +EVT+N+GRV++ I+ S+++  GVYP++MV+K D +  + +L VLP  +E VVFSIDGSFAASVSI G DPKVRPG++DV R WQD GYL+IYI+ RP+MQ++ V  WL+QH FP GMI FS+G+  +PL+QK   L  L++E  IK++ AYGS KD+S+Y  LGL   QI+ +GR  +  +N    L +GYA+HL+ L        K S  +  V LR+  F +  K
Sbjct:  366 VSDCFLLGCPLGLVLAMRRTVLPA----------------------VQVSQLRPACSQIFNLFYPSDPSASRLEPLLQPLFHKLPPFAVPRYQRYPLGDGRTQLIAESIQSHQSVFLETERSHGTKAPQRSYETKSEGGREVGGGRSASMTSVESEMSVCSLSQLGNTIANISSSWWGSKRLDYALYCPDVLTSFPTVALPHLFHASYWESTDVAAFVLRQLMQCDCVKTQEGDN--------LDSAPFSPSSPREKWLRRRTH----------VKLR-NVTANHRVNDVIATEDGPQTLVGRFMYGPLDMVTLTGEKVDILVMTQPQS-GRWVHFDTEVTNNSGRVVYTISPSKKLGLGVYPVKMVVKGDQTSAEAYLTVLPRGMECVVFSIDGSFAASVSIMGSDPKVRPGAVDVVRHWQDLGYLIIYITGRPDMQKQRVVSWLSQHNFPHGMIFFSEGLVHDPLRQKTIFLRNLMQECHIKINSAYGSMKDISVYNMLGLSPSQIYIVGRPSKKYQNQCQFLSEGYAAHLSTLQFGHRARPKKSPSVRMV-LRKGSFGLSAK 887          

HSP 2 Score: 79.337 bits (194), Expect = 2.000e-14
Identity = 45/161 (27.95%), Postives = 80/161 (49.69%), Query Frame = 2
Query: 1160 VFILVVHGGSLLDT-NHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPS 1639
            V +L+VHGG++LDT   +   K  D+  L    + V ++ +      + ++LV CP++ S+  ++++ L P   D+  + SS        L  + +    +  Y+  +  +    N  Y  F++SE+GQ F GQV ++ D +G +  FD L  F N  RP 
Sbjct:  107 VLLLMVHGGNILDTAGGDPSTKARDVATLASVLEKVTRAHFQAAAEHVMIKLVPCPAVCSEAFSLVSNLNPYSYDESCVSSSVDHLPLAALPLLAIV---SPRYQDAVATVIDRANQVYRSFLQSEDGQGFAGQVCLMGDCVGGVLCFDALC-FSNQPRPG 263          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Medaka
Match: PITPNM2 (membrane-associated phosphatidylinositol transfer protein 2 [Source:NCBI gene;Acc:101172908])

HSP 1 Score: 376.711 bits (966), Expect = 2.310e-110
Identity = 164/249 (65.86%), Postives = 203/249 (81.53%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEYRI MP++VEEYRIAQLYMIQKKS++E+ G+GSGVEI+ N+PY +GPGG GQYT K+YHIG H+P+WFR+ILPK+AL VEEE+WNAYPYT+TRY  P ++KF+++IETYY +D G+Q +VFNL+  D +QR ID +DIV DPI+  +Y+ EEDP+ Y S KT RGPL D W  EY      N      IMCAYKLC+VEF+YWGMQ+KIE+FI D+GLRK M+RAHRQAWCWQDEW+GL+I DI
Sbjct:    1 MLIKEYRIPMPMSVEEYRIAQLYMIQKKSREETCGEGSGVEILENKPYTDGPGGTGQYTHKVYHIGMHIPSWFRSILPKAALRVEEESWNAYPYTRTRYTCPFVEKFSIDIETYYKSDTGNQPDVFNLSAADKRQRTIDPIDIVTDPIAPHEYKAEEDPRFYKSVKTQRGPLRDDWIEEYN-----NNPGKTPIMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTIEDI 244          

HSP 2 Score: 363.229 bits (931), Expect = 1.248e-105
Identity = 204/538 (37.92%), Postives = 293/538 (54.46%), Query Frame = 2
Query: 1796 VHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCIS-NVTLRRSCFDI 3406
            V  FF+ GSP+GLV   R                  +T+  +    L  +  RP C+ +YNLFH  DPS+ R+EPL+  +FH +PP  +  + RFP G+ +S  L                                          V   WWG KR+D+ L+CPD + AFP  ALPHL HASYWES D  +F++RQ++          N    +++   ++ F+ PS           +     K   V  R N+TANHR ND +      QI+  RFMYG  DM+T   EKVD++IM  P S G W    +EVT+N+GRV F I E +R+  GVYPI+MV++ D +    +L V+P   E V FSIDGSFAASVSI G DPKVR G++DV R+WQD GYL+IY++ RP+MQ++ V  WL+QH FP G++ F DG+  +P  +      K + E Q+K++  YGSSKD+S+Y S+GL   QI+ +GR  +  ++    + +GYA+HL+ L  + +  S+P++  S  + LR+  F +
Sbjct:  729 VSDFFLFGSPLGLVLALR------------------KTVIPV----LDVAQLRPACQQVYNLFHPADPSASRLEPLLERKFHLLPPFNVPRYQRFPLGDGNSALL------------------------------------------VAGRWWGTKRLDFALYCPDALTAFPTVALPHLFHASYWESTDVVSFLLRQVM-------RHENSSILELDGKEVSEFT-PS---------KPREKWLRKRTHVKIR-NVTANHRVNDAVFTEDSQQIVTGRFMYGPLDMVTLAGEKVDLHIMTQPPS-GEWVYFCTEVTNNSGRVSFVIPEDKRLGIGVYPIKMVVRGDHTFADSYLTVIPRGTEFVAFSIDGSFAASVSIMGSDPKVRAGAVDVVRYWQDLGYLIIYVTGRPDMQKQRVVAWLSQHNFPHGIVSFCDGLVHDP-LRHKANFLKSLTEAQMKIYVGYGSSKDISVYTSIGLLPSQIYIVGRPTKKMQHQCQFITEGYAAHLSQL--EYSHRSRPAKSSSARMVLRKGSFGL 1180          

HSP 3 Score: 118.242 bits (295), Expect = 2.586e-26
Identity = 74/214 (34.58%), Postives = 117/214 (54.67%), Query Frame = 2
Query: 1109 LTLNMDPSTMTQSIQKS---VFILVVHGGSLLDTNHEYHN-KNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFR---NDSRPSLTSSSVSQKESVDMKS--INFDSSHRESDP 1723
            +T +   S++ Q +Q S   V ILV+HGG++LDT     N K  D+  +   FD+V++  YP    +IA+RLV CP+I ++  ++++ L+P   D+  L SS   Q ++PLAA+PL  T +  Y+  +  +    N  Y++FI+S +G  F GQV +I D +G I  FD L       N+S+ S    SV   +  D+ S  I  +S H  + P
Sbjct:  434 VTRHQSESSVQQCLQPSKTHVLILVLHGGNILDTGGGDQNSKQADVNTISTAFDTVMRVHYPAALGRIAIRLVPCPAICAEAFSLVSNLSPYSYDESCLCSS---QDHIPLAALPLLATSSPQYQDAVATVIVRANQVYADFIKSLDGAAFSGQVCLIGDCVGGILGFDALCNSNPTVNESQNSSRRGSVISVQDQDLLSPGIIVNSVHGSASP 644          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Medaka
Match: PITPNM2 (membrane-associated phosphatidylinositol transfer protein 2 [Source:NCBI gene;Acc:101172908])

HSP 1 Score: 377.481 bits (968), Expect = 2.515e-110
Identity = 164/249 (65.86%), Postives = 203/249 (81.53%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDI 790
            MLIKEYRI MP++VEEYRIAQLYMIQKKS++E+ G+GSGVEI+ N+PY +GPGG GQYT K+YHIG H+P+WFR+ILPK+AL VEEE+WNAYPYT+TRY  P ++KF+++IETYY +D G+Q +VFNL+  D +QR ID +DIV DPI+  +Y+ EEDP+ Y S KT RGPL D W  EY      N      IMCAYKLC+VEF+YWGMQ+KIE+FI D+GLRK M+RAHRQAWCWQDEW+GL+I DI
Sbjct:    1 MLIKEYRIPMPMSVEEYRIAQLYMIQKKSREETCGEGSGVEILENKPYTDGPGGTGQYTHKVYHIGMHIPSWFRSILPKAALRVEEESWNAYPYTRTRYTCPFVEKFSIDIETYYKSDTGNQPDVFNLSAADKRQRTIDPIDIVTDPIAPHEYKAEEDPRFYKSVKTQRGPLRDDWIEEYN-----NNPGKTPIMCAYKLCKVEFRYWGMQSKIERFIHDVGLRKVMVRAHRQAWCWQDEWYGLTIEDI 244          

HSP 2 Score: 353.984 bits (907), Expect = 4.304e-102
Identity = 215/594 (36.20%), Postives = 315/594 (53.03%), Query Frame = 2
Query: 1796 VHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAP-------GIL------------------LNDSSTSEHDSN------------LSAFLKCVQVK-------------------QVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCIS-NVTLRRSCFDI 3406
            V  FF+ GSP+GLV   R                  +T+  +    L  +  RP C+ +YNLFH  DPS+ R+EPL+  +FH +PP  +  + RFP G+ +S  L + + ++ GV  ++        G L                  + DS T+ + +N            L  FL   Q +                    +   WWG KR+D+ L+CPD + AFP  ALPHL HASYWES D  +F++RQ++          N    +++   ++ F+ PS           +     K   V  R N+TANHR ND +      QI+  RFMYG  DM+T   EKVD++IM  P S G W    +EVT+N+GRV F I E +R+  GVYPI+MV++ D +    +L V+P   E V FSIDGSFAASVSI G DPKVR G++DV R+WQD GYL+IY++ RP+MQ++ V  WL+QH FP G++ F DG+  +PL+ K   L  L      +++  YGSSKD+S+Y S+GL   QI+ +GR  +  ++    + +GYA+HL+ L  + +  S+P++  S  + LR+  F +
Sbjct:  702 VSDFFLFGSPLGLVLALR------------------KTVIPV----LDVAQLRPACQQVYNLFHPADPSASRLEPLLERKFHLLPPFNVPRYQRFPLGDGNSALLADVVQSHGGVFMDSSYPSSPVTGPLSRGQRRASEVSIASQVSGMADSYTATNIANSKCSEVQPVSHPLFLFLPLRQTQLDFTLLPLLLSVFSLFISYNIAGRWWGTKRLDFALYCPDALTAFPTVALPHLFHASYWESTDVVSFLLRQVM-------RHENSSILELDGKEVSEFT-PS---------KPREKWLRKRTHVKIR-NVTANHRVNDAVFTEDSQQIVTGRFMYGPLDMVTLAGEKVDLHIMTQPPS-GEWVYFCTEVTNNSGRVSFVIPEDKRLGIGVYPIKMVVRGDHTFADSYLTVIPRGTEFVAFSIDGSFAASVSIMGSDPKVRAGAVDVVRYWQDLGYLIIYVTGRPDMQKQRVVAWLSQHNFPHGIVSFCDGLVHDPLRHKANFLKSL-----TEIYVGYGSSKDISVYTSIGLLPSQIYIVGRPTKKMQHQCQFITEGYAAHLSQL--EYSHRSRPAKSSSARMVLRKGSFGL 1247          

HSP 3 Score: 117.857 bits (294), Expect = 3.967e-26
Identity = 73/207 (35.27%), Postives = 114/207 (55.07%), Query Frame = 2
Query: 1130 STMTQSIQKS---VFILVVHGGSLLDTNHEYHN-KNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFR---NDSRPSLTSSSVSQKESVDMKS--INFDSSHRESDP 1723
            S++ Q +Q S   V ILV+HGG++LDT     N K  D+  +   FD+V++  YP    +IA+RLV CP+I ++  ++++ L+P   D+  L SS   Q ++PLAA+PL  T +  Y+  +  +    N  Y++FI+S +G  F GQV +I D +G I  FD L       N+S+ S    SV   +  D+ S  I  +S H  + P
Sbjct:  414 SSVQQCLQPSKTHVLILVLHGGNILDTGGGDQNSKQADVNTISTAFDTVMRVHYPAALGRIAIRLVPCPAICAEAFSLVSNLSPYSYDESCLCSS---QDHIPLAALPLLATSSPQYQDAVATVIVRANQVYADFIKSLDGAAFSGQVCLIGDCVGGILGFDALCNSNPTVNESQNSSRRGSVISVQDQDLLSPGIIVNSVHGSASP 617          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Planmine SMEST
Match: SMESG000004877.1 (SMESG000004877.1)

HSP 1 Score: 2227.21 bits (5770), Expect = 0.000e+0
Identity = 1142/1142 (100.00%), Postives = 1142/1142 (100.00%), Query Frame = 2
Query:   44 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQESSELPIYLNQPTVSSFDVSINEAPFVMETTNDPLEQSNANNSVHKNMKYIQNHXXXXXXXXXXYDAKSDFPSETDSFMTCRNNFSSNLTLNMDPSTMTQSIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV 3469
            MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIRRLEEEAARELAEKMHTQESSELPIYLNQPTVSSFDVSINEAPFVMETTNDPLEQSNANNSVHKNMKYIQNHSFSDEDDESFYDAKSDFPSETDSFMTCRNNFSSNLTLNMDPSTMTQSIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCSSSDLFSSLKFKLDFNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDKNMKLKSKQSSLKFKAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV
Sbjct:    1 MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIRRLEEEAARELAEKMHTQESSELPIYLNQPTVSSFDVSINEAPFVMETTNDPLEQSNANNSVHKNMKYIQNHSFSDEDDESFYDAKSDFPSETDSFMTCRNNFSSNLTLNMDPSTMTQSIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCSSSDLFSSLKFKLDFNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDKNMKLKSKQSSLKFKAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV 1142          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Planmine SMEST
Match: SMESG000004877.1 (SMESG000004877.1)

HSP 1 Score: 2204.87 bits (5712), Expect = 0.000e+0
Identity = 1133/1133 (100.00%), Postives = 1133/1133 (100.00%), Query Frame = 2
Query:   71 MPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIXXXXXXXXXXXXXKMHTQESSELPIYLNQPTVSSFDVSINEAPFVMETTNDPLEQSNANNSVHKNMKYIQNHXXXXXXXXXXYDAKSDFPSETDSFMTCRNNFSSNLTLNMDPSTMTQSIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV 3469
            MPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIRRLEEEAARELAEKMHTQESSELPIYLNQPTVSSFDVSINEAPFVMETTNDPLEQSNANNSVHKNMKYIQNHSFSDEDDESFYDAKSDFPSETDSFMTCRNNFSSNLTLNMDPSTMTQSIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCSSSDLFSSLKFKLDFNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDKNMKLKSKQSSLKFKAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV
Sbjct:    1 MPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYENGPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYKVPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISSSDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKLCRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIRRLEEEAARELAEKMHTQESSELPIYLNQPTVSSFDVSINEAPFVMETTNDPLEQSNANNSVHKNMKYIQNHSFSDEDDESFYDAKSDFPSETDSFMTCRNNFSSNLTLNMDPSTMTQSIQKSVFILVVHGGSLLDTNHEYHNKNGDIGILRQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYLPSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQHFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCSSSDLFSSLKFKLDFNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDKNMKLKSKQSSLKFKAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV 1133          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Planmine SMEST
Match: SMESG000004877.1 (SMESG000004877.1)

HSP 1 Score: 1159.82 bits (2999), Expect = 0.000e+0
Identity = 607/615 (98.70%), Postives = 607/615 (98.70%), Query Frame = 2
Query: 1625 DSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV 3469
            DSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCSSSDLFSSLKFKLDFNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDKNMKLKSKQSSLKFK        NMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV
Sbjct:   64 DSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCSSSDLFSSLKFKLDFNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDKNMKLKSKQSSLKFK--------NMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV 670          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Planmine SMEST
Match: SMESG000004877.1 (SMESG000004877.1)

HSP 1 Score: 1156.35 bits (2990), Expect = 0.000e+0
Identity = 607/615 (98.70%), Postives = 607/615 (98.70%), Query Frame = 2
Query: 1625 DSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCXXXXXXXXXXXXXXXNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV 3469
            DSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCSSSDLFSSLKFKLDFNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDKNMKLKSKQSSLKFK        NMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV
Sbjct:   21 DSRPSLTSSSVSQKESVDMKSINFDSSHRESDPISLQSEQCSSSDLFSSLKFKLDFNVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDKNMKLKSKQSSLKFK--------NMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV 627          
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Planmine SMEST
Match: SMESG000004877.1 (SMESG000004877.1)

HSP 1 Score: 1110.13 bits (2870), Expect = 0.000e+0
Identity = 559/559 (100.00%), Postives = 559/559 (100.00%), Query Frame = 2
Query: 1793 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDXXXXXXXXXXXXXXXAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPXXXXXXXXXXXXXEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV 3469
            NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDKNMKLKSKQSSLKFKAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV
Sbjct:   62 NVHQFFMLGSPVGLVQLFRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLNDPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVIENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPDGVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADVESLHLNNFSEPSFIDKNMKLKSKQSSLKFKAMCVPYRINMTANHRANDVMVLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVTDNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVFSIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRHVQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGSSKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDNTLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV 620          
The following BLAST results are available for this feature:
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PITPNM31.775e-11638.86PITPNM family member 3 [Source:HGNC Symbol;Acc:HGN... [more]
PITPNM32.844e-11638.86PITPNM family member 3 [Source:HGNC Symbol;Acc:HGN... [more]
PITPNM14.813e-11237.41phosphatidylinositol transfer protein membrane ass... [more]
PITPNM14.813e-11237.41phosphatidylinositol transfer protein membrane ass... [more]
PITPNM17.941e-11237.41phosphatidylinositol transfer protein membrane ass... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pitp-11.292e-10764.66PhosphatidylInositol Transfer Protein family [Sou... [more]
Y54F10AR.18.352e-5639.92pep chromosome:WBcel235:III:2572031:2575723:-1 gen... [more]
Y71G12B.177.816e-3735.02pep chromosome:WBcel235:I:1667501:1669792:1 gene:W... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rdgB1.111e-14737.28gene:FBgn0003218 transcript:FBtr0073823[more]
rdgB1.111e-14737.28gene:FBgn0003218 transcript:FBtr0301533[more]
rdgB1.170e-14737.28gene:FBgn0003218 transcript:FBtr0073822[more]
rdgB1.170e-14737.28gene:FBgn0003218 transcript:FBtr0100194[more]
rdgB1.170e-14737.28gene:FBgn0003218 transcript:FBtr0100195[more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnm32.194e-11439.93PITPNM family member 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
plrdgb3.994e-10840.44PITP-less RdgB-like protein [Source:ZFIN;Acc:ZDB-G... [more]
PITPNM22.222e-10765.06phosphatidylinositol transfer protein membrane ass... [more]
pitpnaa1.517e-5943.82phosphatidylinositol transfer protein, alpha a [So... [more]
pitpnaa1.517e-5943.82phosphatidylinositol transfer protein, alpha a [So... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnm27.025e-14736.64phosphatidylinositol transfer protein membrane ass... [more]
pitpnm23.545e-14536.20phosphatidylinositol transfer protein membrane ass... [more]
pitpnm24.099e-14134.55phosphatidylinositol transfer protein membrane ass... [more]
PITPNM38.368e-11439.25PITPNM family member 3 [Source:NCBI gene;Acc:10049... [more]
PITPNM37.265e-11339.25PITPNM family member 3 [Source:NCBI gene;Acc:10049... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pitpnm39.113e-11739.22PITPNM family member 3 [Source:MGI Symbol;Acc:MGI:... [more]
Pitpnm39.773e-11738.86PITPNM family member 3 [Source:MGI Symbol;Acc:MGI:... [more]
Pitpnm19.287e-11562.65phosphatidylinositol transfer protein, membrane-as... [more]
Pitpnm19.287e-11562.65phosphatidylinositol transfer protein, membrane-as... [more]
Pitpnm17.638e-11337.81phosphatidylinositol transfer protein, membrane-as... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P43125|RDGB_DROME1.173e-14637.28Protein retinal degeneration B OS=Drosophila melan... [more]
sp|Q5U2N3|PITM1_RAT1.279e-13833.21Membrane-associated phosphatidylinositol transfer ... [more]
sp|Q3UHE1|PITM3_MOUSE6.375e-11639.22Membrane-associated phosphatidylinositol transfer ... [more]
sp|Q9BZ71|PITM3_HUMAN1.366e-11538.86Membrane-associated phosphatidylinositol transfer ... [more]
sp|O35954|PITM1_MOUSE5.342e-11237.81Membrane-associated phosphatidylinositol transfer ... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K4FA650.000e+040.05Uncharacterized protein OS=Schistosoma mansoni OX=... [more]
A0A4E0RI280.000e+039.83Membrane-associated phosphatidylinositol transfer ... [more]
A0A4S2M7P90.000e+040.21DDHD domain-containing protein OS=Opisthorchis fel... [more]
A0A4Z2DVR10.000e+039.50Membrane-associated phosphatidylinositol transfer ... [more]
A0A430QPI40.000e+040.05DDHD domain-containing protein (Fragment) OS=Schis... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PITPNM20.000e+040.81membrane-associated phosphatidylinositol transfer ... [more]
ENSAMXT00000009284.21.159e-13536.27pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
plrdgb2.727e-12433.37membrane-associated phosphatidylinositol transfer ... [more]
plrdgb1.673e-12233.05membrane-associated phosphatidylinositol transfer ... [more]
PITPNM25.567e-10938.35membrane-associated phosphatidylinositol transfer ... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnm33.486e-10343.65PITPNM family member 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
plrdgb4.828e-10238.48PITP-less RdgB-like protein [Source:ZFIN;Acc:ZDB-G... [more]
pitpnm31.366e-10143.72PITPNM family member 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ENSPMAT00000003232.11.338e-9159.82pep scaffold:Pmarinus_7.0:GL486150:7644:10272:1 ge... [more]
ENSPMAT00000004160.18.274e-5640.94pep scaffold:Pmarinus_7.0:GL481899:12693:18585:1 g... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
DDL13.408e-1121.90DDHD domain-containing phospholipase A1; mitochond... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO418878.467e-13935.55Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO432793.994e-5740.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479177.780e-5640.16Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433221.380e-4939.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO479184.037e-936.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pitpnm32.522e-11439.29PITPNM family member 3 [Source:NCBI gene;Acc:10116... [more]
pitpnm31.058e-11339.29PITPNM family member 3 [Source:NCBI gene;Acc:10116... [more]
pitpnm31.317e-11339.29PITPNM family member 3 [Source:NCBI gene;Acc:10116... [more]
PITPNM22.310e-11065.86membrane-associated phosphatidylinositol transfer ... [more]
PITPNM22.515e-11065.86membrane-associated phosphatidylinositol transfer ... [more]
back to top
BLAST of Membrane-associated phosphatidylinositol transfer protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000004877.10.000e+0100.00SMESG000004877.1[more]
SMESG000004877.10.000e+0100.00SMESG000004877.1[more]
SMESG000004877.10.000e+098.70SMESG000004877.1[more]
SMESG000004877.10.000e+098.70SMESG000004877.1[more]
SMESG000004877.10.000e+0100.00SMESG000004877.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023840 ID=SMED30023840|Name=Membrane-associated phosphatidylinositol transfer protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=3653bp
TCTATATAAATCTTATATGAAACTCGTTTGATTTGATTTAATTATGTTAA
TAAAAGAATATCGAATATGTATGCCATTAACTGTAGAAGAATATCGTATA
GCTCAATTATACATGATACAGAAAAAGTCGAAAGATGAAAGTACCGGACA
AGGTAGTGGAGTTGAAATAATAAGAAATGAACCATATGAAAATGGTCCGG
GTGGGATTGGACAATATACTTTTAAAATTTATCACATTGGTAGCCATTTA
CCAACATGGTTCAGAAATATTTTACCAAAATCTGCTTTAATAGTCGAAGA
AGAAGCTTGGAATGCTTATCCTTATACAAAAACAAGATACAAAGTTCCAA
TTATTGACAAATTTACTTTAGAAATAGAGACATATTATTTTAATGACGGT
GGAGATCAAGATAATGTTTTTAATCTAAACGATGAAGACATGAAGCAACG
AATTATAGACTACCTTGACATAGTAAATGATCCGATATCGTCGAGTGATT
ATCGAAAAGAGGAAGACCCAAAAATCTATGTATCTTCCAAAACGAATCGT
GGACCACTTACTGACAGTTGGGCCACTGAATATAAAACTGCTCAATCGGA
AAACATGGACTCTAATATGCGAATCATGTGTGCCTATAAACTCTGTCGGG
TGGAGTTCAAATATTGGGGGATGCAGACAAAAATTGAAAAGTTTATTGAT
GATATTGGATTAAGGAAAACCATGTTGCGTGCACATAGACAGGCCTGGTG
TTGGCAAGATGAATGGCATGGCTTATCCATTACCGATATCCGACGATTGG
AAGAGGAAGCTGCTAGAGAGTTAGCAGAAAAAATGCATACGCAGGAATCA
TCTGAACTACCAATTTATTTAAACCAGCCAACTGTATCAAGTTTTGATGT
ATCTATTAATGAAGCTCCATTCGTAATGGAAACAACCAATGATCCACTAG
AACAAAGCAATGCAAATAACTCAGTTCACAAAAATATGAAATATATTCAA
AATCACTCCTTTTCTGACGAAGACGACGAAAGCTTTTACGACGCCAAAAG
TGATTTTCCATCAGAAACAGATTCTTTCATGACTTGTCGAAACAATTTTT
CTAGTAATTTGACATTGAATATGGACCCTTCTACAATGACACAATCAATT
CAAAAATCTGTTTTCATTCTCGTAGTACATGGAGGAAGTTTGTTGGACAC
GAATCATGAATATCATAACAAGAATGGGGACATTGGGATTTTAAGGCAAA
CTTTTGATTCAGTCATTAAATCATCATATCCTCATTTGAATAACCAAATA
GCAATGAGACTCGTTGCTTGTCCATCTATTGTTTCAGACCTGTTAACAAT
TTTGAACAAATTAACTCCTCAAATCATCGACCAGCAATATCTTCCAAGTT
CTCCGTCTTTGCAATATTATGTTCCCTTAGCTGCTATTCCGCTTTTCGTT
ACTGAAGCATCAAATTATAAAAAAATCTTAGACGACATTAAAACTTCTCT
AAATGACCGTTATTCTGAATTCATACGCAGCGAAGAAGGGCAACATTTTG
ATGGCCAAGTCATCATAATTGCTGATGCCATCGGTTCAATTGCTGTCTTT
GATATTCTGTCCAAATTTCGAAATGACTCAAGACCGTCCTTGACATCAAG
TTCGGTTAGTCAAAAGGAATCTGTAGATATGAAATCTATTAATTTTGATA
GCTCTCATCGAGAAAGTGATCCTATTTCTCTGCAATCTGAACAGTGTTCT
TCGTCGGATTTATTCTCATCACTAAAATTTAAATTAGACTTCAATGTCCA
CCAATTTTTCATGCTTGGTTCACCAGTTGGTCTTGTTCAATTGTTTCGTA
ATCAGACTAAGAAATCTGAGGCTTGGTGTGGAACTTTGAAAGATTTGACC
AATGAAACGATTAAAAATATTTCTAATAATGAATTGAGTGAAAGTAATTT
CCGCCCTAACTGCAGGCATTTATATAATTTATTCCATTTGAACGATCCGT
CTTCATATCGGATTGAACCATTAATTAATGACAGATTCCATGCGATCCCA
CCTATGAAAATTTCTAACTTTAACCGTTTTCCACATGGCAATGACGATTC
GACTTATCTTATTGAAACTCTTTTCAACAACCCTGGCGTGATAGAAAATG
CTCCCGGTATCCTGTTGAATGATTCTAGCACTTCTGAACATGATTCCAAT
TTATCTGCATTTTTGAAATGTGTTCAAGTTAAGCAAGTTGTGAATTCATG
GTGGGGTGAAAAGCGGATTGACTACGGTTTGCATTGTCCAGATGGAGTTC
AGGCTTTTCCACTTGGTGCATTGCCTCATTTGTTACATGCCAGTTATTGG
GAGTCTAAAGACTGTGCTGCTTTTATTATTCGACAAATCATCGATGCATC
AATGCAGAATCAAGAATTCGCAAACGACATTGCTGCAGATGTTGAATCTC
TTCATCTCAACAATTTCTCAGAACCATCGTTCATAGACAAAAACATGAAA
TTAAAATCTAAACAATCTTCTTTAAAATTTAAGGCAATGTGCGTACCATA
TCGAATAAATATGACTGCTAATCACCGTGCCAATGATGTAATGGTGCTTT
CTGGTCAACCACAAATTCTATTGGCAAGATTTATGTATGGAACATTTGAT
ATGCTAACTCCAAAAAACGAAAAAGTTGATATTTATATCATGAACTTGCC
AATCAGCCATGGGCACTGGGAGAAAGAAGGCAGCGAAGTTACAGATAACA
ATGGCCGAGTTATTTTTCACATCGCAGAATCAAGGAGAATGCCTGAAGGT
GTTTACCCGATAAGGATGGTACTTAAAGCTGATTCGTCTGTTGTTCAGTT
TCATTTGGCTGTTCTTCCTCTAAATGTTGAAGCAGTTGTGTTTAGTATTG
ATGGAAGTTTTGCAGCCAGTGTATCCATTTCGGGCAAAGATCCAAAGGTT
CGTCCTGGAAGTATTGACGTGGCAAGATTTTGGCAAGACAAAGGCTATCT
TTTGATATACATTTCAGCGAGACCGAACATGCAACAAAGACATGTCCAGC
GTTGGCTTGCTCAGCATAAGTTTCCATTCGGAATGATTCTATTCAGTGAT
GGCGTGTCGGCAGAACCACTGAAGCAAAAATTACAAATTCTCTCTAAATT
GATAAAAGAAGTTCAAATTAAAGTCCACTGTGCTTATGGCTCATCTAAGG
ACGTTTCCATTTATCGCTCCTTGGGGCTGCATTCCCATCAGATATTTACT
CTTGGACGGCTGCCTAGGCACAAGAAGAATAATAGTTTTCCTTTAAAAGA
CGGGTACGCTTCCCACCTGAATGATTTGCTGAGAAAAGACAACACATTGT
CTAAACCGTCACGCTGTATATCAAATGTCACGCTTCGCAGATCATGTTTT
GATATTCCTGTGAAATATATATCCAATAGTAAGAACCTTGATAATGACAG
TGAACATAGCTATATTGTTTAATATTTATCATATTTTATAATGCTTTTCC
TCTGTGACCACTTTATTTGTTTGTCTGTGTTTCCTATCTAAACTTTGATC
CACCATTTTATGATTAGTAGAAGCATTTATTACACTAGATTTATTATGTA
TTTGTGGTAATTCTGCAATTGTTTATTATAAATATATGATCAACGCTTTT
CAA
back to top

protein sequence of SMED30023840-orf-1

>SMED30023840-orf-1 ID=SMED30023840-orf-1|Name=SMED30023840-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1143bp
MLIKEYRICMPLTVEEYRIAQLYMIQKKSKDESTGQGSGVEIIRNEPYEN
GPGGIGQYTFKIYHIGSHLPTWFRNILPKSALIVEEEAWNAYPYTKTRYK
VPIIDKFTLEIETYYFNDGGDQDNVFNLNDEDMKQRIIDYLDIVNDPISS
SDYRKEEDPKIYVSSKTNRGPLTDSWATEYKTAQSENMDSNMRIMCAYKL
CRVEFKYWGMQTKIEKFIDDIGLRKTMLRAHRQAWCWQDEWHGLSITDIR
RLEEEAARELAEKMHTQESSELPIYLNQPTVSSFDVSINEAPFVMETTND
PLEQSNANNSVHKNMKYIQNHSFSDEDDESFYDAKSDFPSETDSFMTCRN
NFSSNLTLNMDPSTMTQSIQKSVFILVVHGGSLLDTNHEYHNKNGDIGIL
RQTFDSVIKSSYPHLNNQIAMRLVACPSIVSDLLTILNKLTPQIIDQQYL
PSSPSLQYYVPLAAIPLFVTEASNYKKILDDIKTSLNDRYSEFIRSEEGQ
HFDGQVIIIADAIGSIAVFDILSKFRNDSRPSLTSSSVSQKESVDMKSIN
FDSSHRESDPISLQSEQCSSSDLFSSLKFKLDFNVHQFFMLGSPVGLVQL
FRNQTKKSEAWCGTLKDLTNETIKNISNNELSESNFRPNCRHLYNLFHLN
DPSSYRIEPLINDRFHAIPPMKISNFNRFPHGNDDSTYLIETLFNNPGVI
ENAPGILLNDSSTSEHDSNLSAFLKCVQVKQVVNSWWGEKRIDYGLHCPD
GVQAFPLGALPHLLHASYWESKDCAAFIIRQIIDASMQNQEFANDIAADV
ESLHLNNFSEPSFIDKNMKLKSKQSSLKFKAMCVPYRINMTANHRANDVM
VLSGQPQILLARFMYGTFDMLTPKNEKVDIYIMNLPISHGHWEKEGSEVT
DNNGRVIFHIAESRRMPEGVYPIRMVLKADSSVVQFHLAVLPLNVEAVVF
SIDGSFAASVSISGKDPKVRPGSIDVARFWQDKGYLLIYISARPNMQQRH
VQRWLAQHKFPFGMILFSDGVSAEPLKQKLQILSKLIKEVQIKVHCAYGS
SKDVSIYRSLGLHSHQIFTLGRLPRHKKNNSFPLKDGYASHLNDLLRKDN
TLSKPSRCISNVTLRRSCFDIPVKYISNSKNLDNDSEHSYIV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005548phospholipid transporter activity
GO:0046872metal ion binding
Vocabulary: biological process
TermDefinition
GO:0015914phospholipid transport
GO:0006810transport
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0002075pigment cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR001666PI_transfer
IPR031315LNS2/PITP
IPR004177DDHD_dom
IPR023393START-like_dom_sf
IPR023214HAD_sf
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular