Phosphatase 1 regulatory subunit 37-like protein

Overview
NamePhosphatase 1 regulatory subunit 37-like protein
Smed IDSMED30023831
Length (bp)2507
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Phosphatase 1 regulatory subunit 37-like protein (SMED30023831) t-SNE clustered cells

Violin plots show distribution of expression levels for Phosphatase 1 regulatory subunit 37-like protein (SMED30023831) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Phosphatase 1 regulatory subunit 37-like protein (SMED30023831) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Phosphatase 1 regulatory subunit 37-like protein (SMED30023831) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023831

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023831SMESG000078284.1 PL08008B2E06ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30023831SMESG000078284.1 dd_Smed_v4_5089_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
anterior region of the whole animalSMED30023831SMESG000078284.1 dd_Smed_v4_5089_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
headSMED30023831SMESG000078284.1 dd_Smed_v4_5089_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023831SMESG000078284.1 dd_Smed_v4_5089_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Human
Match: PPP1R37 (protein phosphatase 1 regulatory subunit 37 [Source:HGNC Symbol;Acc:HGNC:27607])

HSP 1 Score: 338.576 bits (867), Expect = 2.324e-104
Identity = 187/429 (43.59%), Postives = 291/429 (67.83%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            +  K+V FP +++IVS   E K+ W   +  + DE+I +YK+AC+  N + IP LL QL+     L H R D L+L   KLD K  E +EE+FKR+QFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  + L++L +ALK+N+++REL+LA N++    D  QLG+LLK N  +++LD+RNN + D GL++IC+GL EQ              GL+ L+LW+N +T+ GM  L   L   +S+++LNLG+NPI +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S ++KVN S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:   41 AAAKRVTFPSDEDIVSGAVEPKDPWRHAQNVTVDEVIGAYKQACQKLNCRQIPKLLRQLQEF-TDLGH-RLDCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLENASLSGRPLMLLATALKMNMNLRELYLADNKLNGLQDSAQLGNLLKFNCSLQILDLRNNHVLDSGLAYICEGLKEQR------------KGLVTLVLWNNQLTHTGMAFLGMTLPHTQSLETLNLGHNPIGNEGVRHLKNGLISNRSVLRLGLASTKLTCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNHSLLRLDLDREPKKE-AVKSFIETQKALLAEIQNGCKRN 454          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Human
Match: PPP1R37 (protein phosphatase 1 regulatory subunit 37 [Source:HGNC Symbol;Acc:HGNC:27607])

HSP 1 Score: 109.383 bits (272), Expect = 1.161e-26
Identity = 49/117 (41.88%), Postives = 81/117 (69.23%), Query Frame = 3
Query:  447 KLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSK 797
            KLD K  E +EE+FKR+QFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  +
Sbjct:   70 KLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLENASLSGR 186          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 79.7221 bits (195), Expect = 1.403e-14
Identity = 99/377 (26.26%), Postives = 164/377 (43.50%), Query Frame = 3
Query:  426 MLNLSNVKLDLKQIE--CMEEIFKRVQFKNLNFENTSL-----DDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLC--EQFLPQPIKEDENHGPG------LLC-------LILWSNSITYNGMPALSDALK----------------------------VNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
            +L    ++LD  Q +   ME +   +  K+   +  SL      ++ + +L   +    S + L++  NS I   G  A +  LK    L  + L+G    +     +  AL     L +LHL+ ++I       +  ALK N  ++EL  +SN +       L   LKVN+ +E LD+++NS+ D G++ +   LC  +  L   ++E+     G       LC       L L +N +   G  A++ A++                            +NRS+ SL+L  N I  +G   +   L VN +L  L L    I   G   + E LA  + L  LDLR N I  AG  A+++++KVN S+ RL+L +
Sbjct:  636 LLYCRKLRLDTNQFQDPVMELLGSVLSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNS-IGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQE 1011          

HSP 2 Score: 70.8626 bits (172), Expect = 9.428e-12
Identity = 66/256 (25.78%), Postives = 108/256 (42.19%), Query Frame = 3
Query:  726 LNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            L R+L    +L  L L  ++I  +    L  ALK+N  +  L L  N +       +   L  NR + +L ++ NS+G +G   + D L +    + +KE          L+  SNSI   G  AL++ALKVN+ ++SL+L +N I   G+                             A+   L   + L+ L LR+N I   G  AI+H++  N ++  LDL      D   +      +E+  +    +Q N
Sbjct:  686 LARSLLVNRSLTSLDLRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQN---RSLKE----------LMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGV----------------------------AALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWN 900          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 79.7221 bits (195), Expect = 1.492e-14
Identity = 99/377 (26.26%), Postives = 164/377 (43.50%), Query Frame = 3
Query:  426 MLNLSNVKLDLKQIE--CMEEIFKRVQFKNLNFENTSL-----DDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLC--EQFLPQPIKEDENHGPG------LLC-------LILWSNSITYNGMPALSDALK----------------------------VNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
            +L    ++LD  Q +   ME +   +  K+   +  SL      ++ + +L   +    S + L++  NS I   G  A +  LK    L  + L+G    +     +  AL     L +LHL+ ++I       +  ALK N  ++EL  +SN +       L   LKVN+ +E LD+++NS+ D G++ +   LC  +  L   ++E+     G       LC       L L +N +   G  A++ A++                            +NRS+ SL+L  N I  +G   +   L VN +L  L L    I   G   + E LA  + L  LDLR N I  AG  A+++++KVN S+ RL+L +
Sbjct:  683 LLYCRKLRLDTNQFQDPVMELLGSVLSGKDCRIQKISLAENQISNKGAKALARSLLVNRSLTSLDLRGNS-IGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLTANLLHDQGARAIAVAVRENRTLTSLHLQWNFIQAGAAQALGQALQLNRSLTSLDLQENAIGDDGACAVARALKVNTALTALYLQVASIGASGAQVLGEALAVNRTLEILDLRGNAIGVAGAKALANALKVNSSLRRLNLQE 1058          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Human
Match: NLRC3 (NLR family CARD domain containing 3 [Source:HGNC Symbol;Acc:HGNC:29889])

HSP 1 Score: 67.781 bits (164), Expect = 3.177e-12
Identity = 57/210 (27.14%), Postives = 92/210 (43.81%), Query Frame = 3
Query:  771 LENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDL 1400
            L  ++I  +    L  ALK+N  +  L L  N +       +   L  NR + +L ++ NS+G +G   + D L +    + +KE          L+  SNSI   G  AL++ALKVN+ ++SL+L +N I   G+                             A+   L   + L+ L LR+N I   G  AI+H++  N ++  LDL
Sbjct:    2 LRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQN---RSLKE----------LMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGV----------------------------AALMGALCTNQTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDL 170          

HSP 2 Score: 64.3142 bits (155), Expect = 4.773e-11
Identity = 52/178 (29.21%), Postives = 83/178 (46.63%), Query Frame = 3
Query:  630 GFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPI 1163
            G  A +  LK    L  + L+G    +     +  AL     L +LHL+ ++I       +  ALK N  ++EL  +SN +       L   LKVN+ +E LD+++NS+ D G++ +   LC                 LL L L  NSI+  G  A++ AL  N ++++L+L  N I
Sbjct:   11 GAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGVAALMGALCTN-------------QTLLSLSLRENSISPEGAQAIAHALCANSTLKNLDLQWNFI 175          

HSP 3 Score: 53.5286 bits (127), Expect = 2.530e-7
Identity = 43/123 (34.96%), Postives = 62/123 (50.41%), Query Frame = 3
Query: 1062 LWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNV 1430
            L  NSI   G  AL+DALK+NR++ SL+L  N +  +G   + + L  NR+L  L L    I   G   +A+ L   + L  L    N I   G  A++ ++KVN+ +  LDL   S  D  V
Sbjct:    2 LRGNSIGPQGAKALADALKINRTLTSLSLQGNTVRDDGARSMAEALASNRTLSMLHLQKNSIGPMGAQRMADALKQNRSLKELMFSSNSIGDGGAKALAEALKVNQGLESLDLQSNSISDAGV 124          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 263.848 bits (673), Expect = 3.916e-75
Identity = 160/443 (36.12%), Postives = 252/443 (56.88%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFES-----KNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRC--GSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ--VSKRDPNVKGYTETQQESLRIIQERVQENKKAVIR 1511
            S  + V FP + ++++ Y E+      +Y    +   S E++ +Y++AC+     P   + +Q+ G   K    R ++L+L   ++   Q+E +EEIFKRVQF  ++FE T LDD+ + SL E+IEFY+SC +LN+SFN +I   G+    + ++    L+ + L+     + +IP L +  R    ++L  LHLEN+ +  KNLL+L  ALK N  +REL+L  N + P+DG  +  L+  N  ++LLD+RNNS+GD G+ HICDGL  +        +      L  ++LW+N++T   M +L++AL  N  I++LN+GNN +  EGI  L+  L  N  L RL L    I CEG + +AE +AD   L+R+D+RDN I  AGL+A+  +MK+N SI  L++D   V      V+ Y +  +   R IQ     NK  V++
Sbjct:   75 SHARTVSFPADMDLITGYHEAPSSLFHSYHDSQRVIDSSEILTAYREACQRRQCAPSAAVEKQI-GYFHKSPDTRQELLSLKGERVSHAQMEALEEIFKRVQFNTIDFEYTFLDDDCAISLGEMIEFYDSCVRLNLSFNKQIDMRGWTTIFRSIRHAVSLQMLNLRYTNLNDRSIPALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHR--------EAVEKSSLSAMVLWNNNVTGASMDSLAEALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGLQNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLNIDASCVKLSSEKVREYQDEFERYFREIQTYCDRNKDDVLK 508          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 263.462 bits (672), Expect = 4.417e-75
Identity = 160/443 (36.12%), Postives = 252/443 (56.88%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFES-----KNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRC--GSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ--VSKRDPNVKGYTETQQESLRIIQERVQENKKAVIR 1511
            S  + V FP + ++++ Y E+      +Y    +   S E++ +Y++AC+     P   + +Q+ G   K    R ++L+L   ++   Q+E +EEIFKRVQF  ++FE T LDD+ + SL E+IEFY+SC +LN+SFN +I   G+    + ++    L+ + L+     + +IP L +  R    ++L  LHLEN+ +  KNLL+L  ALK N  +REL+L  N + P+DG  +  L+  N  ++LLD+RNNS+GD G+ HICDGL  +        +      L  ++LW+N++T   M +L++AL  N  I++LN+GNN +  EGI  L+  L  N  L RL L    I CEG + +AE +AD   L+R+D+RDN I  AGL+A+  +MK+N SI  L++D   V      V+ Y +  +   R IQ     NK  V++
Sbjct:   75 SHARTVSFPADMDLITGYHEAPSSLFHSYHDSQRVIDSSEILTAYREACQRRQCAPSAAVEKQI-GYFHKSPDTRQELLSLKGERVSHAQMEALEEIFKRVQFNTIDFEYTFLDDDCAISLGEMIEFYDSCVRLNLSFNKQIDMRGWTTIFRSIRHAVSLQMLNLRYTNLNDRSIPALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHR--------EAVEKSSLSAMVLWNNNVTGASMDSLAEALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGLQNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLNIDASCVKLSSEKVREYQDEFERYFREIQTYCDRNKDDVLK 508          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 259.225 bits (661), Expect = 1.256e-73
Identity = 151/405 (37.28%), Postives = 238/405 (58.77%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKN-----YWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRC--GSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLD 1403
            S  + V FP + ++++ Y E+ +     Y    +   S E++ +Y++AC+     P   + +Q+ G   K    R ++L+L   ++   Q+E +EEIFKRVQF  ++FE T LDD+ + SL E+IEFY+SC +LN+SFN +I   G+    + ++    L+ + L+     + +IP L +  R    ++L  LHLEN+ +  KNLL+L  ALK N  +REL+L  N + P+DG  +  L+  N  ++LLD+RNNS+GD G+ HICDGL  +        +      L  ++LW+N++T   M +L++AL  N  I++LN+GNN +  EGI  L+  L  N  L RL L    I CEG + +AE +AD   L+R+D+RDN I  AGL+A+  +MK+N SI  L++D
Sbjct:   75 SHARTVSFPADMDLITGYHEAPSSLFHSYHDSQRVIDSSEILTAYREACQRRQCAPSAAVEKQI-GYFHKSPDTRQELLSLKGERVSHAQMEALEEIFKRVQFNTIDFEYTFLDDDCAISLGEMIEFYDSCVRLNLSFNKQIDMRGWTTIFRSIRHAVSLQMLNLRYTNLNDRSIPALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHR--------EAVEKSSLSAMVLWNNNVTGASMDSLAEALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGLQNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLNID 470          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Celegans
Match: F28C1.3 (Protein phosphatase 1 regulatory subunit 37 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q19857])

HSP 1 Score: 259.225 bits (661), Expect = 1.706e-73
Identity = 151/405 (37.28%), Postives = 238/405 (58.77%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKN-----YWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRC--GSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLD 1403
            S  + V FP + ++++ Y E+ +     Y    +   S E++ +Y++AC+     P   + +Q+ G   K    R ++L+L   ++   Q+E +EEIFKRVQF  ++FE T LDD+ + SL E+IEFY+SC +LN+SFN +I   G+    + ++    L+ + L+     + +IP L +  R    ++L  LHLEN+ +  KNLL+L  ALK N  +REL+L  N + P+DG  +  L+  N  ++LLD+RNNS+GD G+ HICDGL  +        +      L  ++LW+N++T   M +L++AL  N  I++LN+GNN +  EGI  L+  L  N  L RL L    I CEG + +AE +AD   L+R+D+RDN I  AGL+A+  +MK+N SI  L++D
Sbjct:   75 SHARTVSFPADMDLITGYHEAPSSLFHSYHDSQRVIDSSEILTAYREACQRRQCAPSAAVEKQI-GYFHKSPDTRQELLSLKGERVSHAQMEALEEIFKRVQFNTIDFEYTFLDDDCAISLGEMIEFYDSCVRLNLSFNKQIDMRGWTTIFRSIRHAVSLQMLNLRYTNLNDRSIPALCKMARAQPSASLTCLHLENTQMSGKNLLVLICALKNNTGLRELYLGDNGLQPTDGSHIYQLITSNSSLQLLDLRNNSIGDSGVRHICDGLRHR--------EAVEKSSLSAMVLWNNNVTGASMDSLAEALIENTKIETLNIGNNNLGVEGIARLKPALASNSHLHRLGLQNTGINCEGAIILAECIADNIALLRVDIRDNPIALAGLLALHSAMKMNTSITLLNID 470          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Fly
Match: CG31635 (gene:FBgn0051635 transcript:FBtr0079326)

HSP 1 Score: 122.094 bits (305), Expect = 6.948e-28
Identity = 75/263 (28.52%), Postives = 146/263 (55.51%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTE-HKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFN-SKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQ 1001
            ++V FP+  ++V+ Y E  N W + +   SS E++  Y+++C+  N +P+  +++ L+ +D  L   R  +L L   +L     E +EEIFKR+Q+  ++    +LD+ S  +LF++IE+YE+ ++L+IS+N +++    +  C+ M++++  L+ +  +    T+     L RAL   SNL  L LE+  +    L+ L   L  N  ++EL +  N +   D   +  +L+ N  +EL+D+ NN++ + G+ ++   L  Q
Sbjct:  210 RRVSFPD-NQLVTGYLEPANPWKQVYLVKSSSEIVDQYQQSCKKHNTQPLESVVDHLRTLD--LNQARQPLLPLKAKELTANDCEALEEIFKRIQYTCIDLSECTLDESSLMALFQMIEYYEAANELDISYNKAEMTKRCWELCAYMVERSQELQLLNAESNPITKLGADSLGRALG-SSNLHTLKLEHCGLRGAPLVNLCRGLYQNKRLKELWVGYNDLDCVDAQHIADMLRYNHSLELIDISNNNIRNEGVMYLVQALILQ 468          

HSP 2 Score: 55.8398 bits (133), Expect = 1.827e-7
Identity = 41/147 (27.89%), Postives = 78/147 (53.06%), Query Frame = 3
Query:  984 DGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYL--ADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKR 1418
            D L  + L +   E      GL  L LW+N+++ +  PA+++ L+   S++ LN+G N + ++ +  ++D L  N +L  L L    +  +G   +A  L      +L R+D+RDN ++   L  I+  +K NK++ ++D++   KR
Sbjct:  979 DTLSRRQLAEATLEANRSPSGLKALTLWNNNLSKDCAPAVAELLQKTISLELLNIGKNCLSNDFVSTIKDSLTKNTTLTTLGLQSAHLNAKGIETLASILTFGGNSKLQRIDIRDNKLEVESLNIIAEVLKSNKTLTQIDINDEPKR 1125          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Fly
Match: CG31635 (gene:FBgn0051635 transcript:FBtr0113410)

HSP 1 Score: 122.094 bits (305), Expect = 7.568e-28
Identity = 75/263 (28.52%), Postives = 146/263 (55.51%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTE-HKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFN-SKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQ 1001
            ++V FP+  ++V+ Y E  N W + +   SS E++  Y+++C+  N +P+  +++ L+ +D  L   R  +L L   +L     E +EEIFKR+Q+  ++    +LD+ S  +LF++IE+YE+ ++L+IS+N +++    +  C+ M++++  L+ +  +    T+     L RAL   SNL  L LE+  +    L+ L   L  N  ++EL +  N +   D   +  +L+ N  +EL+D+ NN++ + G+ ++   L  Q
Sbjct:  210 RRVSFPD-NQLVTGYLEPANPWKQVYLVKSSSEIVDQYQQSCKKHNTQPLESVVDHLRTLD--LNQARQPLLPLKAKELTANDCEALEEIFKRIQYTCIDLSECTLDESSLMALFQMIEYYEAANELDISYNKAEMTKRCWELCAYMVERSQELQLLNAESNPITKLGADSLGRAL-GSSNLHTLKLEHCGLRGAPLVNLCRGLYQNKRLKELWVGYNDLDCVDAQHIADMLRYNHSLELIDISNNNIRNEGVMYLVQALILQ 468          

HSP 2 Score: 56.225 bits (134), Expect = 1.504e-7
Identity = 41/147 (27.89%), Postives = 78/147 (53.06%), Query Frame = 3
Query:  984 DGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYL--ADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKR 1418
            D L  + L +   E      GL  L LW+N+++ +  PA+++ L+   S++ LN+G N + ++ +  ++D L  N +L  L L    +  +G   +A  L      +L R+D+RDN ++   L  I+  +K NK++ ++D++   KR
Sbjct:  979 DTLSRRQLAEATLEANRSPSGLKALTLWNNNLSKDCAPAVAELLQKTISLELLNIGKNCLSNDFVSTIKDSLTKNTTLTTLGLQSAHLNAKGIETLASILTFGGNSKLQRIDIRDNKLEVESLNIIAEVLKSNKTLTQIDINDEPKR 1125          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Fly
Match: CG31635 (gene:FBgn0051635 transcript:FBtr0331188)

HSP 1 Score: 122.094 bits (305), Expect = 8.017e-28
Identity = 75/263 (28.52%), Postives = 146/263 (55.51%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTE-HKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFN-SKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQ 1001
            ++V FP+  ++V+ Y E  N W + +   SS E++  Y+++C+  N +P+  +++ L+ +D  L   R  +L L   +L     E +EEIFKR+Q+  ++    +LD+ S  +LF++IE+YE+ ++L+IS+N +++    +  C+ M++++  L+ +  +    T+     L RAL   SNL  L LE+  +    L+ L   L  N  ++EL +  N +   D   +  +L+ N  +EL+D+ NN++ + G+ ++   L  Q
Sbjct:  210 RRVSFPD-NQLVTGYLEPANPWKQVYLVKSSSEIVDQYQQSCKKHNTQPLESVVDHLRTLD--LNQARQPLLPLKAKELTANDCEALEEIFKRIQYTCIDLSECTLDESSLMALFQMIEYYEAANELDISYNKAEMTKRCWELCAYMVERSQELQLLNAESNPITKLGADSLGRALG-SSNLHTLKLEHCGLRGAPLVNLCRGLYQNKRLKELWVGYNDLDCVDAQHIADMLRYNHSLELIDISNNNIRNEGVMYLVQALILQ 468          

HSP 2 Score: 55.8398 bits (133), Expect = 2.043e-7
Identity = 41/147 (27.89%), Postives = 78/147 (53.06%), Query Frame = 3
Query:  984 DGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYL--ADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKR 1418
            D L  + L +   E      GL  L LW+N+++ +  PA+++ L+   S++ LN+G N + ++ +  ++D L  N +L  L L    +  +G   +A  L      +L R+D+RDN ++   L  I+  +K NK++ ++D++   KR
Sbjct:  979 DTLSRRQLAEATLEANRSPSGLKALTLWNNNLSKDCAPAVAELLQKTISLELLNIGKNCLSNDFVSTIKDSLTKNTTLTTLGLQSAHLNAKGIETLASILTFGGNSKLQRIDIRDNKLEVESLNIIAEVLKSNKTLTQIDINDEPKR 1125          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Fly
Match: CG31635 (gene:FBgn0051635 transcript:FBtr0331192)

HSP 1 Score: 122.094 bits (305), Expect = 8.210e-28
Identity = 75/263 (28.52%), Postives = 146/263 (55.51%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTE-HKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFN-SKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQ 1001
            ++V FP+  ++V+ Y E  N W + +   SS E++  Y+++C+  N +P+  +++ L+ +D  L   R  +L L   +L     E +EEIFKR+Q+  ++    +LD+ S  +LF++IE+YE+ ++L+IS+N +++    +  C+ M++++  L+ +  +    T+     L RAL   SNL  L LE+  +    L+ L   L  N  ++EL +  N +   D   +  +L+ N  +EL+D+ NN++ + G+ ++   L  Q
Sbjct:  210 RRVSFPD-NQLVTGYLEPANPWKQVYLVKSSSEIVDQYQQSCKKHNTQPLESVVDHLRTLD--LNQARQPLLPLKAKELTANDCEALEEIFKRIQYTCIDLSECTLDESSLMALFQMIEYYEAANELDISYNKAEMTKRCWELCAYMVERSQELQLLNAESNPITKLGADSLGRAL-GSSNLHTLKLEHCGLRGAPLVNLCRGLYQNKRLKELWVGYNDLDCVDAQHIADMLRYNHSLELIDISNNNIRNEGVMYLVQALILQ 468          

HSP 2 Score: 55.8398 bits (133), Expect = 1.667e-7
Identity = 41/147 (27.89%), Postives = 78/147 (53.06%), Query Frame = 3
Query:  984 DGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYL--ADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKR 1418
            D L  + L +   E      GL  L LW+N+++ +  PA+++ L+   S++ LN+G N + ++ +  ++D L  N +L  L L    +  +G   +A  L      +L R+D+RDN ++   L  I+  +K NK++ ++D++   KR
Sbjct:  979 DTLSRRQLAEATLEANRSPSGLKALTLWNNNLSKDCAPAVAELLQKTISLELLNIGKNCLSNDFVSTIKDSLTKNTTLTTLGLQSAHLNAKGIETLASILTFGGNSKLQRIDIRDNKLEVESLNIIAEVLKSNKTLTQIDINDEPKR 1125          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Fly
Match: CG31635 (gene:FBgn0051635 transcript:FBtr0331189)

HSP 1 Score: 118.242 bits (295), Expect = 1.247e-26
Identity = 76/267 (28.46%), Postives = 147/267 (55.06%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTE-HKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFN-SKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTS----ALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQ 1001
            ++V FP+  ++V+ Y E  N W + +   SS E++  Y+++C+  N +P+  +++ L+ +D  L   R  +L L   +L     E +EEIFKR+Q+  ++    +LD+ S  +LF++IE+YE+ ++L+IS+N +++    +  C+ M++++  L+ +  +    T+     L RAL   SNL  L LE+  +    L+ L S     L  N  ++EL +  N +   D   +  +L+ N  +EL+D+ NN++ + G+ ++   L  Q
Sbjct:  210 RRVSFPD-NQLVTGYLEPANPWKQVYLVKSSSEIVDQYQQSCKKHNTQPLESVVDHLRTLD--LNQARQPLLPLKAKELTANDCEALEEIFKRIQYTCIDLSECTLDESSLMALFQMIEYYEAANELDISYNKAEMTKRCWELCAYMVERSQELQLLNAESNPITKLGADSLGRAL-GSSNLHTLKLEHCGLRGAPLVNLLSFAGRGLYQNKRLKELWVGYNDLDCVDAQHIADMLRYNHSLELIDISNNNIRNEGVMYLVQALILQ 472          

HSP 2 Score: 55.8398 bits (133), Expect = 1.843e-7
Identity = 41/147 (27.89%), Postives = 78/147 (53.06%), Query Frame = 3
Query:  984 DGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYL--ADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKR 1418
            D L  + L +   E      GL  L LW+N+++ +  PA+++ L+   S++ LN+G N + ++ +  ++D L  N +L  L L    +  +G   +A  L      +L R+D+RDN ++   L  I+  +K NK++ ++D++   KR
Sbjct:  983 DTLSRRQLAEATLEANRSPSGLKALTLWNNNLSKDCAPAVAELLQKTISLELLNIGKNCLSNDFVSTIKDSLTKNTTLTTLGLQSAHLNAKGIETLASILTFGGNSKLQRIDIRDNKLEVESLNIIAEVLKSNKTLTQIDINDEPKR 1129          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Zebrafish
Match: ppp1r37 (protein phosphatase 1, regulatory subunit 37 [Source:NCBI gene;Acc:562516])

HSP 1 Score: 348.591 bits (893), Expect = 4.668e-106
Identity = 187/426 (43.90%), Postives = 293/426 (68.78%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            K+V FP +++IVS   E K+ W   +  + +E++ +Y++AC+  N KPIP +L+Q +  D K   +R + L+L   KLD K  E +EEIFKRVQFK ++ E T+LD++ +++LF++IE+YES + LNIS N  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLENS I  + L++L +ALK+N+++REL+LA N++    D  QLG+LLK N +I++LD+RNN + D GL+++C+GL EQ              GL+ L+LW+N +T+NGM  L+ AL   +S+++LNLG+N + +EG+H L+DGL+ NRS+LRL L   +++CEG VAIAE++A++ +L+RLD+R+N+IKT GLMA+S + KVN S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:  192 KRVTFPSDEDIVSGAVEPKDPWRHAQNVTVEEILNAYRQACQKLNCKPIPKVLKQTQ--DLKDLTQRNECLDLKGEKLDYKSCESLEEIFKRVQFKLVDLEQTNLDEDGASALFDMIEYYESATHLNISNNKHIGTRGWQAAAHMMRKTNSLQYLDARNTPLLDHSAPFVARALRISSSLTVLHLENSGISGRPLMLLATALKMNMNLRELYLAENKLNGLQDSAQLGNLLKFNYNIQILDLRNNHILDSGLAYVCEGLKEQR------------KGLVTLVLWNNQLTHNGMGYLAAALPFTQSLETLNLGHNAVGNEGVHKLKDGLISNRSILRLGLASTKLSCEGAVAIAEFIAESPRLLRLDMRENEIKTGGLMALSLAFKVNTSLLRLDLDREPKKE-TVKSFIETQRALLADIQNGCKRN 602          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Zebrafish
Match: si:dkey-288a3.2 (si:dkey-288a3.2 [Source:ZFIN;Acc:ZDB-GENE-131127-351])

HSP 1 Score: 174.866 bits (442), Expect = 6.297e-48
Identity = 120/323 (37.15%), Postives = 190/323 (58.82%), Query Frame = 3
Query:  540 ESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENKKAV 1505
            + +++L +++ +YES + L++S NS + + G+ + S +L+++  L  ++   +   +     L++AL   S L +LHLEN+ +  K L  L  ALK N+ ++EL+L+ N +    D +Q+  LLK N  ++ LD+ NN+  D GL  ICD L  Q              GL  LIL +N IT+ GM  L + L   +S+++LNLG N + + GIH L++ L++NRSLL+L L    ITCEG V +AE LA++ Q+ RLD+R N +   GLMA+S ++K+N+S+IRLDLDQ  K + +     ETQ+  L  I +    N  A 
Sbjct:    8 KGASALLDMVLYYESATHLDVSANSGMGFSGWLSLSHLLRQSGCLWRLDACNMPMVDYAAQALSKALLT-SRLTVLHLENTCLSGKPLFTLVGALKRNVALQELYLSENNLNGYQDSMQVADLLKFNNTLKTLDLSNNATSDSGLEEICDALSFQ------------KTGLRTLILSNNHITHLGMSHLQNVLPRLKSLETLNLGKNNLENRGIHMLKESLMINRSLLQLGLAATGITCEGAVTLAEILAESPQIQRLDVRQNQVLAGGLMALSLALKINRSLIRLDLDQHLKEEKD-DFLMETQKTLLSRITDLCAANATAA 316          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Zebrafish
Match: nlrc3 (NLR family, CARD domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-071119-1])

HSP 1 Score: 79.337 bits (194), Expect = 1.113e-14
Identity = 93/335 (27.76%), Postives = 141/335 (42.09%), Query Frame = 3
Query:  546 SASLFEIIEFYESCSKLNISFN----SKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENH----GPGLLC-----------LILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            S+SL  ++     CSKL +  N      ++ +G    S +  K   ++ + L     +   + PL+RAL     L  L L  +NI +K    L  ALKLN  +  ++L +N +       L  +L+ NR +  L+V+ N +G  G+  I +GL +    Q      NH    G   L            L L SNS++  G+ ALS AL+ NR +  LNL  N I   G+ G +D                         IA+ L     L  LDL  N +   G+ AI+ +M+VN+SI  L L     +    K   E+   +  I    +QEN
Sbjct:  302 SSSLKRLLPQLLYCSKLRMENNEFKEGAMELLG----SLLSAKECHIQMLSLADNSISSKGVKPLSRALLVNRTLTTLDLRGNNIGAKGAKTLCEALKLNQFLVSVNLQNNHIEDEGARSLSEVLQSNRKLTTLNVQKNGIGPEGMKKIAEGLIKNQTLQDFNVSSNHLGDLGTVALAQALMVNHVLHTLSLQSNSVSDRGIKALSHALQSNRGLCCLNLRENSI---GVAGAKD-------------------------IAKALKVNTCLRELDLTANLLHDEGVTAIAEAMRVNRSISSLHLQWNFMKAGAAKALAESLSSNTCIQLLDLQEN 604          

HSP 2 Score: 68.1662 bits (165), Expect = 3.044e-11
Identity = 89/337 (26.41%), Postives = 150/337 (44.51%), Query Frame = 3
Query:  399 AKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQF-KNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
            A L +     L+L    +  K  + + E  K  QF  ++N +N  ++DE + SL E+++     + LN+  N  I   G    ++ L K   L+   +      +     L +AL     L  L L+++++  + +  L+ AL+ N  +  L+L  N +  +    +   LKVN  +  LD+  N L D G++ I + +    + + I            L L  N +      AL+++L  N  IQ L+L  N +   G+  L   L+ N SL  L L        G VA+A+ +   K L  LDLR N I   G  A S ++K N+S+  L+L +
Sbjct:  365 ALLVNRTLTTLDLRGNNIGAKGAKTLCEALKLNQFLVSVNLQNNHIEDEGARSLSEVLQSNRKLTTLNVQKNG-IGPEGMKKIAEGLIKNQTLQDFNVSSNHLGDLGTVALAQALMVNHVLHTLSLQSNSVSDRGIKALSHALQSNRGLCCLNLRENSIGVAGAKDIAKALKVNTCLRELDLTANLLHDEGVTAIAEAM---RVNRSISS----------LHLQWNFMKAGAAKALAESLSSNTCIQLLDLQENALGDNGVIALAAALMSNSSLTVLYLQGVSAGKSGAVALADAMVVNKTLHTLDLRGNSIGMEGAKAFSSALKNNRSLRSLNLQE 687          

HSP 3 Score: 63.1586 bits (152), Expect = 9.863e-10
Identity = 74/315 (23.49%), Postives = 123/315 (39.05%), Query Frame = 3
Query:  477 EEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQ-----FLPQPIKEDENHGPGLL----------CLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVN 1376
            E + K    ++ N  +  L D  + +L + +        L++  NS +   G  A S  L+    L C+ L+           + +AL+  + L+ L L  + +  + +  +  A+++N  +  LHL  N M       L   L  N  I+LLD++ N+LGD G+  +   L           Q +   ++    L            L L  NSI   G  A S ALK NRS++SLNL  N                             +  +G + IA  L    QL  ++L+ N I  +G   +S ++K  
Sbjct:  448 EGLIKNQTLQDFNVSSNHLGDLGTVALAQALMVNHVLHTLSLQSNS-VSDRGIKALSHALQSNRGLCCLNLRENSIGVAGAKDIAKALKVNTCLRELDLTANLLHDEGVTAIAEAMRVNRSISSLHLQWNFMKAGAAKALAESLSSNTCIQLLDLQENALGDNGVIALAAALMSNSSLTVLYLQGVSAGKSGAVALADAMVVNKTLHTLDLRGNSIGMEGAKAFSSALKNNRSLRSLNLQENS----------------------------LGMDGAIFIATALRGNHQLTYINLQGNGIGESGAKVVSDAIKAG 733          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Zebrafish
Match: lrrc74b (leucine rich repeat containing 74B [Source:ZFIN;Acc:ZDB-GENE-141212-96])

HSP 1 Score: 57.3806 bits (137), Expect = 4.720e-8
Identity = 67/285 (23.51%), Postives = 121/285 (42.46%), Query Frame = 3
Query:  327 YKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESC--SKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEG 1175
            YK+AC+  NV P+   L  +   +  + H          + + L                 LN  +  ++   +A++ ++++  E+C  +++++S N   +Y G  A S ML +   L  + L G    E     L+ AL     L+ L L ++ +      IL +A+  N  ++ L+LA N +     I     L+ N  +  +D+  N LG  G            L + +K++      L  L + +N I + G   L+  LKVN +++ L +  NPI S G
Sbjct:  122 YKEACKMLNVIPVSCFLRNINQSEVNMMHCGLGAQGTKALAISL---------VTNTSILKLNLRDNWMEGAGAAAIADMLK--ENCYITEIDLSDNRMGEY-GARALSSMLLENSTLFSVNLSGNHLDERAAKHLSPALISNQKLQHLDLSHNRLTDTAGEILGAAIAENTGLKALNLAWNCIRGKGAIAFAKGLEGNIFLRSVDLSYNGLGKDG---------ALALEEALKQNNT----LEDLNISNNRIPFEGAVHLALGLKVNTTLRILKMSRNPIQSAG 381          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Zebrafish
Match: lrrc74a (leucine rich repeat containing 74A [Source:ZFIN;Acc:ZDB-GENE-131127-263])

HSP 1 Score: 55.4546 bits (132), Expect = 2.001e-7
Identity = 82/330 (24.85%), Postives = 127/330 (38.48%), Query Frame = 3
Query:  303 SSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADT 1292
            S++EL   Y +AC+   V P+   +  L      L H  + +  L    L +  +  M           L   +  L  E +  L E++    +   L++S N ++Q  G  + +KML +   ++ ++L G  FTE                                    AL  N  ++EL L+ N      G  LG ++  N  +E+LD+  N L   G    C GL        +     H      L L  N     G  AL +ALK N ++Q L+L NN I  EG   L  GL  N +L  L L    +T EG + +   + +T
Sbjct:    2 STEEL---YLQACKLVGVIPVRYFIRNLGCATINLNH--HGLGPLGGKALAIALVTDMHT-------TTLELADNCLRAEGATHLMEMLRANFTIHNLDLSDN-QLQSAGAESVAKMLLENISIKSLKLSGNKFTEDDAK----------------------------WFADALSSNYRVKELDLSHNEFSGRGGEHLGQMIANNDGLEVLDLSWNHLRMKGAVAFCAGL-------KVNTTLKH------LDLSWNGFGNEGALALGEALKFNNTLQHLDLNNNRITDEGAGMLSKGLEANDTLRVLQLAYNSLTVEGALTLINTIKNT 277          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Xenopus
Match: nt5e (5'-nucleotidase, ecto (CD73) [Source:Xenbase;Acc:XB-GENE-984211])

HSP 1 Score: 331.643 bits (849), Expect = 2.198e-102
Identity = 184/426 (43.19%), Postives = 287/426 (67.37%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            K+V FP + +IVS   E K+ W   +  + +++I SY +AC+  N K IP L+ QL+  D      R + L+L   +LD K  E +EEIFKRVQFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  + L++L +ALK+NI +REL+LA NR+    D  QLG+LLK N  I++LD+RNN + D GLS+IC+G+ EQ              GL+ L+LW+N +T+ GM  +S  L   +++++LNLG+N I +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S +++VN+S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:   37 KRVTFPCDDDIVSGALEPKDPWRHAQNVTVNDVITSYTQACQKLNCKQIPKLIRQLE--DLTDLSGRVETLDLKGERLDHKACEALEEIFKRVQFKMVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTNCLQYLDARNTPLLDHSAPFVARALRISSSLTVLHLENTSLSGRPLMLLATALKMNIVLRELYLADNRLNSLQDSAQLGNLLKFNSCIQILDLRNNHIMDSGLSYICEGIKEQR------------QGLVTLVLWNNQLTHAGMVYMSLCLPHTQTLETLNLGHNAIGNEGVRHLKNGLIGNRSVLRLGLASAKLTCEGAVAVAEFVAESPRLLRLDLRENEIKTGGLMALSLALRVNQSLLRLDLDREPKKEA-VKSFIETQRALLAEIQNGCRRN 447          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Xenopus
Match: nt5e (5'-nucleotidase, ecto (CD73) [Source:Xenbase;Acc:XB-GENE-984211])

HSP 1 Score: 329.717 bits (844), Expect = 2.448e-102
Identity = 184/426 (43.19%), Postives = 287/426 (67.37%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            K+V FP + +IVS   E K+ W   +  + +++I SY +AC+  N K IP L+ QL+  D      R + L+L   +LD K  E +EEIFKRVQFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  + L++L +ALK+NI +REL+LA NR+    D  QLG+LLK N  I++LD+RNN + D GLS+IC+G+ EQ              GL+ L+LW+N +T+ GM  +S  L   +++++LNLG+N I +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S +++VN+S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:   37 KRVTFPCDDDIVSGALEPKDPWRHAQNVTVNDVITSYTQACQKLNCKQIPKLIRQLE--DLTDLSGRVETLDLKGERLDHKACEALEEIFKRVQFKMVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTNCLQYLDARNTPLLDHSAPFVARALRISSSLTVLHLENTSLSGRPLMLLATALKMNIVLRELYLADNRLNSLQDSAQLGNLLKFNSCIQILDLRNNHIMDSGLSYICEGIKEQR------------QGLVTLVLWNNQLTHAGMVYMSLCLPHTQTLETLNLGHNAIGNEGVRHLKNGLIGNRSVLRLGLASAKLTCEGAVAVAEFVAESPRLLRLDLRENEIKTGGLMALSLALRVNQSLLRLDLDREPKKEA-VKSFIETQRALLAEIQNGCRRN 447          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Xenopus
Match: nt5e (5'-nucleotidase, ecto (CD73) [Source:Xenbase;Acc:XB-GENE-984211])

HSP 1 Score: 330.487 bits (846), Expect = 4.974e-102
Identity = 184/426 (43.19%), Postives = 287/426 (67.37%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            K+V FP + +IVS   E K+ W   +  + +++I SY +AC+  N K IP L+ QL+  D      R + L+L   +LD K  E +EEIFKRVQFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  + L++L +ALK+NI +REL+LA NR+    D  QLG+LLK N  I++LD+RNN + D GLS+IC+G+ EQ              GL+ L+LW+N +T+ GM  +S  L   +++++LNLG+N I +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S +++VN+S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:   38 KRVTFPCDDDIVSGALEPKDPWRHAQNVTVNDVITSYTQACQKLNCKQIPKLIRQLE--DLTDLSGRVETLDLKGERLDHKACEALEEIFKRVQFKMVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTNCLQYLDARNTPLLDHSAPFVARALRISSSLTVLHLENTSLSGRPLMLLATALKMNIVLRELYLADNRLNSLQDSAQLGNLLKFNSCIQILDLRNNHIMDSGLSYICEGIKEQR------------QGLVTLVLWNNQLTHAGMVYMSLCLPHTQTLETLNLGHNAIGNEGVRHLKNGLIGNRSVLRLGLASAKLTCEGAVAVAEFVAESPRLLRLDLRENEIKTGGLMALSLALRVNQSLLRLDLDREPKKEA-VKSFIETQRALLAEIQNGCRRN 448          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Xenopus
Match: nt5e (5'-nucleotidase, ecto (CD73) [Source:Xenbase;Acc:XB-GENE-984211])

HSP 1 Score: 329.717 bits (844), Expect = 8.162e-102
Identity = 184/426 (43.19%), Postives = 287/426 (67.37%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            K+V FP + +IVS   E K+ W   +  + +++I SY +AC+  N K IP L+ QL+  D      R + L+L   +LD K  E +EEIFKRVQFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  + L++L +ALK+NI +REL+LA NR+    D  QLG+LLK N  I++LD+RNN + D GLS+IC+G+ EQ              GL+ L+LW+N +T+ GM  +S  L   +++++LNLG+N I +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S +++VN+S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:   37 KRVTFPCDDDIVSGALEPKDPWRHAQNVTVNDVITSYTQACQKLNCKQIPKLIRQLE--DLTDLSGRVETLDLKGERLDHKACEALEEIFKRVQFKMVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTNCLQYLDARNTPLLDHSAPFVARALRISSSLTVLHLENTSLSGRPLMLLATALKMNIVLRELYLADNRLNSLQDSAQLGNLLKFNSCIQILDLRNNHIMDSGLSYICEGIKEQR------------QGLVTLVLWNNQLTHAGMVYMSLCLPHTQTLETLNLGHNAIGNEGVRHLKNGLIGNRSVLRLGLASAKLTCEGAVAVAEFVAESPRLLRLDLRENEIKTGGLMALSLALRVNQSLLRLDLDREPKKEA-VKSFIETQRALLAEIQNGCRRN 447          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Xenopus
Match: nt5e (5'-nucleotidase, ecto (CD73) [Source:Xenbase;Acc:XB-GENE-984211])

HSP 1 Score: 328.176 bits (840), Expect = 1.200e-101
Identity = 184/426 (43.19%), Postives = 287/426 (67.37%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            K+V FP + +IVS   E K+ W   +  + +++I SY +AC+  N K IP L+ QL+  D      R + L+L   +LD K  E +EEIFKRVQFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  + L++L +ALK+NI +REL+LA NR+    D  QLG+LLK N  I++LD+RNN + D GLS+IC+G+ EQ              GL+ L+LW+N +T+ GM  +S  L   +++++LNLG+N I +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S +++VN+S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:   26 KRVTFPCDDDIVSGALEPKDPWRHAQNVTVNDVITSYTQACQKLNCKQIPKLIRQLE--DLTDLSGRVETLDLKGERLDHKACEALEEIFKRVQFKMVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTNCLQYLDARNTPLLDHSAPFVARALRISSSLTVLHLENTSLSGRPLMLLATALKMNIVLRELYLADNRLNSLQDSAQLGNLLKFNSCIQILDLRNNHIMDSGLSYICEGIKEQ------------RQGLVTLVLWNNQLTHAGMVYMSLCLPHTQTLETLNLGHNAIGNEGVRHLKNGLIGNRSVLRLGLASAKLTCEGAVAVAEFVAESPRLLRLDLRENEIKTGGLMALSLALRVNQSLLRLDLDREPKKEA-VKSFIETQRALLAEIQNGCRRN 436          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Mouse
Match: Ppp1r37 (protein phosphatase 1, regulatory subunit 37 [Source:MGI Symbol;Acc:MGI:2687042])

HSP 1 Score: 341.658 bits (875), Expect = 1.800e-105
Identity = 188/441 (42.63%), Postives = 296/441 (67.12%), Query Frame = 3
Query:  186 TNTFDESDSK----KKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            T T   +D +     K+V FP +++IVS   E K+ W   +  + DE+I +Y++AC+  N + IP LL QL+        +R + L+L   KLD K  E +EE+FKR+QFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  + L++L +ALK+N+++REL+LA N++    D  QLG+LLK N  +++LD+RNN + D GL++IC+GL EQ              GL+ L+LW+N +T+ GM  L  AL   +S+++LNLG+NPI +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S ++KVN S++RLDLD+  K++P VK + ETQ+  L  IQ   + N
Sbjct:   35 TGTSPPADGRLKAAAKRVTFPSDEDIVSGAVEPKDPWRHAQNVTVDEVISAYRQACQKLNCRQIPKLLRQLQEFTD--LEQRINCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLENASLSGRPLMLLATALKMNMNLRELYLADNKLNGLQDSAQLGNLLKFNCSLQILDLRNNHVLDSGLAYICEGLKEQR------------KGLVTLVLWNNQLTHTGMAFLGMALPHTQSLETLNLGHNPIGNEGVRNLKNGLISNRSVLRLGLASTKLTCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNHSLLRLDLDREPKKEP-VKSFIETQKALLAEIQNGCKRN 460          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Mouse
Match: Nlrc3 (NLR family, CARD domain containing 3 [Source:MGI Symbol;Acc:MGI:2444070])

HSP 1 Score: 72.0182 bits (175), Expect = 2.544e-12
Identity = 101/366 (27.60%), Postives = 164/366 (44.81%), Query Frame = 3
Query:  348 CNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQ-------IECMEEIFK-RVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIP-----PLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
            C ++ I +   Q+    AK    R  ++N S + LDL+         + + +  K      +L+ ++  + D+    + E +   ++ S L +  N  I  IG    +  LK+        LK +MF+  TI       L  AL+    L+ L L++++I    + +L  AL  N  +  L+L  N + P     L   L  N  ++ LD+  N L D G   I            +   ENH   L  L L  N I      AL  AL++NR++ +L+L  N I  EG   +   L VN +L+ L L    I  +G  A+ E L   + L  LDLR ND+  AG  A+++++K+N S+ RL+L +
Sbjct:  703 CRIRKISLAENQIGNKGAK-ALARSLLVNRSLITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKN-LIGLIGAQQMADALKQNR-----SLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIA-----------VAVGENHS--LTHLHLQWNFIQAGAARALGQALQLNRTLTTLDLQENAIGDEGASSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGNDVGAAGAKALANALKLNSSLRRLNLQE 1048          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Mouse
Match: Nlrc3 (NLR family, CARD domain containing 3 [Source:MGI Symbol;Acc:MGI:2444070])

HSP 1 Score: 67.0106 bits (162), Expect = 4.424e-11
Identity = 89/307 (28.99%), Postives = 141/307 (45.93%), Query Frame = 3
Query:  501 FKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIP-----PLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
              +L+ ++  + D+    + E +   ++ S L +  N  I  IG    +  LK+        LK +MF+  TI       L  AL+    L+ L L++++I    + +L  AL  N  +  L+L  N + P     L   L  N  ++ LD+  N L D G   I            +   ENH   L  L L  N I      AL  AL++NR++ +L+L  N I  EG   +   L VN +L+ L L    I  +G  A+ E L   + L  LDLR ND+  AG  A+++++K+N S+ RL+L +
Sbjct:   56 LTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKN-LIGLIGAQQMADALKQNR-----SLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLRENSISPEGAQALTQALCRNNTLKHLDLTANLLHDRGAQAIA-----------VAVGENHS--LTHLHLQWNFIQAGAARALGQALQLNRTLTTLDLQENAIGDEGASSVAGALKVNTTLIALYLQVASIGSQGAQALGEALTVNRTLEILDLRGNDVGAAGAKALANALKLNSSLRRLNLQE 343          

HSP 2 Score: 51.6026 bits (122), Expect = 3.235e-6
Identity = 45/128 (35.16%), Postives = 70/128 (54.69%), Query Frame = 3
Query: 1047 LLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNV 1430
            L+ L L SNSI   G  AL+DALK+NR++ SL+L +N I  +G+  + + L+ N+++  L L    I   G   +A+ L   + L  L    N I   G +A++ ++KVN+ +  LDL   S  D  V
Sbjct:   28 LITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGV 155          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Mouse
Match: Lrrc74b (leucine rich repeat containing 74B [Source:MGI Symbol;Acc:MGI:1921935])

HSP 1 Score: 63.1586 bits (152), Expect = 5.594e-10
Identity = 72/288 (25.00%), Postives = 123/288 (42.71%), Query Frame = 3
Query:  327 YKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQF-KNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGL 1187
            Y K+C   +V P+  LL Q          E    LNL +  L  + +  +  +     + K L+  +  L    + +L +++      S +++S N +I   G  A    L   P +E ++L+G    E     L   L     LK L L  + +      IL  A+  N  + EL+L+ N +           L+ N  +++LD+ +N  GD G S I D L    +   ++E          L + +N I+ +G   L   L+VN++++ L +  NPI S+G  GL
Sbjct:   58 YLKSCRANSVVPVSCLLRQ----------EGASELNLRHRGLGPQGVRALASVLTSNPYIKRLDLRDNGLCGAGAEALADVLRKNSIISDVDLSEN-QIGAAGLQAICTALALNPTVEKMQLQGNRLEEQAAQHLAALLLHHRGLKSLDLSYNQLNDLAGEILGPAVAENTGLTELNLSWNHLRGLGATAFARGLEANIFLKVLDISHNGFGDSGASAIGDAL---RVNNVLEE----------LNMRNNRISVSGALKLGLGLQVNQTLRILIISKNPIRSDGCVGL 321          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Mouse
Match: Nlrc3 (NLR family, CARD domain containing 3 [Source:MGI Symbol;Acc:MGI:2444070])

HSP 1 Score: 61.6178 bits (148), Expect = 4.414e-9
Identity = 73/228 (32.02%), Postives = 120/228 (52.63%), Query Frame = 3
Query:  726 LNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQ-LGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
            L R+L    +L  L L +++I       L  ALK+N  +  L L SN ++  DG+  +   L  N+ I +L ++ N +G IG   + D L         K++ +    L  L+  SN+I   G  AL++ALKVN+ +++L+L +N I   G+  L   L  N++L  L+L    I  EG  ++A  L     L+ L LR ND+  AG  A+++++K+N S+ RL+L +
Sbjct:  707 LARSLLVNRSLITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSN-VIKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGAQQMADAL---------KQNRS----LKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGVTVLMRALCSNQTLSSLNLQENAIGDEGASSVAGALKVNTTLIALYLRGNDVGAAGAKALANALKLNSSLRRLNLQE 920          

HSP 2 Score: 51.2174 bits (121), Expect = 6.008e-6
Identity = 45/128 (35.16%), Postives = 70/128 (54.69%), Query Frame = 3
Query: 1047 LLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNV 1430
            L+ L L SNSI   G  AL+DALK+NR++ SL+L +N I  +G+  + + L+ N+++  L L    I   G   +A+ L   + L  L    N I   G +A++ ++KVN+ +  LDL   S  D  V
Sbjct:  717 LITLDLRSNSIGPPGAKALADALKINRTLTSLSLQSNVIKDDGVMCVAEALVSNQTISMLQLQKNLIGLIGAQQMADALKQNRSLKALMFSSNTIGDRGAIALAEALKVNQILENLDLQSNSISDMGV 844          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. UniProt/SwissProt
Match: sp|Q1L994|PPR37_DANRE (Protein phosphatase 1 regulatory subunit 37 OS=Danio rerio OX=7955 GN=ppp1r37 PE=2 SV=1)

HSP 1 Score: 348.591 bits (893), Expect = 4.611e-105
Identity = 187/426 (43.90%), Postives = 293/426 (68.78%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            K+V FP +++IVS   E K+ W   +  + +E++ +Y++AC+  N KPIP +L+Q +  D K   +R + L+L   KLD K  E +EEIFKRVQFK ++ E T+LD++ +++LF++IE+YES + LNIS N  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLENS I  + L++L +ALK+N+++REL+LA N++    D  QLG+LLK N +I++LD+RNN + D GL+++C+GL EQ              GL+ L+LW+N +T+NGM  L+ AL   +S+++LNLG+N + +EG+H L+DGL+ NRS+LRL L   +++CEG VAIAE++A++ +L+RLD+R+N+IKT GLMA+S + KVN S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:  192 KRVTFPSDEDIVSGAVEPKDPWRHAQNVTVEEILNAYRQACQKLNCKPIPKVLKQTQ--DLKDLTQRNECLDLKGEKLDYKSCESLEEIFKRVQFKLVDLEQTNLDEDGASALFDMIEYYESATHLNISNNKHIGTRGWQAAAHMMRKTNSLQYLDARNTPLLDHSAPFVARALRISSSLTVLHLENSGISGRPLMLLATALKMNMNLRELYLAENKLNGLQDSAQLGNLLKFNYNIQILDLRNNHILDSGLAYVCEGLKEQR------------KGLVTLVLWNNQLTHNGMGYLAAALPFTQSLETLNLGHNAVGNEGVHKLKDGLISNRSILRLGLASTKLSCEGAVAIAEFIAESPRLLRLDMRENEIKTGGLMALSLAFKVNTSLLRLDLDREPKKE-TVKSFIETQRALLADIQNGCKRN 602          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. UniProt/SwissProt
Match: sp|Q8BKR5|PPR37_MOUSE (Protein phosphatase 1 regulatory subunit 37 OS=Mus musculus OX=10090 GN=Ppp1r37 PE=1 SV=1)

HSP 1 Score: 341.658 bits (875), Expect = 1.259e-104
Identity = 188/441 (42.63%), Postives = 296/441 (67.12%), Query Frame = 3
Query:  186 TNTFDESDSK----KKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            T T   +D +     K+V FP +++IVS   E K+ W   +  + DE+I +Y++AC+  N + IP LL QL+        +R + L+L   KLD K  E +EE+FKR+QFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  + L++L +ALK+N+++REL+LA N++    D  QLG+LLK N  +++LD+RNN + D GL++IC+GL EQ              GL+ L+LW+N +T+ GM  L  AL   +S+++LNLG+NPI +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S ++KVN S++RLDLD+  K++P VK + ETQ+  L  IQ   + N
Sbjct:   35 TGTSPPADGRLKAAAKRVTFPSDEDIVSGAVEPKDPWRHAQNVTVDEVISAYRQACQKLNCRQIPKLLRQLQEFTD--LEQRINCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLENASLSGRPLMLLATALKMNMNLRELYLADNKLNGLQDSAQLGNLLKFNCSLQILDLRNNHVLDSGLAYICEGLKEQR------------KGLVTLVLWNNQLTHTGMAFLGMALPHTQSLETLNLGHNPIGNEGVRNLKNGLISNRSVLRLGLASTKLTCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNHSLLRLDLDREPKKEP-VKSFIETQKALLAEIQNGCKRN 460          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. UniProt/SwissProt
Match: sp|B2RYF1|PPR37_RAT (Protein phosphatase 1 regulatory subunit 37 OS=Rattus norvegicus OX=10116 GN=Ppp1r37 PE=1 SV=1)

HSP 1 Score: 340.117 bits (871), Expect = 5.636e-104
Identity = 184/429 (42.89%), Postives = 292/429 (68.07%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            +  K+V FP +++IVS   E K+ W   +  + DE+I +Y++AC+  N + IP LL QL+        +R + L+L   KLD K  E +EE+FKR+QFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  + L++L +ALK+N++++EL+LA N++    D  QLG+LLK N  +++LD+RNN + D GL++IC+GL EQ              GL+ L+LW+N +T+ GM  L  AL   +S+++LNLG+NPI +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S ++KVN S++RLDLD+  K++P VK + ETQ+  L  IQ   + N
Sbjct:   45 AAAKRVTFPSDEDIVSGAVEPKDPWRHAQNVTVDEVISAYRQACQKLNCRQIPKLLRQLQEFTD--LEQRINCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLENASLSGRPLMLLATALKMNMNLQELYLADNKLNGLQDSAQLGNLLKFNCSLQILDLRNNHVLDSGLAYICEGLKEQR------------KGLVTLVLWNNQLTHTGMAFLGMALPHTQSLETLNLGHNPIGNEGVRNLKNGLISNRSVLRLGLASTKLTCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNHSLLRLDLDREPKKEP-VKSFIETQKALLAEIQNGCKRN 458          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. UniProt/SwissProt
Match: sp|O75864|PPR37_HUMAN (Protein phosphatase 1 regulatory subunit 37 OS=Homo sapiens OX=9606 GN=PPP1R37 PE=1 SV=4)

HSP 1 Score: 338.576 bits (867), Expect = 1.116e-103
Identity = 187/429 (43.59%), Postives = 291/429 (67.83%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            +  K+V FP +++IVS   E K+ W   +  + DE+I +YK+AC+  N + IP LL QL+     L H R D L+L   KLD K  E +EE+FKR+QFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLEN+++  + L++L +ALK+N+++REL+LA N++    D  QLG+LLK N  +++LD+RNN + D GL++IC+GL EQ              GL+ L+LW+N +T+ GM  L   L   +S+++LNLG+NPI +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S ++KVN S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:   41 AAAKRVTFPSDEDIVSGAVEPKDPWRHAQNVTVDEVIGAYKQACQKLNCRQIPKLLRQLQEF-TDLGH-RLDCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLENASLSGRPLMLLATALKMNMNLRELYLADNKLNGLQDSAQLGNLLKFNCSLQILDLRNNHVLDSGLAYICEGLKEQR------------KGLVTLVLWNNQLTHTGMAFLGMTLPHTQSLETLNLGHNPIGNEGVRHLKNGLISNRSVLRLGLASTKLTCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNHSLLRLDLDREPKKE-AVKSFIETQKALLAEIQNGCKRN 454          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. UniProt/SwissProt
Match: sp|A7Z026|PPR37_BOVIN (Protein phosphatase 1 regulatory subunit 37 OS=Bos taurus OX=9913 GN=PPP1R37 PE=2 SV=1)

HSP 1 Score: 336.65 bits (862), Expect = 8.798e-103
Identity = 187/429 (43.59%), Postives = 288/429 (67.13%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            +  K+V FP +++IVS   E K+ W   +  + DE+I +YK+AC+  N + IP LL QL+     L H R D L+L   KLD K  E +EE+FKR+QFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR  S+L +LHLE+S++  + L++L +ALK+N+ +REL+LA N++    D  QLG+LLK N  +++LD+RNN + D GL++IC+GL EQ              GL  L+LW+N +T+ GM  L   L    S+++LNLG+NPI +EG+  L++GL+ NRS+LRL L   ++TCEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S ++KVN S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:   41 AAAKRVTFPSDEDIVSGAVEPKDPWRHAQNVTVDEIIGAYKQACQKLNCRQIPKLLRQLQEF-TDLGH-RIDCLDLKGEKLDYKTCEALEEVFKRLQFKVVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTSCLQYLDARNTPLLDHSAPFVARALRIRSSLAVLHLESSSLSGRPLMLLATALKMNMTLRELYLADNKLNGLQDSAQLGNLLKFNCSLQILDLRNNHVLDSGLAYICEGLKEQR------------KGLATLVLWNNQLTHTGMAFLGMTLPHTHSLETLNLGHNPIGNEGVRNLKNGLISNRSVLRLGLASTKLTCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNHSLLRLDLDREPKKE-AVKSFIETQKALLAEIQNGCKRN 454          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. TrEMBL
Match: A0A1I8GAD2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 422.55 bits (1085), Expect = 6.943e-135
Identity = 221/429 (51.52%), Postives = 307/429 (71.56%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENK 1496
            S  +KV FP ++ IVS Y +  + W +   C+++EL+ +YK AC+   V+P   LLEQL+GID  +C++RY+ML+  N++LD +Q+E +EEIFKRVQFK L+FE++ LD++S+ +LF++IE+YESC KLNI+ N++I   G+  CS+MLKKTP L+ I+L GI  +E +IP L R+LR GS L  LHLE+SNI  +NLLIL +AL++N  +REL LA N+M  SDG  L SLL+    +++LDVRNN+L D G ++IC+GL EQ         +    GL  L+LW N I++  MPA+S AL VNR +Q+LNLG+N I SEG+H LR+GLL NR+LLRL L  CRI CEG VA+AE LA++ QL+RLDLRDN I+TAGLMA+  ++ VNKS+ RLDLD+  K++P++K Y E Q   L  I   +Q N+
Sbjct:   22 SSSRKVTFPTDESIVSGYMDPPDPWGKGYNCTTEELVCAYKAACDANGVQPHRHLLEQLQGIDLSVCNDRYEMLSCRNLRLDSRQVEALEEIFKRVQFKTLDFESSGLDEDSAIALFDMIEYYESCCKLNIAHNTRIGLRGWQMCSRMLKKTPCLQTIDLHGIPLSEQSIPALVRSLRIGSTLVTLHLEHSNITGRNLLILVTALRINESLRELLLADNKMTSSDGQHLASLLRNTPTLQMLDVRNNALQDTGCAYICEGLYEQ---------QGGECGLAALVLWHNQISHEAMPAVSAALAVNRHLQTLNLGHNLIGSEGVHLLREGLLRNRTLLRLGLQWCRIACEGAVALAECLAESPQLLRLDLRDNQIRTAGLMALKLALSVNKSLTRLDLDKDIKKEPSMKDYAEQQGALLEAIGALLQRNR 441          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. TrEMBL
Match: A0A267GK46 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig033792g1 PE=4 SV=1)

HSP 1 Score: 426.017 bits (1094), Expect = 7.901e-135
Identity = 221/429 (51.52%), Postives = 307/429 (71.56%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENK 1496
            S  +KV FP ++ IVS Y +  + W +   C+++EL+ +YK AC+   V+P   LLEQL+GID  +C++RY+ML+  N++LD +Q+E +EEIFKRVQFK L+FE++ LD++S+ +LF++IE+YESC KLNI+ N++I   G+  CS+MLKKTP L+ I+L GI  +E +IP L R+LR GS L  LHLE+SNI  +NLLIL +AL++N  +REL LA N+M  SDG  L SLL+    +++LDVRNN+L D G ++IC+GL EQ         +    GL  L+LW N I++  MPA+S AL VNR +Q+LNLG+N I SEG+H LR+GLL NR+LLRL L  CRI CEG VA+AE LA++ QL+RLDLRDN I+TAGLMA+  ++ VNKS+ RLDLD+  K++P++K Y E Q   L  I   +Q N+
Sbjct:   22 SSSRKVTFPTDESIVSGYMDPPDPWGKGYNCTTEELVCAYKAACDANGVQPHRHLLEQLQGIDLSVCNDRYEMLSCRNLRLDSRQVEALEEIFKRVQFKTLDFESSGLDEDSAIALFDMIEYYESCCKLNIAHNTRIGLRGWQMCSRMLKKTPCLQTIDLHGIPLSEQSIPALVRSLRIGSTLVTLHLEHSNITGRNLLILVTALRINESLRELLLADNKMTSSDGQHLASLLRNTPTLQMLDVRNNALQDTGCAYICEGLYEQ---------QGGECGLAALVLWHNQISHEAMPAVSAALAVNRHLQTLNLGHNLIGSEGVHLLREGLLRNRTLLRLGLQWCRIACEGAVALAECLAESPQLLRLDLRDNQIRTAGLMALKLALSVNKSLTRLDLDKDIKKEPSMKDYAEQQGALLEAIGALLQRNR 441          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. TrEMBL
Match: A0A1I8HPS9 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 427.172 bits (1097), Expect = 8.523e-135
Identity = 221/429 (51.52%), Postives = 307/429 (71.56%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENK 1496
            S  +KV FP ++ IVS Y +  + W +   C+++EL+ +YK AC+   V+P   LLEQL+GID  +C++RY+ML+  N++LD +Q+E +EEIFKRVQFK L+FE++ LD++S+ +LF++IE+YESC KLNI+ N++I   G+  CS+MLKKTP L+ I+L GI  +E +IP L R+LR GS L  LHLE+SNI  +NLLIL +AL++N  +REL LA N+M  SDG  L SLL+    +++LDVRNN+L D G ++IC+GL EQ         +    GL  L+LW N I++  MPA+S AL VNR +Q+LNLG+N I SEG+H LR+GLL NR+LLRL L  CRI CEG VA+AE LA++ QL+RLDLRDN I+TAGLMA+  ++ VNKS+ RLDLD+  K++P++K Y E Q   L  I   +Q N+
Sbjct:   22 SSSRKVTFPTDESIVSGYMDPPDPWGKGYNCTTEELVCAYKAACDANGVQPHRHLLEQLQGIDLSVCNDRYEMLSCRNLRLDSRQVEALEEIFKRVQFKTLDFESSGLDEDSAIALFDMIEYYESCCKLNIAHNTRIGLRGWQMCSRMLKKTPCLQTIDLHGIPLSEQSIPALVRSLRIGSTLVTLHLEHSNITGRNLLILVTALRINESLRELLLADNKMTSSDGQHLASLLRNTPTLQMLDVRNNALQDTGCAYICEGLYEQ---------QGGECGLAALVLWHNQISHEAMPAVSAALAVNRHLQTLNLGHNLIGSEGVHLLREGLLRNRTLLRLGLQWCRIACEGAVALAECLAESPQLLRLDLRDNQIRTAGLMALKLALSVNKSLTRLDLDKDIKKEPSMKDYAEQQGALLEAIGALLQRNR 441          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. TrEMBL
Match: A0A1I8HI74 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 421.779 bits (1083), Expect = 1.762e-134
Identity = 220/429 (51.28%), Postives = 307/429 (71.56%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENK 1496
            S  +KV FP ++ IVS Y +  + W +   C+++EL+ +YK AC+   V+P   LLEQL+GID  +C++RY+ML+  N++LD +Q+E +EEIFKRVQFK L+FE++ LD++S+ +LF++IE+YESC KLNI+ N++I   G+  CS+MLKKTP L+ I+L GI  +E +IP L R+LR GS L  LHLE+SNI  +NLLIL +AL++N  +REL LA N+M  SDG  L SLL+    +++LDVRNN+L D G ++IC+GL EQ         +    GL  L+LW N I++  MPA+S AL VNR +Q+LNLG+N I SEG+H LR+GLL NR+LLRL L  CRI CEG VA+AE LA++ QL+RLDLRDN I+TAGL+A+  ++ VNKS+ RLDLD+  K++P++K Y E Q   L  I   +Q N+
Sbjct:   22 SSSRKVTFPTDESIVSGYMDPPDPWGKGYNCTTEELVCAYKAACDANGVQPHRHLLEQLQGIDLSVCNDRYEMLSCRNLRLDSRQVEALEEIFKRVQFKTLDFESSGLDEDSAIALFDMIEYYESCCKLNIAHNTRIGLRGWQMCSRMLKKTPCLQTIDLHGIPLSEQSIPALVRSLRIGSTLVTLHLEHSNITGRNLLILVTALRINESLRELLLADNKMTSSDGQHLASLLRNTPTLQMLDVRNNALQDTGCAYICEGLYEQ---------QGGECGLAALVLWHNQISHEAMPAVSAALAVNRHLQTLNLGHNLIGSEGVHLLREGLLRNRTLLRLGLQWCRIACEGAVALAECLAESPQLLRLDLRDNQIRTAGLIALKLALSVNKSLTRLDLDKDIKKEPSMKDYAEQQGALLEAIGALLQRNR 441          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. TrEMBL
Match: A0A267GHZ2 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031292g1 PE=4 SV=1)

HSP 1 Score: 424.476 bits (1090), Expect = 4.042e-134
Identity = 220/429 (51.28%), Postives = 307/429 (71.56%), Query Frame = 3
Query:  210 SKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENK 1496
            S  +KV FP ++ IVS Y +  + W +   C+++EL+ +YK AC+   V+P   LLEQL+GID  +C++RY+ML+  N++LD +Q+E +EEIFKRVQFK L+FE++ LD++S+ +LF++IE+YESC KLNI+ N++I   G+  CS+MLKKTP L+ I+L GI  +E +IP L R+LR GS L  LHLE+SNI  +NLLIL +AL++N  +REL LA N+M  SDG  L SLL+    +++LDVRNN+L D G ++IC+GL EQ         +    GL  L+LW N I++  MPA+S AL VNR +Q+LNLG+N I SEG+H LR+GLL NR+LLRL L  CRI CEG VA+AE LA++ QL+RLDLRDN I+TAGL+A+  ++ VNKS+ RLDLD+  K++P++K Y E Q   L  I   +Q N+
Sbjct:   22 SSSRKVTFPTDESIVSGYMDPPDPWGKGYNCTTEELVCAYKAACDANGVQPHRHLLEQLQGIDLSVCNDRYEMLSCRNLRLDSRQVEALEEIFKRVQFKTLDFESSGLDEDSAIALFDMIEYYESCCKLNIAHNTRIGLRGWQMCSRMLKKTPCLQTIDLHGIPLSEQSIPALVRSLRIGSTLVTLHLEHSNITGRNLLILVTALRINESLRELLLADNKMTSSDGQHLASLLRNTPTLQMLDVRNNALQDTGCAYICEGLYEQ---------QGGECGLAALVLWHNQISHEAMPAVSAALAVNRHLQTLNLGHNLIGSEGVHLLREGLLRNRTLLRLGLQWCRIACEGAVALAECLAESPQLLRLDLRDNQIRTAGLIALKLALSVNKSLTRLDLDKDIKKEPSMKDYAEQQGALLEAIGALLQRNR 441          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Cavefish
Match: ppp1r37 (protein phosphatase 1 regulatory subunit 37 [Source:NCBI gene;Acc:103028691])

HSP 1 Score: 351.673 bits (901), Expect = 1.603e-105
Identity = 186/426 (43.66%), Postives = 293/426 (68.78%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            K+V FP ++EIVS   E K+ W   +  + +E++ +Y++AC+  N KPIP +L+Q++  D     +R + L+L   KLD K  E +EEIFKRVQFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR   +L +LHLEN+ I  + L++L +ALK+N+++REL+LA N++    D  QLG+LLK N +I++LD+RNN + D GL+++C+GL EQ              GL+ L+LW+N +++NGM  L+ AL   +S+++LNLG+N I +EG+H L+DGL+ NRS+LRL L   ++ CEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S ++KVN S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:  210 KRVTFPSDEEIVSGSVEPKDPWRHAQNVTVEEILNAYRQACQKLNCKPIPKVLKQIQ--DLTDLTQRNECLDLKGEKLDYKACESLEEIFKRVQFKLVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTSSLQYLDARNTPLLDHSAPFVARALRISGSLAVLHLENAGISGRPLMLLATALKMNMNLRELYLADNKLNGLQDSAQLGNLLKFNYNIQILDLRNNHILDSGLAYVCEGLKEQR------------KGLVTLVLWNNQLSHNGMGYLAAALPCTQSLETLNLGHNAIGNEGVHKLKDGLIANRSVLRLGLASTKLACEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNTSLLRLDLDREPKKE-TVKSFIETQRALLAEIQNGCKRN 620          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Cavefish
Match: si:dkey-288a3.2 (si:dkey-288a3.2 [Source:ZFIN;Acc:ZDB-GENE-131127-351])

HSP 1 Score: 130.568 bits (327), Expect = 9.882e-33
Identity = 108/291 (37.11%), Postives = 175/291 (60.14%), Query Frame = 3
Query:  543 SSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRM-VPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDAL--KVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
             ++SL E++ +YES + L+IS +S +   G+ A S++L+++  L  ++   I   E     L++AL   S L +LHLEN+ +  K L  L  ALK N  ++EL+L  N +    D +QLG LLK NR +  +D+ NN++ D  L  +CDGL                 GL  L+L +N IT++GM  L   L     R++++L+L  N + ++G+H L++ L++NRS+ +LSL    ITCE  V +AE LA+++ L  +D+R N + TAGLMA++ ++++N S++RLDLDQ
Sbjct:    1 GASSLMEMMLYYESATHLDISSSSSMGVSGWQALSRLLRQSGCLWRLDACNIPLLEFPAQALSKAL-LSSRLTVLHLENTCLSGKPLFTL-GALKKNAALQELYLCDNELNSYQDAMQLGELLKYNRTLRTIDLGNNAVSD-SLEELCDGL------------RVEKSGLRTLVLSNNQITHHGMTHLKSVLFQPFLRTLETLDLSKNNLENQGVHMLKEPLMMNRSITQLSLAAVGITCEA-VVLAEVLAESRVLQTVDVRQNRVLTAGLMALALALRINHSVLRLDLDQ 275          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Cavefish
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:103024894])

HSP 1 Score: 89.7373 bits (221), Expect = 5.530e-18
Identity = 91/308 (29.55%), Postives = 144/308 (46.75%), Query Frame = 3
Query:  546 SASLFEIIEFYESCSKLNISFNS----KIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGL--------------LC-LILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVS 1412
            SASL  ++     CSKL +  N      ++ +G    S +  K   ++ + L     +   I PL+RAL     L IL L  +NI +K    L  AL++N  +  ++L SN +       L  +L+ NR +  L+V+ N +G  G+  I + L +  + Q +    NH   L              LC L L SNS++  GM AL+ AL+ NR + +LNL  N I  EG   +   L  N +L  L L    +      A+A+ L     +  LDL++N +   G++A++ ++K N S+  L L  VS
Sbjct:  443 SASLKRLLPQLLYCSKLRMENNGFKDDAMELLG----SLLSAKDCHIQFLSLADSSISSKGIKPLSRALLVNRTLTILDLHGNNIGTKGAKTLAEALRMNQIIVSINLQSNSIEDEGARALAEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVLYLQGVS 746          

HSP 2 Score: 58.151 bits (139), Expect = 3.539e-8
Identity = 90/345 (26.09%), Postives = 145/345 (42.03%), Query Frame = 3
Query:  387 KGID----AKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQF-KNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
            KGI     A L +    +L+L    +  K  + + E  +  Q   ++N ++ S++DE + +L E+++     + LN+  N  I   G    ++ LKK   L+ + +      +     L +AL     L  L L+++++  K +  LT AL+                             NR +  L++R NS+G  G   I   L E      ++E          L L  N +      AL+ +L  N SIQ L+L  N +  EG+  L   L  N SL  L L        G  A+AE L   + L  LDLR N I   G  A+S ++K N+S+  L+L +
Sbjct:  498 KGIKPLSRALLVNRTLTILDLHGNNIGTKGAKTLAEALRMNQIIVSINLQSNSIEDEGARALAEVLQSNRKLTSLNVQKNG-IGPDGVKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKGMKALTLALR----------------------------SNRGLTTLNLRENSIGVEGAKAIARALQEN---STLRE----------LDLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVLYLQGVSAGKAGAEALAEALMVNQTLCTLDLRGNSIGMGGAKALSSALKTNRSLRSLNLQE 800          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Cavefish
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:103024894])

HSP 1 Score: 87.8113 bits (216), Expect = 2.396e-17
Identity = 95/314 (30.25%), Postives = 144/314 (45.86%), Query Frame = 3
Query:  546 SASLFEIIEFYESCSKLNISFNS----KIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGL--------------LC-LILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNV 1430
            SASL  ++     CSKL +  N      ++ +G    S +  K   ++ + L     +   I PL+RAL     L IL L  +NI +K    L  AL++N  +  ++L SN +       L  +L+ NR +  L+V+ N +G  G+  I + L +  + Q +    NH   L              LC L L SNS++  GM AL+ AL+ NR + +LNL  N I  EG   +   L  N +L  L L    +  EG  AIA  +   + L  L L+ N +K     A++ S+  N SI  LDL + +  D  V
Sbjct:  443 SASLKRLLPQLLYCSKLRMENNGFKDDAMELLG----SLLSAKDCHIQFLSLADSSISSKGIKPLSRALLVNRTLTILDLHGNNIGTKGAKTLAEALRMNQIIVSINLQSNSIEDEGARALAEVLQSNRKLTSLNVQKNGIGPDGVKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLTANLLHDEGVTAIAGSVKVNRALRSLHLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGDEGV 752          

HSP 2 Score: 68.1662 bits (165), Expect = 3.183e-11
Identity = 78/322 (24.22%), Postives = 133/322 (41.30%), Query Frame = 3
Query:  465 IECMEEIFKRVQ-FKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGL-CEQFLPQPIKEDENHGPGL-------------LCLI-LWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKS 1382
            ++ + E  K+ Q  ++LN  +  L D  + +L + +    +   L++  NS +   G  A +  L+    L  + L+           + RAL+  S L+ L L  + +  + +  +  ++K+N  +R LHL  N M       L   L  N  I+LLD++ N+LGD G+  +   L     L     +  + G                LC + L  NSI   G  ALS ALK NRS++SLNL  N                             +  +G + IA  L    QL  ++L+ N I  +G   +S +++ + +
Sbjct:  584 VKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNS-VSDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLTANLLHDEGVTAIAGSVKVNRALRSLHLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVLYLQGVSAGKAGAEALAEALMVNQTLCTLDLRGNSIGMGGAKALSSALKTNRSLRSLNLQENS----------------------------LGMDGAIFIATALRGNHQLTYINLQGNGIGESGAKVVSDAIRTDAA 876          

HSP 3 Score: 66.6254 bits (161), Expect = 9.499e-11
Identity = 93/345 (26.96%), Postives = 153/345 (44.35%), Query Frame = 3
Query:  387 KGID----AKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQF-KNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
            KGI     A L +    +L+L    +  K  + + E  +  Q   ++N ++ S++DE + +L E+++     + LN+  N  I   G    ++ LKK   L+ + +      +     L +AL     L  L L+++++  K +  LT AL+ N  +  L+L  N +       +   L+ N  +  LD+  N L D G++ I            +K +      L  L L  N +      AL+ +L  N SIQ L+L  N +  EG+  L   L  N SL  L L        G  A+AE L   + L  LDLR N I   G  A+S ++K N+S+  L+L +
Sbjct:  498 KGIKPLSRALLVNRTLTILDLHGNNIGTKGAKTLAEALRMNQIIVSINLQSNSIEDEGARALAEVLQSNRKLTSLNVQKNG-IGPDGVKRIAESLKKNQILQDLNVSSNHLGDLGTVALAQALVVNHTLCTLSLQSNSVSDKGMKALTLALRSNRGLTTLNLRENSIGVEGAKAIARALQENSTLRELDLTANLLHDEGVTAIAG---------SVKVNR----ALRSLHLQWNFMKIGAAKALAQSLHSNSSIQLLDLQENTLGDEGVVALAGALKANSSLAVLYLQGVSAGKAGAEALAEALMVNQTLCTLDLRGNSIGMGGAKALSSALKTNRSLRSLNLQE 828          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Cavefish
Match: lrrc74a (leucine rich repeat containing 74A [Source:NCBI gene;Acc:103039030])

HSP 1 Score: 57.7658 bits (138), Expect = 4.105e-8
Identity = 96/372 (25.81%), Postives = 144/372 (38.71%), Query Frame = 3
Query:  192 TFDESDSKKKKVHFPEEKEIVSDYFES-----KNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADT 1292
            + DE DS       P E E+  D +++         +  K  S+ EL   Y +AC+   V P+   L  L      L H  + +  L    L +  +  M     R++  + NF    L  E +  L E++    +   L++S N+ +Q  G    +KML     ++ I+L G  F E                             +      A   N  ++EL L+ N+     G  LG +L  N  IELLD+  N L   G    C GL                  L  L L  N     G  AL +ALK N ++  L+L NN I +EG+  L  GL  N +L  L L    +T EG +A+   + +T
Sbjct:   12 SLDERDS-------PYETELEEDEWDTDLEPEAERKSTGKGMSTAEL---YLQACKLVGVIPVSYFLRNLGCATINLNH--HGLGPLGGKALAIALVTDMHTT--RLELAD-NF----LLGEGARYLVEMLRANFTIQNLDLS-NNHLQSAGAECVAKMLLDNISIKSIKLSGNGFIE----------------------------DDAKWFAEAFSSNYRVKELDLSHNQFSGKGGEYLGQMLANNEGIELLDLSWNHLRMKGAVAFCAGLKVNVT-------------LKQLDLSWNGFGNEGALALGEALKFNNTLVDLDLSNNRITNEGVGMLCRGLEANDTLRTLKLAYNSLTVEGALALIRVVKNT 322          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Sea Lamprey
Match: ppp1r37 (protein phosphatase 1, regulatory subunit 37 [Source:NCBI gene;Acc:562516])

HSP 1 Score: 310.071 bits (793), Expect = 2.915e-98
Identity = 168/382 (43.98%), Postives = 266/382 (69.63%), Query Frame = 3
Query:  315 LIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKK-TPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRM-VPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQ 1454
            +I +YK++C   NV+PIP L++QL+ I       R + L+L   KLD K  E +EE+FKR+QF  +N E+TSLD++ +++LF++IE+YES   LNISFN  I   G+ A + ++KK T  L+ ++ +     +  +P + RALR  S+L +LH+EN+++  + LL+L SALK+N+ +REL+LA N++    D +QLG+L+K N  ++LLD+RNNSL D GL H+C+GL EQ              GL+ L++W+N +++ GM  ++  L   +S+++LNLG+N + +EG+  L+DGL+ NRS+LRL L C RITCEG VA+AE++A++ +++R+DLR+ND+KT GLMA++ ++KVN S+ RLDLD+  K++  VK + +TQ+
Sbjct:    9 IITAYKESCLKLNVRPIPKLIKQLQDITE--LSGRVECLDLRAEKLDYKTCETLEEVFKRLQFNEVNAESTSLDEDGASALFDMIEYYESAVHLNISFNKHIGVRGWQAAANLMKKKTGSLQILDARNSPVADQALPFVARALRMHSSLAVLHMENASMSGRPLLLLVSALKMNLALRELYLADNKLNSGQDALQLGNLVKFNSTLQLLDLRNNSLMDSGLQHVCEGLKEQ------------KKGLVTLVVWNNQLSHVGMQYVASMLPCTQSLETLNLGHNSVGNEGVLRLKDGLIANRSVLRLGLACTRITCEGAVAVAEFIAESPRIVRIDLRENDVKTGGLMALALALKVNTSLARLDLDKEPKKE-QVKSFLDTQK 375          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002444.1 (pep scaffold:Pmarinus_7.0:GL480979:320698:340261:-1 gene:ENSPMAG00000002230.1 transcript:ENSPMAT00000002444.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 1.141e-11
Identity = 63/226 (27.88%), Postives = 107/226 (47.35%), Query Frame = 3
Query:  726 LNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLD 1403
            L+R L+    ++ L++ ++ +     + L SAL+ N  +  L+L+ N +       L + + VNR ++ LD+ +N +GD G  H+   +      + +          L   LW     +NG  A++ A+ VNRS++ L+L    +  EG   LR+ L  NR+L  L L  CR+   G  A+A  L     L  L L  N I   G +A+  +++ NK     DL+
Sbjct:   22 LSRMLKENCYIEELNVSSNRMGVGGAMALCSALRENSTITSLNLSGNNLTDEAARHLHNAMSVNRSLKELDMSHNRIGDAGAMHVAHMIANSETLETLD---------LAWSLWR----WNGSVAIAAAISVNRSVRWLSLAWTGVGIEGALALREALQRNRTLHHLDLSSCRVDERGARALAAGLQTNVALRSLKLALNPIMAEGALALLSAIQKNKRSTMQDLN 234          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Nematostella
Match: EDO35578 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL42])

HSP 1 Score: 272.322 bits (695), Expect = 4.373e-84
Identity = 163/405 (40.25%), Postives = 247/405 (60.99%), Query Frame = 3
Query:  219 KKVHFPEEKEI-VSDYFESKNYWTEHK--FCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDP 1424
            +KV FP++  + +    E K+ W + K    S  E+I SY+ AC     KP   L++QL+  ++   HER D+++L   KLD K  E +EE+F++V+ + L+ ENT+LDDE                                        TP LE ++L+  ++TE +IP L R+L+ G NL +LH+E +N+  K L +L +A+K N ++R+L L  NR+VPSDG  LG++LK N+ + LLD+RNN L D+GL+H+C+GL EQ              GL  L+LW+N +T+ GM AL++AL    S+Q+LNLG+N + +EGIH L+ GLL N+SL R+ L   R++ EG +A+AE +AD+K L+RLDLR+ND    GLMA++ S+KVN S++R+DLD+  K++P
Sbjct:    1 RKVSFPDDHALPLFHSQEPKDPWQDGKDVTFSFSEVIESYRTACNISKTKPCDKLIKQLEACES--FHERIDVIDLRGTKLDQKSCESLEEVFRQVRTRTLDLENTNLDDE----------------------------------------TPCLEYLDLRHTVWTEQSIPLLGRSLKLGCNLVVLHMEATNLTGKPLFLLATAVKTNHNLRDLFLGDNRLVPSDGQCLGTMLKSNKTLRLLDLRNNQLQDMGLAHLCEGLAEQ-----------RDAGLQTLVLWNNQLTFQGMSALANALVALTSLQTLNLGHNRLTNEGIHLLKSGLLGNKSLQRVGLLNTRLSSEGIIALAEVVADSKTLLRLDLRENDPYVGGLMALALSLKVNNSLVRIDLDKELKKEP 352          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Nematostella
Match: EDO43196 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RZ93])

HSP 1 Score: 84.7297 bits (208), Expect = 1.944e-17
Identity = 85/315 (26.98%), Postives = 141/315 (44.76%), Query Frame = 3
Query:  465 IECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKG--IMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLD 1403
            I   + +      + L+ E   + DE + ++ + +    +  KL++  N KI   G  A +K L     LE ++L+G  I   +     + +AL   S L+ L LE + I  +  + +  AL  N  + +L L  N++     I +   L  N  +E LD+  N +GD G   I   L      +              L L  N I   G  A++ AL  N +++ L+L  N I  EG   +   L+ N +L +L L   +I  EG +AIA+ L     L +LDL  N I   G +AI+ ++  N ++ +LDL+
Sbjct:   22 IAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGN-KIGDDGAIAIAKALMTNSTLEKLDLEGNKIGDEDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKK-------------LDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLE 322          

HSP 2 Score: 83.9593 bits (206), Expect = 4.005e-17
Identity = 89/339 (26.25%), Postives = 146/339 (43.07%), Query Frame = 3
Query:  390 GIDAKLCHERYDMLNLSNVKLDLK----------QIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVN 1376
            G D  +   +  M N +  KLDL+           I   + +      + L+ E   + DE + ++ + +    +  KL++  N KI   G  A +K L     LE ++L+G    +     + +AL   S LK L LE + I  +  + +  AL  N  +++L L  N++     I +   L  N  ++ LD+  N +GD G   I   L      +              L L  N I   G  A++ AL  N +++ L+L  N I  EG   +   L+ N +L +L L   +I  EG +AIA+ L     L +LDL  N I   G +AI+ ++  N
Sbjct:   73 GDDGAIAIAKALMTNSTLEKLDLEGNKIGDEDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGN-KIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKK-------------LDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTN 397          

HSP 3 Score: 83.5741 bits (205), Expect = 5.798e-17
Identity = 80/290 (27.59%), Postives = 134/290 (46.21%), Query Frame = 3
Query:  534 DDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLD 1403
            +DE + ++ + +    +  KL++  N KI   G  A +K L     LE ++L+G    +     + +AL   S L+ L LE + I  +  + +  AL  N  +++L L  N++     I +   L  N  ++ LD+  N +GD G   I   L      +              L L  N I   G  A++ AL  N +++ L+L  N I  EG   +   L+ N +L +L L   +I  EG +AIA+ L     L +LDL  N I   G +AI+ ++  N ++ +LDL+
Sbjct:  103 EDEGAIAIAKALMTNSTLEKLDLEGN-KIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKK-------------LDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLE 378          

HSP 4 Score: 83.1889 bits (204), Expect = 6.233e-17
Identity = 83/303 (27.39%), Postives = 138/303 (45.54%), Query Frame = 3
Query:  501 FKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKN--LLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLD 1403
             + L+ E   + DE + ++ + +    +  KL++  N KI   G  A +K L     LE ++L+G    +     + +AL   S L+ L LE + I  ++   + +  AL  N  + +L L  N++     I +   L  N  +E LD+  N +GD G   I   L      +              L L  N I   G  A++ AL  N +++ L+L  N I  EG   +   L+ N +L +L L   +I  EG +AIA+ L     L +LDL  N I   G +AI+ ++  N ++ +LDL+
Sbjct:    6 LEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGN-KIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDDGAIAIAKALMTNSTLEKLDLEGNKIGDEDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEK-------------LDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLE 294          

HSP 5 Score: 78.5666 bits (192), Expect = 2.220e-15
Identity = 80/276 (28.99%), Postives = 125/276 (45.29%), Query Frame = 3
Query:  582 SCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSD--GIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLD 1403
            +  KL++  N KI   G  A +K L     LE ++L+G    +     + +AL   S L+ L LE + I     + +  AL  N  + +L L  N++   D   I +   L  N  +E LD+  N +GD G   I   L      +              L L  N I   G  A++ AL  N +++ L+L  N I  EG   +   L+ N +L +L L   +I  EG +AIA+ L     L +LDL  N I   G +AI+ ++  N ++ +LDL+
Sbjct:    5 TLEKLDLEGN-KIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDDGAIAIAKALMTNSTLEKLDLEGNKIGDEDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLEK-------------LDLEGNKIGDEGAIAIAKALMTNSTLEKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLEGNKIGDEGAIAIAKALMTNSTLKKLDLE 266          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Nematostella
Match: EDO31618 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXE5])

HSP 1 Score: 69.3218 bits (168), Expect = 2.199e-12
Identity = 71/285 (24.91%), Postives = 122/285 (42.81%), Query Frame = 3
Query:  327 YKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEII--EFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEG 1175
            Y KAC    + P    L QL   +  L H          V + L Q           +   LN  N  + +E +  + +++   FY   ++L+IS N+ +Q  G  A S+ML++   +  + L    F E  + P+  A++    LK L+L  +  C     +L  AL  N+ +  L+L  N++     + +G  L+ N  ++ LD+  N   D G   + + L    L   + E          L + SN I+  G  +++  L  N ++Q L +G NP  S+G
Sbjct:    5 YLKACSSLGLVPCSPFLRQLHKPEMNLMHYNLGPRGAEAVAVALMQ---------NTKVLTLNISNNDIQEEGAIYISKMLTENFY--ITELDIS-NNNLQSQGAYAVSEMLRQNSEILEVNLSENKFIEKDVEPIVEAMKDNYTLKSLNLSRNAFCEIGGQLLGPALDANVGLEYLNLRWNQIRRKGAVAIGYGLRHNCSLKSLDLSWNGFADDGAKSVGEALA---LNTTLTE----------LDISSNRISGEGASSIAAGLAKNETLQILRIGINPFLSQG 264          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Nematostella
Match: EDO39935 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8F3])

HSP 1 Score: 66.2402 bits (160), Expect = 1.074e-11
Identity = 55/193 (28.50%), Postives = 89/193 (46.11%), Query Frame = 3
Query:  645 SKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPG----------------LLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEG 1175
            +KMLK   FL C++L         +  + R L     L+ L+L N+ +  K++ +L   LK N H++ L+L  N +    G  LG+ L  N  +E LDV  N +   G   +  G+ E +  + +K   N G G                L+ L + + SI  +G   +   LKVN++++ L +G NP  S G
Sbjct:   70 AKMLKGNCFLTCLDLSANKIGGKGVRAIARMLLQNVTLEELNLMNNKLIDKDVSLLCGTLKENFHLKVLNLGGNNLGEQAGGMLGATLSANNVLEELDVSWNRILGKGAIALAKGVKESWSLKVLKLAWN-GFGDVGAQALRKVLEENETLIHLDITNASIGLDGAGHIGKGLKVNKTLKILKVGRNPFLSAG 261          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Nematostella
Match: EDO36360 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIU1])

HSP 1 Score: 64.3142 bits (155), Expect = 8.561e-11
Identity = 65/288 (22.57%), Postives = 119/288 (41.32%), Query Frame = 3
Query:  324 SYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGL 1187
            +Y +AC+  NV PI  LL+ ++  +  L H                 +     + K    + L+ E   L +E + S  ++++     ++LN++ N+ +   G  A  +++  + ++  ++L    F +     L++ L     LK L L +++       +L   +  N  +  L L+ N +     I +   +  N  I +LD+  N   D G + + + L              H   L  L L  N IT  G  ALS  L VN +++ L +G NP  S+G   L
Sbjct:   16 AYLRACKTLNVTPISSLLQNIENKEISLAHHGLGPRG---------AMALARALAKSTTVEKLDLEENRLQEEGAESFAKMLKDNCYITELNLAGNA-MSSRGAKAMGEIIGYSNYIRKLDLSFNNFIDKDGEALSKGLAATLTLKELRLSHNSFSESGGELLAPGIAANYSVEYLDLSWNHLRMKGAIAICKAMGENASIRVLDLSWNGFADDGAAAMGNAL-------------RHNSTLKELDLSHNRITKKGAFALSKGLAVNDALRVLKIGFNPFESDGTMAL 280          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Medaka
Match: ppp1r37 (protein phosphatase 1 regulatory subunit 37 [Source:NCBI gene;Acc:101163101])

HSP 1 Score: 345.895 bits (886), Expect = 1.063e-103
Identity = 184/427 (43.09%), Postives = 293/427 (68.62%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGI-DAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            K+V FP +++IVS   E K+ W   +  + +E++  YK+AC+  N KPIP +L+Q++ + D  L   R + L+L   KLD K  E +EEI KRVQFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR   +L +LHLEN+ +  + L++L +ALK+N+++REL+LA N++    D  QLG+LLK N +I++LD+RNN + D GL+++C+GL EQ              GL+ L+LW+N +T++GM  L+ AL   +S+++LNLG+N + +EG+H L+DGL+ NRS+LRL L   +++CEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S ++KVN S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:  165 KRVTFPSDEDIVSGAVEPKDPWRHAQNVTVEEILTCYKQACQKLNCKPIPKVLQQIQELKDLTL---RNECLDLKGEKLDYKACESLEEILKRVQFKTVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTSSLQYLDARNTPLLDHSAPFVARALRISGSLAVLHLENAGLSGRPLMLLATALKMNMNLRELYLADNKLNGLQDSAQLGNLLKFNYNIQILDLRNNHILDSGLAYLCEGLKEQRK------------GLVTLVLWNNQLTHSGMGYLAAALPCTQSLETLNLGHNSVSNEGVHKLKDGLIANRSVLRLGLASTKLSCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNTSLLRLDLDREPKKE-TVKSFIETQRALLAEIQNGCKRN 575          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Medaka
Match: ppp1r37 (protein phosphatase 1 regulatory subunit 37 [Source:NCBI gene;Acc:101163101])

HSP 1 Score: 345.895 bits (886), Expect = 2.562e-103
Identity = 184/427 (43.09%), Postives = 293/427 (68.62%), Query Frame = 3
Query:  219 KKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGI-DAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVP-SDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQEN 1493
            K+V FP +++IVS   E K+ W   +  + +E++  YK+AC+  N KPIP +L+Q++ + D  L   R + L+L   KLD K  E +EEI KRVQFK ++ E T+LD++ +++LF++IE+YES + LNISFN  I   G+ A + M++KT  L+ ++ +     + + P + RALR   +L +LHLEN+ +  + L++L +ALK+N+++REL+LA N++    D  QLG+LLK N +I++LD+RNN + D GL+++C+GL EQ              GL+ L+LW+N +T++GM  L+ AL   +S+++LNLG+N + +EG+H L+DGL+ NRS+LRL L   +++CEG VA+AE++A++ +L+RLDLR+N+IKT GLMA+S ++KVN S++RLDLD+  K++  VK + ETQ+  L  IQ   + N
Sbjct:  224 KRVTFPSDEDIVSGAVEPKDPWRHAQNVTVEEILTCYKQACQKLNCKPIPKVLQQIQELKDLTL---RNECLDLKGEKLDYKACESLEEILKRVQFKTVDLEQTNLDEDGASALFDMIEYYESATHLNISFNKHIGTRGWQAAAHMMRKTSSLQYLDARNTPLLDHSAPFVARALRISGSLAVLHLENAGLSGRPLMLLATALKMNMNLRELYLADNKLNGLQDSAQLGNLLKFNYNIQILDLRNNHILDSGLAYLCEGLKEQRK------------GLVTLVLWNNQLTHSGMGYLAAALPCTQSLETLNLGHNSVSNEGVHKLKDGLIANRSVLRLGLASTKLSCEGAVAVAEFIAESPRLLRLDLRENEIKTGGLMALSLALKVNTSLLRLDLDREPKKE-TVKSFIETQRALLAEIQNGCKRN 634          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Medaka
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:101165263])

HSP 1 Score: 92.8189 bits (229), Expect = 8.439e-19
Identity = 98/340 (28.82%), Postives = 162/340 (47.65%), Query Frame = 3
Query:  399 AKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQ-FKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKM---LKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
            A L +     LNL N  +  K  + + E  K  Q   ++NF+N S+++E + +L E+++    C++  +S N +   IG +   ++   LK    L  + L      +     L  AL+    L  L L++++I ++ +  LT AL+ N  +  L+L  N +       +   LK N  ++ LD+  N L D G+         Q +   IK ++    GL  L L  N I       L++AL  N +I+ L+L  N I +EG+  L + L VN SL  L L        G VA+AE L + + L  LDLR N I   G  A+++++K N+S+  L+L +
Sbjct:  757 ALLVNRTLTYLNLRNNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQ----CNRKLVSLNVRKNKIGADGAKRIADALKMNQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGIEGAKNMAQALKENNSLQNLDLTANLLHDEGV---------QAISAAIKFNQ----GLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALMENQSLQTLDLRGNSIGMEGAKALANALKCNRSLKSLNLQE 1079          

HSP 2 Score: 81.6481 bits (200), Expect = 2.346e-15
Identity = 75/226 (33.19%), Postives = 112/226 (49.56%), Query Frame = 3
Query:  723 PLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDL 1400
             L+RAL     L  L+L N+NI SK    L  ALK+N  +  ++  +N +       L  +L+ NR +  L+VR N +G  G   I D L         K ++     L  LIL SN +   G  AL++ALK+N+++ SL L +N I + G+  L   L  N  L+ L+L    I  EG   +A+ L +   L  LDL  N +   G+ AIS ++K N+ +  L L
Sbjct:  753 ALSRALLVNRTLTYLNLRNNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKNKIGADGAKRIADAL---------KMNQT----LTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGIEGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHL 965          

HSP 3 Score: 72.7886 bits (177), Expect = 1.129e-12
Identity = 81/323 (25.08%), Postives = 144/323 (44.58%), Query Frame = 3
Query:  489 KRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQE 1457
            K    + L+  + ++ ++ + +L   +    + + LN+  N+ I   G    ++ LK    L  I  +     E     L   L+C   L  L++  + I +     +  ALK+N  + +L L SN++     + L   LK+N+ +  L +++NS+ + G++ +   L  +F         NH  GL+ L L  NSI   G   ++ ALK N S+Q+L+L  N +  EG+  +   +  N+ L  L L    I       +A  L     +  LDL++N I   G++ ++ ++KVN S+  L L  VS          E   E
Sbjct:  732 KDCHIQKLSLADNAISNKGAKALSRALLVNRTLTYLNLR-NNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKNKIGADGAKRIADALKMNQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKAL--RF---------NH--GLVTLNLRENSIGIEGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALME 1040          

HSP 4 Score: 62.003 bits (149), Expect = 2.230e-9
Identity = 61/223 (27.35%), Postives = 102/223 (45.74%), Query Frame = 3
Query:  507 NLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEG 1175
            +L  ++ S+ +    +L + + F      LN+  NS I   G    ++ LK+   L+ ++L   +  +  +  ++ A++    L  LHL+ + I S    +L +AL  N  ++ L L  N +     I L   LKVN  ++ L ++  S G  G   + + L E                L  L L  NSI   G  AL++ALK NRS++SLNL  N +  +G
Sbjct:  878 SLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENS-IGIEGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALMEN-------------QSLQTLDLRGNSIGMEGAKALANALKCNRSLKSLNLQENSLGMDG 1086          

HSP 5 Score: 57.7658 bits (138), Expect = 4.307e-8
Identity = 60/248 (24.19%), Postives = 111/248 (44.76%), Query Frame = 3
Query:  765 LHLENSNICSKNLLILTSALKL-NIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENKKAV 1505
            L LEN+N     + +L S L   + H+++L LA N +       L   L VNR +  L++RNN++G  G          +FL + +K ++     L  +   +NSI   G  AL++ L+ NR + SLN+  N                            +I  +G   IA+ L   + L +L L  N +   G +A++ ++K+N++++ L L   S  +  +   T+  + +  ++   ++EN   +
Sbjct:  710 LRLENNNFKDDVMELLGSLLSAKDCHIQKLSLADNAISNKGAKALSRALLVNRTLTYLNLRNNNIGSKG---------AKFLAEALKMNQV----LTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKN----------------------------KIGADGAKRIADALKMNQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGI 916          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Medaka
Match: nlrc3 (NLR family CARD domain containing 3 [Source:NCBI gene;Acc:101165263])

HSP 1 Score: 92.8189 bits (229), Expect = 8.439e-19
Identity = 98/340 (28.82%), Postives = 162/340 (47.65%), Query Frame = 3
Query:  399 AKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQ-FKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKM---LKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQ 1406
            A L +     LNL N  +  K  + + E  K  Q   ++NF+N S+++E + +L E+++    C++  +S N +   IG +   ++   LK    L  + L      +     L  AL+    L  L L++++I ++ +  LT AL+ N  +  L+L  N +       +   LK N  ++ LD+  N L D G+         Q +   IK ++    GL  L L  N I       L++AL  N +I+ L+L  N I +EG+  L + L VN SL  L L        G VA+AE L + + L  LDLR N I   G  A+++++K N+S+  L+L +
Sbjct:  757 ALLVNRTLTYLNLRNNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQ----CNRKLVSLNVRKNKIGADGAKRIADALKMNQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGIEGAKNMAQALKENNSLQNLDLTANLLHDEGV---------QAISAAIKFNQ----GLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALMENQSLQTLDLRGNSIGMEGAKALANALKCNRSLKSLNLQE 1079          

HSP 2 Score: 81.6481 bits (200), Expect = 2.346e-15
Identity = 75/226 (33.19%), Postives = 112/226 (49.56%), Query Frame = 3
Query:  723 PLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDL 1400
             L+RAL     L  L+L N+NI SK    L  ALK+N  +  ++  +N +       L  +L+ NR +  L+VR N +G  G   I D L         K ++     L  LIL SN +   G  AL++ALK+N+++ SL L +N I + G+  L   L  N  L+ L+L    I  EG   +A+ L +   L  LDL  N +   G+ AIS ++K N+ +  L L
Sbjct:  753 ALSRALLVNRTLTYLNLRNNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKNKIGADGAKRIADAL---------KMNQT----LTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGIEGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHL 965          

HSP 3 Score: 72.7886 bits (177), Expect = 1.129e-12
Identity = 81/323 (25.08%), Postives = 144/323 (44.58%), Query Frame = 3
Query:  489 KRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQE 1457
            K    + L+  + ++ ++ + +L   +    + + LN+  N+ I   G    ++ LK    L  I  +     E     L   L+C   L  L++  + I +     +  ALK+N  + +L L SN++     + L   LK+N+ +  L +++NS+ + G++ +   L  +F         NH  GL+ L L  NSI   G   ++ ALK N S+Q+L+L  N +  EG+  +   +  N+ L  L L    I       +A  L     +  LDL++N I   G++ ++ ++KVN S+  L L  VS          E   E
Sbjct:  732 KDCHIQKLSLADNAISNKGAKALSRALLVNRTLTYLNLR-NNNIGSKGAKFLAEALKMNQVLTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKNKIGADGAKRIADALKMNQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKAL--RF---------NH--GLVTLNLRENSIGIEGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALME 1040          

HSP 4 Score: 62.003 bits (149), Expect = 2.230e-9
Identity = 61/223 (27.35%), Postives = 102/223 (45.74%), Query Frame = 3
Query:  507 NLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEG 1175
            +L  ++ S+ +    +L + + F      LN+  NS I   G    ++ LK+   L+ ++L   +  +  +  ++ A++    L  LHL+ + I S    +L +AL  N  ++ L L  N +     I L   LKVN  ++ L ++  S G  G   + + L E                L  L L  NSI   G  AL++ALK NRS++SLNL  N +  +G
Sbjct:  878 SLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENS-IGIEGAKNMAQALKENNSLQNLDLTANLLHDEGVQAISAAIKFNQGLTSLHLQWNFIKSTATKVLANALMSNATIKLLDLQENAIGNEGVIFLAEALKVNTSLQTLCLQGVSAGTSGAVALAEALMEN-------------QSLQTLDLRGNSIGMEGAKALANALKCNRSLKSLNLQENSLGMDG 1086          

HSP 5 Score: 57.7658 bits (138), Expect = 4.307e-8
Identity = 60/248 (24.19%), Postives = 111/248 (44.76%), Query Frame = 3
Query:  765 LHLENSNICSKNLLILTSALKL-NIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENKKAV 1505
            L LEN+N     + +L S L   + H+++L LA N +       L   L VNR +  L++RNN++G  G          +FL + +K ++     L  +   +NSI   G  AL++ L+ NR + SLN+  N                            +I  +G   IA+ L   + L +L L  N +   G +A++ ++K+N++++ L L   S  +  +   T+  + +  ++   ++EN   +
Sbjct:  710 LRLENNNFKDDVMELLGSLLSAKDCHIQKLSLADNAISNKGAKALSRALLVNRTLTYLNLRNNNIGSKG---------AKFLAEALKMNQV----LTSINFQNNSIEEEGAQALAEVLQCNRKLVSLNVRKN----------------------------KIGADGAKRIADALKMNQTLTKLILCSNQLGDKGTVALAEALKLNQTLLSLQLQSNSISNRGMTALTKALRFNHGLVTLNLRENSIGI 916          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Planmine SMEST
Match: SMESG000078284.1 (SMESG000078284.1)

HSP 1 Score: 1359.36 bits (3517), Expect = 0.000e+0
Identity = 702/702 (100.00%), Postives = 702/702 (100.00%), Query Frame = 3
Query:   63 MSENEDFSSIEDFSYMNIVNPDKMENKLVNQVFQMRDLPPETNTFDESDSKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENKKAVIRSQDADLAHNCQSLSTNTHAVNETSDSQIMLPNDPYAETMIPDQSNMETSNASLDNISDVVDEPHIQIDGPXXXXXXXXXXXXXXXXXXXXFSTEMETSFELPSIISNNFSNKVLSPTDTILEFNKSSEFILSGCDGDNDYIVENKQEMLNTSDNCKPELITMEVEDNVKEKNAVSNLLSKSEIEENVHYNYDSNNIFDGLFDENIIVKESNHSESFEAV 2168
            MSENEDFSSIEDFSYMNIVNPDKMENKLVNQVFQMRDLPPETNTFDESDSKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGLLVNRSLLRLSLPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENKKAVIRSQDADLAHNCQSLSTNTHAVNETSDSQIMLPNDPYAETMIPDQSNMETSNASLDNISDVVDEPHIQIDGPSLEENVLINNNVVIANLSLSFSTEMETSFELPSIISNNFSNKVLSPTDTILEFNKSSEFILSGCDGDNDYIVENKQEMLNTSDNCKPELITMEVEDNVKEKNAVSNLLSKSEIEENVHYNYDSNNIFDGLFDENIIVKESNHSESFEAV
Sbjct:    1 MSENEDFSSIEDFSYMNIVNPDKMENKLVNQVFQMRDLPPETNTFDESDSKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGLLVNRSLLRLSLPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENKKAVIRSQDADLAHNCQSLSTNTHAVNETSDSQIMLPNDPYAETMIPDQSNMETSNASLDNISDVVDEPHIQIDGPSLEENVLINNNVVIANLSLSFSTEMETSFELPSIISNNFSNKVLSPTDTILEFNKSSEFILSGCDGDNDYIVENKQEMLNTSDNCKPELITMEVEDNVKEKNAVSNLLSKSEIEENVHYNYDSNNIFDGLFDENIIVKESNHSESFEAV 702          
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Planmine SMEST
Match: SMESG000078284.1 (SMESG000078284.1)

HSP 1 Score: 1260.74 bits (3261), Expect = 0.000e+0
Identity = 651/657 (99.09%), Postives = 653/657 (99.39%), Query Frame = 3
Query:   63 MSENEDFSSIEDFSYMNIVNPDKMENKLVNQVFQMRDLPPETNTFDESDSKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGXXXXXXXXXXXXPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENKKAVIRSQDADLAHNCQSLSTNTHAVNETSDSQIMLPNDPYAETMIPDQSNMETSNASLDNISDVVDEPHIQIDGPXXXXXXXXXXXXXXXXXXXXFSTEMETSFELPSIISNNFSNKVLSPTDTILEFNKSSEFILSGCDGDNDYIVENKQEMLNTSDNCKPELITMEVEDNVKEKNAV 2033
            MSENEDFSSIEDFSYMNIVNPDKMENKLVNQVFQMRDLPPETNTFDESDSKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGLLVNRSLLRLSLPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENKKAVIRSQDADLAHNCQSLSTNTHAVNETSDSQIMLPNDPYAETMIPDQSNMETSNASLDNISDVVDEPHIQIDGPSLEENVLINNNVVIANLSLSFSTEMETSFELPSIISNNFSNKVLSPTDTILEFNKSSEFILSGCDGDNDYIVENKQEMLNTSDNCKPELITMEVEDN  +K  +
Sbjct:    1 MSENEDFSSIEDFSYMNIVNPDKMENKLVNQVFQMRDLPPETNTFDESDSKKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKPIPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNLNFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKKTPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLILTSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGDIGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDALKVNRSIQSLNLGNNPIFSEGIHGLRDGLLVNRSLLRLSLPCCRITCEGGVAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVSKRDPNVKGYTETQQESLRIIQERVQENKKAVIRSQDADLAHNCQSLSTNTHAVNETSDSQIMLPNDPYAETMIPDQSNMETSNASLDNISDVVDEPHIQIDGPSLEENVLINNNVVIANLSLSFSTEMETSFELPSIISNNFSNKVLSPTDTILEFNKSSEFILSGCDGDNDYIVENKQEMLNTSDNCKPELITMEVEDNKLKKMCI 657          

HSP 2 Score: 72.7886 bits (177), Expect = 7.138e-13
Identity = 37/39 (94.87%), Postives = 38/39 (97.44%), Query Frame = 1
Query: 2050 NQKLKKMCIIIMIRTIFLMDYSMKILLLKKVTIVNHLKL 2166
            + KLKKMCIIIMIRTIFLMDYSMKILLLKKVTIVNHLKL
Sbjct:  649 DNKLKKMCIIIMIRTIFLMDYSMKILLLKKVTIVNHLKL 687          
The following BLAST results are available for this feature:
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP1R372.324e-10443.59protein phosphatase 1 regulatory subunit 37 [Sourc... [more]
PPP1R371.161e-2641.88protein phosphatase 1 regulatory subunit 37 [Sourc... [more]
NLRC31.403e-1426.26NLR family CARD domain containing 3 [Source:HGNC S... [more]
NLRC31.492e-1426.26NLR family CARD domain containing 3 [Source:HGNC S... [more]
NLRC33.177e-1227.14NLR family CARD domain containing 3 [Source:HGNC S... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
F28C1.33.916e-7536.12Protein phosphatase 1 regulatory subunit 37 homolo... [more]
F28C1.34.417e-7536.12Protein phosphatase 1 regulatory subunit 37 homolo... [more]
F28C1.31.256e-7337.28Protein phosphatase 1 regulatory subunit 37 homolo... [more]
F28C1.31.706e-7337.28Protein phosphatase 1 regulatory subunit 37 homolo... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG316356.948e-2828.52gene:FBgn0051635 transcript:FBtr0079326[more]
CG316357.568e-2828.52gene:FBgn0051635 transcript:FBtr0113410[more]
CG316358.017e-2828.52gene:FBgn0051635 transcript:FBtr0331188[more]
CG316358.210e-2828.52gene:FBgn0051635 transcript:FBtr0331192[more]
CG316351.247e-2628.46gene:FBgn0051635 transcript:FBtr0331189[more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r374.668e-10643.90protein phosphatase 1, regulatory subunit 37 [Sour... [more]
si:dkey-288a3.26.297e-4837.15si:dkey-288a3.2 [Source:ZFIN;Acc:ZDB-GENE-131127-3... [more]
nlrc31.113e-1427.76NLR family, CARD domain containing 3 [Source:ZFIN;... [more]
lrrc74b4.720e-823.51leucine rich repeat containing 74B [Source:ZFIN;Ac... [more]
lrrc74a2.001e-724.85leucine rich repeat containing 74A [Source:ZFIN;Ac... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nt5e2.198e-10243.195'-nucleotidase, ecto (CD73) [Source:Xenbase;Acc:X... [more]
nt5e2.448e-10243.195'-nucleotidase, ecto (CD73) [Source:Xenbase;Acc:X... [more]
nt5e4.974e-10243.195'-nucleotidase, ecto (CD73) [Source:Xenbase;Acc:X... [more]
nt5e8.162e-10243.195'-nucleotidase, ecto (CD73) [Source:Xenbase;Acc:X... [more]
nt5e1.200e-10143.195'-nucleotidase, ecto (CD73) [Source:Xenbase;Acc:X... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp1r371.800e-10542.63protein phosphatase 1, regulatory subunit 37 [Sour... [more]
Nlrc32.544e-1227.60NLR family, CARD domain containing 3 [Source:MGI S... [more]
Nlrc34.424e-1128.99NLR family, CARD domain containing 3 [Source:MGI S... [more]
Lrrc74b5.594e-1025.00leucine rich repeat containing 74B [Source:MGI Sym... [more]
Nlrc34.414e-932.02NLR family, CARD domain containing 3 [Source:MGI S... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1L994|PPR37_DANRE4.611e-10543.90Protein phosphatase 1 regulatory subunit 37 OS=Dan... [more]
sp|Q8BKR5|PPR37_MOUSE1.259e-10442.63Protein phosphatase 1 regulatory subunit 37 OS=Mus... [more]
sp|B2RYF1|PPR37_RAT5.636e-10442.89Protein phosphatase 1 regulatory subunit 37 OS=Rat... [more]
sp|O75864|PPR37_HUMAN1.116e-10343.59Protein phosphatase 1 regulatory subunit 37 OS=Hom... [more]
sp|A7Z026|PPR37_BOVIN8.798e-10343.59Protein phosphatase 1 regulatory subunit 37 OS=Bos... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8GAD26.943e-13551.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GK467.901e-13551.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HPS98.523e-13551.52Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8HI741.762e-13451.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GHZ24.042e-13451.28Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp1r371.603e-10543.66protein phosphatase 1 regulatory subunit 37 [Sourc... [more]
si:dkey-288a3.29.882e-3337.11si:dkey-288a3.2 [Source:ZFIN;Acc:ZDB-GENE-131127-3... [more]
nlrc35.530e-1829.55NLR family CARD domain containing 3 [Source:NCBI g... [more]
nlrc32.396e-1730.25NLR family CARD domain containing 3 [Source:NCBI g... [more]
lrrc74a4.105e-825.81leucine rich repeat containing 74A [Source:NCBI ge... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ppp1r372.915e-9843.98protein phosphatase 1, regulatory subunit 37 [Sour... [more]
ENSPMAT00000002444.11.141e-1127.88pep scaffold:Pmarinus_7.0:GL480979:320698:340261:-... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO355784.373e-8440.25Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO431961.944e-1726.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316182.199e-1224.91Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO399351.074e-1128.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO363608.561e-1122.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ppp1r371.063e-10343.09protein phosphatase 1 regulatory subunit 37 [Sourc... [more]
ppp1r372.562e-10343.09protein phosphatase 1 regulatory subunit 37 [Sourc... [more]
nlrc38.439e-1928.82NLR family CARD domain containing 3 [Source:NCBI g... [more]
nlrc38.439e-1928.82NLR family CARD domain containing 3 [Source:NCBI g... [more]
back to top
BLAST of Phosphatase 1 regulatory subunit 37-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000078284.10.000e+0100.00SMESG000078284.1[more]
SMESG000078284.17.138e-1399.09SMESG000078284.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023831 ID=SMED30023831|Name=Phosphatase 1 regulatory subunit 37-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2507bp
GGAATGGATGTAAAGTTGTTTATTTTATAAATTCTATATAATATATGTTT
CCTAATTAAAGAATGTCTGAAAATGAAGATTTTTCTAGCATAGAAGATTT
TTCATATATGAATATTGTTAATCCCGATAAAATGGAAAATAAATTAGTAA
ACCAAGTGTTCCAAATGAGAGATTTACCACCTGAAACAAACACTTTTGAT
GAAAGTGATTCCAAGAAGAAAAAAGTTCATTTTCCAGAAGAGAAAGAAAT
TGTTTCTGATTATTTTGAATCTAAGAATTATTGGACAGAACATAAATTTT
GTTCTTCCGATGAATTAATCTATTCTTATAAAAAAGCTTGTGAACATTGT
AATGTAAAACCAATTCCAATACTATTAGAACAATTGAAAGGAATTGATGC
AAAATTGTGTCATGAAAGATATGATATGTTAAATTTGTCGAATGTAAAAT
TGGATCTAAAACAAATAGAATGCATGGAAGAAATATTTAAACGTGTCCAA
TTTAAAAATCTTAATTTTGAAAATACAAGTTTAGACGATGAGTCTTCTGC
ATCTTTATTTGAGATTATTGAATTTTATGAATCTTGTTCGAAATTAAATA
TTTCGTTTAACTCAAAAATTCAGTACATTGGATTTAATGCCTGTTCTAAA
ATGTTGAAAAAAACTCCTTTTCTGGAATGTATCGAATTAAAAGGAATAAT
GTTCACTGAAACTACAATACCACCTTTAAATCGAGCCTTACGCTGTGGCA
GTAATTTGAAAATCCTACATTTAGAAAATTCAAATATTTGCTCGAAAAAT
TTATTAATTTTAACTTCGGCACTCAAGTTGAATATTCACATGAGGGAGCT
TCATTTAGCAAGTAACCGAATGGTGCCTTCAGATGGAATTCAATTGGGAT
CATTGCTCAAAGTCAATAGGCATATCGAATTACTCGATGTTCGAAATAAT
TCACTGGGGGACATTGGACTGAGTCATATTTGTGATGGACTCTGTGAACA
ATTTCTGCCTCAGCCAATTAAAGAAGATGAAAATCACGGTCCAGGATTGT
TATGTCTTATATTGTGGAGTAATTCAATTACTTACAATGGGATGCCTGCT
TTATCGGATGCCCTTAAAGTGAACAGAAGCATACAGTCACTTAATTTAGG
AAACAATCCGATTTTCAGTGAAGGTATACATGGTCTTCGTGATGGTCTTC
TAGTCAATCGGTCGCTATTGCGATTAAGTTTGCCTTGTTGTCGCATAACC
TGTGAAGGTGGAGTAGCGATTGCTGAATATTTGGCAGACACAAAACAGTT
AATGCGACTTGATTTGCGCGATAATGACATAAAGACAGCTGGCTTAATGG
CAATCTCTCATTCAATGAAAGTTAATAAAAGTATTATCAGATTAGATCTT
GATCAAGTATCTAAACGAGATCCAAATGTAAAAGGTTATACTGAAACTCA
ACAGGAATCATTACGCATAATTCAAGAAAGGGTTCAGGAGAATAAAAAGG
CTGTGATTAGAAGTCAGGATGCTGATTTAGCTCATAATTGTCAAAGTCTT
TCAACTAACACCCATGCAGTAAACGAAACTTCTGACTCCCAGATTATGTT
GCCAAATGATCCCTATGCAGAAACCATGATTCCAGATCAATCGAATATGG
AAACTAGTAATGCATCTTTGGACAACATATCAGACGTCGTCGATGAGCCA
CATATACAAATTGATGGTCCTTCTCTCGAGGAAAATGTATTAATTAATAA
TAATGTTGTGATAGCGAATTTGTCCTTGAGTTTTTCAACTGAGATGGAAA
CTAGCTTTGAATTGCCTTCTATTATTTCCAATAATTTTTCTAATAAAGTT
CTTTCCCCAACCGATACGATTTTAGAATTTAATAAATCTTCAGAATTTAT
ATTGTCCGGTTGTGATGGTGACAATGATTACATTGTTGAAAACAAACAAG
AAATGTTAAATACTTCTGACAACTGTAAACCAGAACTCATAACTATGGAA
GTGGAAGATAATGTAAAGGAGAAAAATGCTGTTAGTAATTTGTTAAGTAA
ATCAGAAATTGAAGAAAATGTGCATTATAATTATGATTCGAACAATATTT
TTGATGGATTATTCGATGAAAATATTATTGTTAAAGAAAGTAACCATAGT
GAATCATTTGAAGCTGTAGTAAATGGAGATAACATTTATCTGGATGAGCC
GACAAAAAGAGATCTCAATTTTGTTGAACATATTCTTTCTAATGAAGCAA
TCGATAATTAAATTTTATTTGTGAATAATGTAAATTGTGATGCAATTCAA
ATGTCTCTAAACACCGCTCCGTTCCTTCATTCCAAAAATATTGCGCAACC
TATTGAAAATGTGATCATTACCTTTATACATTTATGAGTATAACATTCTT
TTGGATTTGGAAGATTATTTGTTAAATATTTGCCTATTTTTATTTGGCTT
TTACTATCTTACATATGCCATTGTTTAATACTTGAATCCTGTAAAATATG
AATAAAC
back to top

protein sequence of SMED30023831-orf-1

>SMED30023831-orf-1 ID=SMED30023831-orf-1|Name=SMED30023831-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=733bp
MSENEDFSSIEDFSYMNIVNPDKMENKLVNQVFQMRDLPPETNTFDESDS
KKKKVHFPEEKEIVSDYFESKNYWTEHKFCSSDELIYSYKKACEHCNVKP
IPILLEQLKGIDAKLCHERYDMLNLSNVKLDLKQIECMEEIFKRVQFKNL
NFENTSLDDESSASLFEIIEFYESCSKLNISFNSKIQYIGFNACSKMLKK
TPFLECIELKGIMFTETTIPPLNRALRCGSNLKILHLENSNICSKNLLIL
TSALKLNIHMRELHLASNRMVPSDGIQLGSLLKVNRHIELLDVRNNSLGD
IGLSHICDGLCEQFLPQPIKEDENHGPGLLCLILWSNSITYNGMPALSDA
LKVNRSIQSLNLGNNPIFSEGIHGLRDGLLVNRSLLRLSLPCCRITCEGG
VAIAEYLADTKQLMRLDLRDNDIKTAGLMAISHSMKVNKSIIRLDLDQVS
KRDPNVKGYTETQQESLRIIQERVQENKKAVIRSQDADLAHNCQSLSTNT
HAVNETSDSQIMLPNDPYAETMIPDQSNMETSNASLDNISDVVDEPHIQI
DGPSLEENVLINNNVVIANLSLSFSTEMETSFELPSIISNNFSNKVLSPT
DTILEFNKSSEFILSGCDGDNDYIVENKQEMLNTSDNCKPELITMEVEDN
VKEKNAVSNLLSKSEIEENVHYNYDSNNIFDGLFDENIIVKESNHSESFE
AVVNGDNIYLDEPTKRDLNFVEHILSNEAIDN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0006812cation transport
GO:0055085transmembrane transport
GO:0098655cation transmembrane transport
GO:0010923negative regulation of phosphatase activity
Vocabulary: molecular function
TermDefinition
GO:0008324cation transmembrane transporter activity
GO:0005515protein binding
GO:0004864protein phosphatase inhibitor activity
GO:0019902phosphatase binding
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
GO:0005575cellular_component
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000140anterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR032675LRR_dom_sf
IPR001611Leu-rich_rpt
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableSMARTSM00368LRR_RI_2coord: 354..381
e-value: 1.2
score: 16.5
coord: 410..437
e-value: 0.88
score: 17.5
coord: 285..312
e-value: 0.049
score: 22.8
coord: 326..353
e-value: 40.0
score: 5.9
coord: 257..284
e-value: 4.8
score: 12.4
coord: 382..409
e-value: 3.8E-4
score: 29.8
NoneNo IPR availablePANTHERPTHR24112FAMILY NOT NAMEDcoord: 63..600
NoneNo IPR availableSUPERFAMILYSSF52047RNI-likecoord: 71..449
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 235..311
e-value: 9.3E-11
score: 43.4
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 94..234
e-value: 1.0E-8
score: 36.7
IPR032675Leucine-rich repeat domain superfamilyGENE3DG3DSA:3.80.10.10coord: 312..485
e-value: 6.9E-27
score: 95.7
IPR001611Leucine-rich repeatPFAMPF13516LRR_6coord: 413..432
e-value: 0.016
score: 15.2
coord: 382..404
e-value: 1.7
score: 8.9
coord: 285..307
e-value: 0.042
score: 13.9