Nuclear pore complex protein Nup188

Overview
NameNuclear pore complex protein Nup188
Smed IDSMED30023829
Length (bp)5446
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Nuclear pore complex protein Nup188 (SMED30023829) t-SNE clustered cells

Violin plots show distribution of expression levels for Nuclear pore complex protein Nup188 (SMED30023829) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Nuclear pore complex protein Nup188 (SMED30023829) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Nuclear pore complex protein Nup188 (SMED30023829) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023829

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023829SMESG000039965.1 SmedASXL_017527SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023829SMESG000039965.1 SmedASXL_017527SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Human
Match: NUP188 (nucleoporin 188 [Source:HGNC Symbol;Acc:HGNC:17859])

HSP 1 Score: 87.0409 bits (214), Expect = 3.549e-16
Identity = 213/1067 (19.96%), Postives = 427/1067 (40.02%), Query Frame = 1
Query:  166 LDYYKRYDEKSIEIFKKS-EVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYK-----LIITEIGQDKTSYEFKDENSEEEMAIQGSEEKIELLETM-LIAAYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMF-VSTDDLSS--HFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCV-LFDLLSLLCYGIHLNSLELKI---RQDLVNTMC-VIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLSMINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDG----DCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLATAVECRIQ-KDLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTTDDSNLIKQIVSVRN-------LFPNAQLSAERIISNQSLIEK-----IWNSELTPINIKIIQSYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQSSSDVTDLAMNCLSFIAEILSIKPNSYLALSDSRRARLELIQKVTHEILVNTSSVIKTILAISCMDVDILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQL-----IGPGKSVTNVTSSGFYNSCITIVSHFKFDDEISVKLTC------SVSKLFSSLWINECYSAIEILKNM-NIWATVITPI 3228
            L YYK     S E  K + +V   +K   +++S++L L  E    + + YL  D +   + ++++L     + +++ KI  +YYEER  ++R + +    +++E     +    V   +    L K+++  Y+     L  TE    +T      E       +Q   E+  LLE + L  AY      D +       MF+E GFG    QT  +     +    +RI    +LI++E   ++++   + DD      F  DG     ++  +  FG  P    +LL  +L+R+    +  +S     G    TAI +L +F YL  +L S       + G+       C+ ++ LLS +     L SLEL     +QD+++T C V+  P +      ++P  SG   +L+ +   FP  LS +  +   +      ++      V  F++ +S++++    K     V+   DG   R    +       Q  L       G    D   YL    + W   YS W +   E+E+   ++S               + +    +R++ I+D +   +   +   D ++ I   ++ +++  +  I     ++ + +N     L      N  K    +R+         P + LS  ++IS + +        + NSE       +  ++L+    L++ +       G++P       + FV++ +L + +K  + S      +    L  I  IL++   + L  S +   +   I  + +         +  I+ I    +D+++     S+   G  G  + L + V LA ++   +           I ++  S+V+            S L   +S  G    ++    +  + +++ + +   + R+++ +LK +   + +S+ ACLG   + IRD FL    S +ED  ++  + +FL+  V   + G+++L     +  G   +   S G + SC+  V     D +   +  C      +      +LW +   SA+ +L+     W  + +P+
Sbjct:   47 LSYYKPPSPSSAEKVKANKDVASPLKELGLRISKFLGLDEEQSVQLLQCYLQEDYRGTRDSVKTVLQDERQSQALILKIADYYYEERTCILRCVLHLLTYFQDE-----RHPYRVEYADCVDKLEKELVSKYRQQFEELYKTEAPTWETHGNLMTERQVSRWFVQCLREQSMLLEIIFLYYAYFEMAPSDLLVLTK---MFKEQGFGS--RQTNRHLVDETMDPFVDRIGYFSALILVEGMDIESLHKCALDDRRELHQFAQDGLICQDMDCLMLTFGDIPHHAPVLLAWALLRHTLNPEETSSVVRKIGG---TAI-QLNVFQYLTRLLQS-----LASGGNDCTTSTACMCVYGLLSFV-----LTSLELHTLGNQQDIIDTACEVLADPSLPELFWGTEP-TSGLGIILDSVCGMFPHLLSPLLQLLRALVSGKSTAKK-----VYSFLDKMSFYNE--LYKHKPHDVISHEDGTLWRRQTPKLLYPLGGQTNLRIPQGTVGQVMLDDRAYL----VRWEYSYSSWTLFTCEIEMLLHVVS--------------TADVIQHCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRLTTVISPPVDVIASCVN----CLTVLAARNPAKVWTDLRHTGFLPFVAHPVSSLS--QMISAEGMNAGGYGNLLMNSEQPQGEYGVTIAFLRLITTLVKGQLGSTQSQGLVPC------VMFVLKEMLPSYHKWRYNSHGVREQIGCLILELIHAILNLCHETDLHSSHTPSLQFLCICSLAY---TEAGQTVINIMGIGVDTIDMVMAAQPRSDGAEG-QGQGQLLIKTVKLAFSVTNNV-----------IRLKPPSNVV------------SPLEQALSQHG----AHGNNLIAVLAKYIYHKHDPALPRLAIQLLKRLATVAPMSVYACLGNDAAAIRDAFLTRLQSKIEDMRIKVMILEFLTVAVET-QPGLIELFLNLEVKDGSDGSKEFSLGMW-SCLHAVLEL-IDSQQQDRYWCPPLLHRAAIAFLHALWQDRRDSAMLVLRTKPKFWENLTSPL 1017          
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Zebrafish
Match: nup188 (nucleoporin 188 [Source:ZFIN;Acc:ZDB-GENE-030131-7184])

HSP 1 Score: 73.559 bits (179), Expect = 2.801e-12
Identity = 130/565 (23.01%), Postives = 229/565 (40.53%), Query Frame = 1
Query:  166 LDYYKRYDEKSIEIFKK-SEVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEE-FLILSKIILSVSGFENKTFLFKKILESYK-----LIITEIGQDKTSYEFKDENSEEEMAIQGSEEKIELLETM-LIAAYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVST----DDLSSHFLIDGKSLSK-LNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLELKIRQDLVNTMC-VIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLSMINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYL------SKSLTLDGDCEGYLMDGN----------IAWAVHYSIWDVIGAEVELTRRLIS------HGQR 1746
            L +YK+    + +  K   +    +K F +++S+ L L  +    V + YL  D +   N L+++L     + +++ KI  +YYEERL ++R + +    +++E     ++    VS  E      K ++ +Y+     L  +E    +T      E       +Q  +E+  LLE + L  AY      D  TF     +F+E GFG    QT  +     +    ERI    SL+++E  GMD  F+      D    H   D + + K ++  +  FG  P  G +LL   L+R+    +  +S     G        +LG+F YL +ML +   + +      +     C+ + LLS +      ++  L  +Q L+N  C V+  P +     ES+P N G   +L+     FP     +  +      SD  +  +    V  F++ +S++++    K     V+   DG   R         RQ    L        +L +   C G + +G           + W   YS W +   E+E+   ++S      H QR
Sbjct:   45 LSFYKQPSTSAADKLKADKDTPQALKDFGLRISKLLGLDEQQSVQVLQCYLQEDYRGTRNTLKAVLQDERQSQALLLKIADYYYEERLCVLRCVLHLLTYFQDERHPYRAEYSNCVSKLE------KDLVSNYRQQFETLSKSEAPTWETHGNLMTERQVSRWFVQCLKEQALLLEILFLYYAYFEMSPNDLCTFTR---LFKEQGFG--QRQTNRHLVDKSMDTLVERIGYFSSLMLVE--GMDIDFLHKCALEDRTEQHQFYDQQDVCKEMDQMLLTFGDIPHHGPVLLAWVLLRHTLRPEEVSSVIRRLG----NTTLQLGVFQYLTNMLQA---LGSAGNNCTVSTARMCI-YGLLSFVITSFEEDT--LGSQQHLINAACEVLGAPSLAELFWESKP-NMGLGVILDSAVGVFPYKTGPLLQLL-TALLSDKSTAKK----VYTFLDKMSFYTEA--YKHRPNDVISREDGTLWR---------RQTHKLLYPLGVGQTNLRMPQGCFGQVCEGKQLSVGEQGFLVRWEYSYSSWTLFTCEIEMLLHVVSTADVLVHCQR 569          
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:NCBI gene;Acc:100135081])

HSP 1 Score: 98.5969 bits (244), Expect = 8.429e-20
Identity = 225/1060 (21.23%), Postives = 424/1060 (40.00%), Query Frame = 1
Query:  166 LDYYKRYDEKSIEIFKKSE-VKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYA---FCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQD-KTSYEFKDENSEEEMAIQGSEEKIELLETMLIA----AYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVS--TDDLSSH-FLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLELKIRQDLVNT-MCVIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLS-MINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDG----DCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLATAVECRIQ-KDLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTTDDSNLIKQIVSVRNLFPNAQLSAERIISNQSLIEKIWNS----ELTPINIKIIQSYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQSSSDVTDLAMNCLSFIAEILSIKPNSYLALSDSRRARLELIQKVTHEILVNTSSVIKTILAISCMDVD----ILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVTNVTSSGFYN----SCITIVSHF--KFDDEISVK---LTCSVSKLFSSLWINECYSAIEILKNM-NIWATVITPI 3228
            L YY+     S    K ++ +   ++   ++LS++L L  E   ++ + YLL D +     ++ +      + ++M K+  +YYEER+SL+R + Y    F D K  +   ++    V   E K  LF K L+ ++ +  E     +T   F  E       +Q   E+  LLE + +     A S  D         +  +F+E GFG  L    L      +    ERI     LI LE   ++ +     +D    H F  + +   +++  +   G  P  G +LL  +L+R     D  T    +   M  TAI +L +F YL  ML S          S   L V+  L  +L+      +L    L+ +QDLV+T   V   P +       +P  +G   +L+ +   FP +LS ++ +   L+ KS         + V  F++ +S +++    K   ++  +  +  + R + K    +   Q  L       G    D  G+L    + W   YS W +   E+E+   ++S               + +  Q +R++ I+D +   +   +   D ++ I   ++ +++  +  +      L + ++     L T   + +   +     L   A   +  IIS + +    + S    E +     I  S+L+    L++ +       G++P       I FV+R +L N ++  + S      L    LS I  IL++ P    + S         +Q +    L NT +  + ++ I  + VD    ++L Q   S    G  G  + L + + LA ++   +           I ++  SS I            S L   ++  G    ++    +  + +++ + Y   + R+++ +LK +   + +S+ ACLG   + IRD FL      +ED  ++  + +FL+  V   + G+++L    +       S  Y+    SC+ +V       D E S     L  S      +LW +   SA+ +L+   N W  + +P+
Sbjct:   22 LAYYRPPSTSSTGKVKANKNLSPALQELGLRLSKFLGLDEEQSVELLQTYLLYDYRGTQESVKGVPQDERQSQALMLKMVDYYYEERISLLRCVLYILNYFQDDKHPY--SAEFSKCVEMMEQKE-LFGKYLKQFESLCREEAPTWETHGNFMTERQVSRWFVQRLREQAMLLEIIFLYFACFAASPSD------LLALTKLFKEQGFGCRLQNRHL--VEPSMDPLVERIGYFSVLIFLEALDIETLMTCSLSDKTEQHPFSSEEQVCKEMDSVLVTLGDAPHHGPVLLAWALLRFALNADKVTP---TVRKMGSTAI-QLHIFQYLTRMLQSLRSGENNCTTSTACLCVYTFLTFVLT------NLEEQVLQSQQDLVDTAFQVFAAPNLPDLFWNMEP-TAGLGILLDSVVGMFPFHLSPLLKLFTALVSKSS-------AKKVYSFLDRMSSYTEHYRHKPHDILSHED-ETLWKRQTPKVLYALGLGQTNLRIPQGTIGQVMADEHGFL----VRWEYSYSCWTLFTCEIEMLLHVVS--------------TADVIHQCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRLTTVMNPPMDFLSSCVDCLAA-LATRMPAKVWIDLRHTGFLPFAANPVSGHIISTEGMNAGGYGSLFGIEQSQGEYSITLSFLRLVTTLVKGQLGSTQSQGLVP------CILFVLREMLPNYHRWRYNSHGVREQLGFQILSLIHAILNLSPEEEESTSTPN------LQSLCIFSLTNTEAG-QAVINIMGVGVDTLNAVMLTQAGSS----GTEGQGQMLMQTIKLAFSITNNV-----------IRLKPLSSAI------------SPLEHALTQHG----AHGNNLIAVLAKYIYHKYDPSLPRLAIQLLKRLAMVAPMSVYACLGSDAAAIRDAFLSRLRDNIEDMQIKIMILEFLTVAVET-QPGLIELFLNLEVKDTNEGSKEYSLGEWSCLQVVLKLIDSQDPESSWGAPLLHRSAIAFLHALWQDRRDSAMTVLRTKPNFWENLTSPL 987          
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:NCBI gene;Acc:100135081])

HSP 1 Score: 98.5969 bits (244), Expect = 9.499e-20
Identity = 225/1060 (21.23%), Postives = 424/1060 (40.00%), Query Frame = 1
Query:  166 LDYYKRYDEKSIEIFKKSE-VKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYA---FCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQD-KTSYEFKDENSEEEMAIQGSEEKIELLETMLIA----AYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVS--TDDLSSH-FLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLELKIRQDLVNT-MCVIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLS-MINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDG----DCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLATAVECRIQ-KDLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTTDDSNLIKQIVSVRNLFPNAQLSAERIISNQSLIEKIWNS----ELTPINIKIIQSYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQSSSDVTDLAMNCLSFIAEILSIKPNSYLALSDSRRARLELIQKVTHEILVNTSSVIKTILAISCMDVD----ILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVTNVTSSGFYN----SCITIVSHF--KFDDEISVK---LTCSVSKLFSSLWINECYSAIEILKNM-NIWATVITPI 3228
            L YY+     S    K ++ +   ++   ++LS++L L  E   ++ + YLL D +     ++ +      + ++M K+  +YYEER+SL+R + Y    F D K  +   ++    V   E K  LF K L+ ++ +  E     +T   F  E       +Q   E+  LLE + +     A S  D         +  +F+E GFG  L    L      +    ERI     LI LE   ++ +     +D    H F  + +   +++  +   G  P  G +LL  +L+R     D  T    +   M  TAI +L +F YL  ML S          S   L V+  L  +L+      +L    L+ +QDLV+T   V   P +       +P  +G   +L+ +   FP +LS ++ +   L+ KS         + V  F++ +S +++    K   ++  +  +  + R + K    +   Q  L       G    D  G+L    + W   YS W +   E+E+   ++S               + +  Q +R++ I+D +   +   +   D ++ I   ++ +++  +  +      L + ++     L T   + +   +     L   A   +  IIS + +    + S    E +     I  S+L+    L++ +       G++P       I FV+R +L N ++  + S      L    LS I  IL++ P    + S         +Q +    L NT +  + ++ I  + VD    ++L Q   S    G  G  + L + + LA ++   +           I ++  SS I            S L   ++  G    ++    +  + +++ + Y   + R+++ +LK +   + +S+ ACLG   + IRD FL      +ED  ++  + +FL+  V   + G+++L    +       S  Y+    SC+ +V       D E S     L  S      +LW +   SA+ +L+   N W  + +P+
Sbjct:   46 LAYYRPPSTSSTGKVKANKNLSPALQELGLRLSKFLGLDEEQSVELLQTYLLYDYRGTQESVKGVPQDERQSQALMLKMVDYYYEERISLLRCVLYILNYFQDDKHPY--SAEFSKCVEMMEQKE-LFGKYLKQFESLCREEAPTWETHGNFMTERQVSRWFVQRLREQAMLLEIIFLYFACFAASPSD------LLALTKLFKEQGFGCRLQNRHL--VEPSMDPLVERIGYFSVLIFLEALDIETLMTCSLSDKTEQHPFSSEEQVCKEMDSVLVTLGDAPHHGPVLLAWALLRFALNADKVTP---TVRKMGSTAI-QLHIFQYLTRMLQSLRSGENNCTTSTACLCVYTFLTFVLT------NLEEQVLQSQQDLVDTAFQVFAAPNLPDLFWNMEP-TAGLGILLDSVVGMFPFHLSPLLKLFTALVSKSS-------AKKVYSFLDRMSSYTEHYRHKPHDILSHED-ETLWKRQTPKVLYALGLGQTNLRIPQGTIGQVMADEHGFL----VRWEYSYSCWTLFTCEIEMLLHVVS--------------TADVIHQCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRLTTVMNPPMDFLSSCVDCLAA-LATRMPAKVWIDLRHTGFLPFAANPVSGHIISTEGMNAGGYGSLFGIEQSQGEYSITLSFLRLVTTLVKGQLGSTQSQGLVP------CILFVLREMLPNYHRWRYNSHGVREQLGFQILSLIHAILNLSPEEEESTSTPN------LQSLCIFSLTNTEAG-QAVINIMGVGVDTLNAVMLTQAGSS----GTEGQGQMLMQTIKLAFSITNNV-----------IRLKPLSSAI------------SPLEHALTQHG----AHGNNLIAVLAKYIYHKYDPSLPRLAIQLLKRLAMVAPMSVYACLGSDAAAIRDAFLSRLRDNIEDMQIKIMILEFLTVAVET-QPGLIELFLNLEVKDTNEGSKEYSLGEWSCLQVVLKLIDSQDPESSWGAPLLHRSAIAFLHALWQDRRDSAMTVLRTKPNFWENLTSPL 1011          
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:NCBI gene;Acc:100135081])

HSP 1 Score: 98.2117 bits (243), Expect = 1.197e-19
Identity = 225/1060 (21.23%), Postives = 424/1060 (40.00%), Query Frame = 1
Query:  166 LDYYKRYDEKSIEIFKKSE-VKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYA---FCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQD-KTSYEFKDENSEEEMAIQGSEEKIELLETMLIA----AYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVS--TDDLSSH-FLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLELKIRQDLVNT-MCVIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLS-MINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDG----DCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLATAVECRIQ-KDLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTTDDSNLIKQIVSVRNLFPNAQLSAERIISNQSLIEKIWNS----ELTPINIKIIQSYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQSSSDVTDLAMNCLSFIAEILSIKPNSYLALSDSRRARLELIQKVTHEILVNTSSVIKTILAISCMDVD----ILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVTNVTSSGFYN----SCITIVSHF--KFDDEISVK---LTCSVSKLFSSLWINECYSAIEILKNM-NIWATVITPI 3228
            L YY+     S    K ++ +   ++   ++LS++L L  E   ++ + YLL D +     ++ +      + ++M K+  +YYEER+SL+R + Y    F D K  +   ++    V   E K  LF K L+ ++ +  E     +T   F  E       +Q   E+  LLE + +     A S  D         +  +F+E GFG  L    L      +    ERI     LI LE   ++ +     +D    H F  + +   +++  +   G  P  G +LL  +L+R     D  T    +   M  TAI +L +F YL  ML S          S   L V+  L  +L+      +L    L+ +QDLV+T   V   P +       +P  +G   +L+ +   FP +LS ++ +   L+ KS         + V  F++ +S +++    K   ++  +  +  + R + K    +   Q  L       G    D  G+L    + W   YS W +   E+E+   ++S               + +  Q +R++ I+D +   +   +   D ++ I   ++ +++  +  +      L + ++     L T   + +   +     L   A   +  IIS + +    + S    E +     I  S+L+    L++ +       G++P       I FV+R +L N ++  + S      L    LS I  IL++ P    + S         +Q +    L NT +  + ++ I  + VD    ++L Q   S    G  G  + L + + LA ++   +           I ++  SS I            S L   ++  G    ++    +  + +++ + Y   + R+++ +LK +   + +S+ ACLG   + IRD FL      +ED  ++  + +FL+  V   + G+++L    +       S  Y+    SC+ +V       D E S     L  S      +LW +   SA+ +L+   N W  + +P+
Sbjct:   46 LAYYRPPSTSSTGKVKANKNLSPALQELGLRLSKFLGLDEEQSVELLQTYLLYDYRGTQESVKGVPQDERQSQALMLKMVDYYYEERISLLRCVLYILNYFQDDKHPY--SAEFSKCVEMMEQKE-LFGKYLKQFESLCREEAPTWETHGNFMTERQVSRWFVQRLREQAMLLEIIFLYFACFAASPSD------LLALTKLFKEQGFGCRLQNRHL--VEPSMDPLVERIGYFSVLIFLEALDIETLMTCSLSDKTEQHPFSSEEQVCKEMDSVLVTLGDAPHHGPVLLAWALLRFALNADKVTP---TVRKMGSTAI-QLHIFQYLTRMLQSLRSGENNCTTSTACLCVYTFLTFVLT------NLEEQVLQSQQDLVDTAFQVFAAPNLPDLFWNMEP-TAGLGILLDSVVGMFPFHLSPLLKLFTALVSKSS-------AKKVYSFLDRMSSYTEHYRHKPHDILSHED-ETLWKRQTPKVLYALGLGQTNLRIPQGTIGQVMADEHGFL----VRWEYSYSCWTLFTCEIEMLLHVVS--------------TADVIHQCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRLTTVMNPPMDFLSSCVDCLAA-LATRMPAKVWIDLRHTGFLPFAANPVSGHIISTEGMNAGGYGSLFGIEQSQGEYSITLSFLRLVTTLVKGQLGSTQSQGLVP------CILFVLREMLPNYHRWRYNSHGVREQLGFQILSLIHAILNLSPEEEESTSTPN------LQSLCIFSLTNTEAG-QAVINIMGVGVDTLNAVMLTQAGSS----GTEGQGQMLMQTIKLAFSITNNV-----------IRLKPLSSAI------------SPLEHALTQHG----AHGNNLIAVLAKYIYHKYDPSLPRLAIQLLKRLAMVAPMSVYACLGSDAAAIRDAFLSRLRDNIEDMQIKIMILEFLTVAVET-QPGLIELFLNLEVKDTNEGSKEYSLGEWSCLQVVLKLIDSQDPESSWGAPLLHRSAIAFLHALWQDRRDSAMTVLRTKPNFWENLTSPL 1011          
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:NCBI gene;Acc:100135081])

HSP 1 Score: 90.8929 bits (224), Expect = 1.824e-17
Identity = 225/1060 (21.23%), Postives = 417/1060 (39.34%), Query Frame = 1
Query:  166 LDYYKRYDEKSIEIFKKSE-VKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYA---FCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQD-KTSYEFKDENSEEEMAIQGSEEKIELLETMLIA----AYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVS--TDDLSSH-FLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLELKIRQDLVNT-MCVIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLS-MINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDG----DCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLATAVECRIQ-KDLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTTDDSNLIKQIVSVRNLFPNAQLSAERIISNQSLIEKIWNS----ELTPINIKIIQSYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQSSSDVTDLAMNCLSFIAEILSIKPNSYLALSDSRRARLELIQKVTHEILVNTSSVIKTILAISCMDVD----ILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVTNVTSSGFYN----SCITIVSHF--KFDDEISVK---LTCSVSKLFSSLWINECYSAIEILKNM-NIWATVITPI 3228
            L YY+     S    K ++ +   ++   ++LS++L L  E   ++ + YLL D               Y       K+  +YYEER+SL+R + Y    F D K  +   ++    V   E K  LF K L+ ++ +  E     +T   F  E       +Q   E+  LLE + +     A S  D         +  +F+E GFG  L    L      +    ERI     LI LE   ++ +     +D    H F  + +   +++  +   G  P  G +LL  +L+R     D  T    +   M  TAI +L +F YL  ML S          S   L V+  L  +L+      +L    L+ +QDLV+T   V   P +       +P  +G   +L+ +   FP +LS ++ +   L+ KS         + V  F++ +S +++    K   ++  +  +  + R + K    +   Q  L       G    D  G+L    + W   YS W +   E+E+   ++S               + +  Q +R++ I+D +   +   +   D ++ I   ++ +++  +  +      L + ++     L T   + +   +     L   A   +  IIS + +    + S    E +     I  S+L+    L++ +       G++P       I FV+R +L N ++  + S      L    LS I  IL++ P    + S         +Q +    L NT +  + ++ I  + VD    ++L Q   S    G  G  + L + + LA ++   +           I ++  SS I            S L   ++  G    ++    +  + +++ + Y   + R+++ +LK +   + +S+ ACLG   + IRD FL      +ED  ++  + +FL+  V   + G+++L    +       S  Y+    SC+ +V       D E S     L  S      +LW +   SA+ +L+   N W  + +P+
Sbjct:   46 LAYYRPPSTSSTGKVKANKNLSPALQELGLRLSKFLGLDEEQSVELLQTYLLYD---------------YRGTQESVKMVDYYYEERISLLRCVLYILNYFQDDKHPY--SAEFSKCVEMMEQKE-LFGKYLKQFESLCREEAPTWETHGNFMTERQVSRWFVQRLREQAMLLEIIFLYFACFAASPSD------LLALTKLFKEQGFGCRLQNRHL--VEPSMDPLVERIGYFSVLIFLEALDIETLMTCSLSDKTEQHPFSSEEQVCKEMDSVLVTLGDAPHHGPVLLAWALLRFALNADKVTP---TVRKMGSTAI-QLHIFQYLTRMLQSLRSGENNCTTSTACLCVYTFLTFVLT------NLEEQVLQSQQDLVDTAFQVFAAPNLPDLFWNMEP-TAGLGILLDSVVGMFPFHLSPLLKLFTALVSKSS-------AKKVYSFLDRMSSYTEHYRHKPHDILSHED-ETLWKRQTPKVLYALGLGQTNLRIPQGTIGQVMADEHGFL----VRWEYSYSCWTLFTCEIEMLLHVVS--------------TADVIHQCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRLTTVMNPPMDFLSSCVDCLAA-LATRMPAKVWIDLRHTGFLPFAANPVSGHIISTEGMNAGGYGSLFGIEQSQGEYSITLSFLRLVTTLVKGQLGSTQSQGLVP------CILFVLREMLPNYHRWRYNSHGVREQLGFQILSLIHAILNLSPEEEESTSTPN------LQSLCIFSLTNTEAG-QAVINIMGVGVDTLNAVMLTQAGSS----GTEGQGQMLMQTIKLAFSITNNV-----------IRLKPLSSAI------------SPLEHALTQHG----AHGNNLIAVLAKYIYHKYDPSLPRLAIQLLKRLAMVAPMSVYACLGSDAAAIRDAFLSRLRDNIEDMQIKIMILEFLTVAVET-QPGLIELFLNLEVKDTNEGSKEYSLGEWSCLQVVLKLIDSQDPESSWGAPLLHRSAIAFLHALWQDRRDSAMTVLRTKPNFWENLTSPL 996          
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Xenopus
Match: nup188 (nucleoporin 188kDa [Source:NCBI gene;Acc:100135081])

HSP 1 Score: 68.1662 bits (165), Expect = 1.429e-10
Identity = 140/606 (23.10%), Postives = 244/606 (40.26%), Query Frame = 1
Query:  166 LDYYKRYDEKSIEIFKKSE-VKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYA---FCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQD-KTSYEFKDENSEEEMAIQGSEEKIELLETMLIA----AYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVS--TDDLSSH-FLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLELKIRQDLVNTMC-VIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLS-MINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDG----DCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLIS------------------HGQRDMDLGVGPANI---SSIYSQFERLELI----LDFLATAVEC 1848
            L YY+     S    K ++ +   ++   ++LS++L L  E   ++ + YLL D +     ++ +      + ++M K+  +YYEER+SL+R + Y    F D K  +   ++    V   E K  LF K L+ ++ +  E     +T   F  E       +Q   E+  LLE + +     A S  D         +  +F+E GFG  L    L      +    ERI     LI LE   ++ +     +D    H F  + +   +++  +   G  P  G +LL  +L+R     D  T    +   M  TAI +L +F YL  ML S          S   L V+  L  +L+      +L    L+ +QDLV+T   V   P +       +P  +G   +L+ +   FP +LS ++ +   L+ KS         + V  F++ +S +++    K   ++  +  +  + R + K    +   Q  L       G    D  G+L    + W   YS W +   E+E+   ++S                  H     DL +    +   S IY   +RL  +    +DFL++ V+C
Sbjct:   22 LAYYRPPSTSSTGKVKANKNLSPALQELGLRLSKFLGLDEEQSVELLQTYLLYDYRGTQESVKGVPQDERQSQALMLKMVDYYYEERISLLRCVLYILNYFQDDKHPY--SAEFSKCVEMMEQKE-LFGKYLKQFESLCREEAPTWETHGNFMTERQVSRWFVQRLREQAMLLEIIFLYFACFAASPSD------LLALTKLFKEQGFGCRLQNRHL--VEPSMDPLVERIGYFSVLIFLEALDIETLMTCSLSDKTEQHPFSSEEQVCKEMDSVLVTLGDAPHHGPVLLAWALLRFALNADKVTP---TVRKMGSTAI-QLHIFQYLTRMLQSLRSGENNCTTSTACLCVYTFLTFVLT------NLEEQVLQSQQDLVDTAFQVFAAPNLPDLFWNMEP-TAGLGILLDSVVGMFPFHLSPLLKLFTALVSKSS-------AKKVYSFLDRMSSYTEHYRHKPHDILSHED-ETLWKRQTPKVLYALGLGQTNLRIPQGTIGQVMADEHGFL----VRWEYSYSCWTLFTCEIEMLLHVVSTADVIHQCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRLTTVMNPPMDFLSSCVDC 593          
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Mouse
Match: Nup188 (nucleoporin 188 [Source:MGI Symbol;Acc:MGI:2446190])

HSP 1 Score: 70.4774 bits (171), Expect = 2.271e-11
Identity = 134/564 (23.76%), Postives = 226/564 (40.07%), Query Frame = 1
Query:  127 KYFQTILSQLQKLLDYYKRYDEKSIEIFKKS-EVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQDKTSYEFKDENSEEEMAIQGSEEKIELLETM-LIAAYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMD----NMFVSTDDLSSH-FLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCV-LFDLLSLLCYGIHLNSLELKI---RQDLVNTMC-VIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLSMINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDG----DCEGYLMDGNIAWAVHYSIWDVIGAEVEL------TRRLISHGQR 1746
            KY+Q +L  L     YYK     S E  K + +V   +K   +++S++L L  E    + + YL  D +   + L+++L     + ++  KI  +YYEER  ++R + +    +++E                K  + K   +  +L  TE    +T      E       +Q   E+  LLE + L  AY      D +       MF+E GFG       L G    +    +RI    +LI++E  GMD    + +   D    H F  DG     ++ ++   G  P    +LL  +L+R+    +  +S     G    TAI +L +F YL  +L S       + G+       C+ ++ LLS       L SLEL     +QD+++T C V+  P +      ++P  SG   +L+ +   FP  LS +  +   +      ++      V  F++ +S++++    K     V+   DG   R    +       Q  L       G    D   YL    + W   YS W +   E+E+      T  +I H QR
Sbjct:   38 KYWQRLLEGL----SYYKPPSPSSAERVKANKDVASPLKELGLRVSKFLGLDEEQSVQLLQCYLQEDYRGTRDSLKTVLQDERQSQALTLKIADYYYEERTCILRCVLHLLTYFQDERHPYRAEYADCVDKLEKELVLKYRQQFEELYRTEAPTWETHGNLMTERQVSRWLVQCLREQSMLLEIIFLYYAYFEMAPSDLLVLTK---MFKEQGFGSRQTSRHLVG--GTMDPFVDRIGYFSALILVE--GMDIESLHKYALDDRRELHQFAQDGLICQDMDRAMLTLGDIPHHAPVLLAWALLRHTLSPEETSSVVRKIGG---TAI-QLNVFQYLTRLLRS-----LASGGNDCTTSTACMCVYGLLSFA-----LTSLELHTLGNQQDVIDTACEVLADPSLPELFWGTEP-TSGLGIILDSVCGMFPHLLSPLLQLLRALVSGKSTAKK-----VYSFLDKMSFYNE--LHKHKPHDVLSHEDGTLWRRQTPKLLYPLGGQTNLRIPQGTVGQVMLDDRAYL----VRWEYSYSSWTLFTCEIEMLLHVVSTADVIQHCQR 564          
BLAST of Nuclear pore complex protein Nup188 vs. UniProt/SwissProt
Match: sp|F6WXT2|NU188_XENTR (Nucleoporin NUP188 homolog OS=Xenopus tropicalis OX=8364 GN=nup188 PE=2 SV=1)

HSP 1 Score: 94.3597 bits (233), Expect = 1.065e-17
Identity = 225/1062 (21.19%), Postives = 423/1062 (39.83%), Query Frame = 1
Query:  166 LDYYKRYDEKSIEIFKKSE-VKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIK--KFYYEERLSLIRIIRYA---FCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQD-KTSYEFKDENSEEEMAIQGSEEKIELLETMLIA----AYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVS--TDDLSSH-FLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLELKIRQDLVNT-MCVIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLS-MINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDG----DCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLATAVECRIQ-KDLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTTDDSNLIKQIVSVRNLFPNAQLSAERIISNQSLIEKIWNS----ELTPINIKIIQSYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQSSSDVTDLAMNCLSFIAEILSIKPNSYLALSDSRRARLELIQKVTHEILVNTSSVIKTILAISCMDVD----ILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVTNVTSSGFYN----SCITIVSHF--KFDDEISVK---LTCSVSKLFSSLWINECYSAIEILKNM-NIWATVITPI 3228
            L YY+     S    K ++ +   ++   ++LS++L L  E   ++ + YLL D +     ++ +      + ++M K     +YYEER+SL+R + Y    F D K  +   ++    V   E K  LF K L+ ++ +  E     +T   F  E       +Q   E+  LLE + +     A S  D         +  +F+E GFG  L    L      +    ERI     LI LE   ++ +     +D    H F  + +   +++  +   G  P  G +LL  +L+R     D  T    +   M  TAI +L +F YL  ML S          S   L V+  L  +L+      +L    L+ +QDLV+T   V   P +       +P  +G   +L+ +   FP +LS ++ +   L+ KS         + V  F++ +S +++    K   ++  +  +  + R + K    +   Q  L       G    D  G+L    + W   YS W +   E+E+   ++S               + +  Q +R++ I+D +   +   +   D ++ I   ++ +++  +  +      L + ++     L T   + +   +     L   A   +  IIS + +    + S    E +     I  S+L+    L++ +       G++P       I FV+R +L N ++  + S      L    LS I  IL++ P    + S         +Q +    L NT +  + ++ I  + VD    ++L Q   S    G  G  + L + + LA ++   +           I ++  SS I            S L   ++  G    ++    +  + +++ + Y   + R+++ +LK +   + +S+ ACLG   + IRD FL      +ED  ++  + +FL+  V   + G+++L    +       S  Y+    SC+ +V       D E S     L  S      +LW +   SA+ +L+   N W  + +P+
Sbjct:   46 LAYYRPPSTSSTGKVKANKNLSPALQELGLRLSKFLGLDEEQSVELLQTYLLYDYRGTQESVKGVPQDERQSQALMLKASMVDYYYEERISLLRCVLYILNYFQDDKHPY--SAEFSKCVEMMEQKE-LFGKYLKQFESLCREEAPTWETHGNFMTERQVSRWFVQRLREQAMLLEIIFLYFACFAASPSD------LLALTKLFKEQGFGCRLQNRHL--VEPSMDPLVERIGYFSVLIFLEALDIETLMTCSLSDKTEQHPFSSEEQVCKEMDSVLVTLGDAPHHGPVLLAWALLRFALNADKVTP---TVRKMGSTAI-QLHIFQYLTRMLQSLRSGENNCTTSTACLCVYTFLTFVLT------NLEEQVLQSQQDLVDTAFQVFAAPNLPDLFWNMEP-TAGLGILLDSVVGMFPFHLSPLLKLFTALVSKSS-------AKKVYSFLDRMSSYTEHYRHKPHDILSHED-ETLWKRQTPKVLYALGLGQTNLRIPQGTIGQVMADEHGFL----VRWEYSYSCWTLFTCEIEMLLHVVS--------------TADVIHQCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRLTTVMNPPMDFLSSCVDCLAA-LATRMPAKVWIDLRHTGFLPFAANPVSGHIISTEGMNAGGYGSLFGIEQSQGEYSITLSFLRLVTTLVKGQLGSTQSQGLVP------CILFVLREMLPNYHRWRYNSHGVREQLGFQILSLIHAILNLSPEEEESTSTPN------LQSLCIFSLTNTEAG-QAVINIMGVGVDTLNAVMLTQAGSS----GTEGQGQMLMQTIKLAFSITNNV-----------IRLKPLSSAI------------SPLEHALTQHG----AHGNNLIAVLAKYIYHKYDPSLPRLAIQLLKRLAMVAPMSVYACLGSDAAAIRDAFLSRLRDNIEDMQIKIMILEFLTVAVET-QPGLIELFLNLEVKDTNEGSKEYSLGEWSCLQVVLKLIDSQDPESSWGAPLLHRSAIAFLHALWQDRRDSAMTVLRTKPNFWENLTSPL 1013          
BLAST of Nuclear pore complex protein Nup188 vs. UniProt/SwissProt
Match: sp|Q5SRE5|NU188_HUMAN (Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606 GN=NUP188 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 1.704e-15
Identity = 213/1067 (19.96%), Postives = 427/1067 (40.02%), Query Frame = 1
Query:  166 LDYYKRYDEKSIEIFKKS-EVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYK-----LIITEIGQDKTSYEFKDENSEEEMAIQGSEEKIELLETM-LIAAYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMF-VSTDDLSS--HFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCV-LFDLLSLLCYGIHLNSLELKI---RQDLVNTMC-VIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLSMINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDG----DCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLATAVECRIQ-KDLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTTDDSNLIKQIVSVRN-------LFPNAQLSAERIISNQSLIEK-----IWNSELTPINIKIIQSYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQSSSDVTDLAMNCLSFIAEILSIKPNSYLALSDSRRARLELIQKVTHEILVNTSSVIKTILAISCMDVDILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQL-----IGPGKSVTNVTSSGFYNSCITIVSHFKFDDEISVKLTC------SVSKLFSSLWINECYSAIEILKNM-NIWATVITPI 3228
            L YYK     S E  K + +V   +K   +++S++L L  E    + + YL  D +   + ++++L     + +++ KI  +YYEER  ++R + +    +++E     +    V   +    L K+++  Y+     L  TE    +T      E       +Q   E+  LLE + L  AY      D +       MF+E GFG    QT  +     +    +RI    +LI++E   ++++   + DD      F  DG     ++  +  FG  P    +LL  +L+R+    +  +S     G    TAI +L +F YL  +L S       + G+       C+ ++ LLS +     L SLEL     +QD+++T C V+  P +      ++P  SG   +L+ +   FP  LS +  +   +      ++      V  F++ +S++++    K     V+   DG   R    +       Q  L       G    D   YL    + W   YS W +   E+E+   ++S               + +    +R++ I+D +   +   +   D ++ I   ++ +++  +  I     ++ + +N     L      N  K    +R+         P + LS  ++IS + +        + NSE       +  ++L+    L++ +       G++P       + FV++ +L + +K  + S      +    L  I  IL++   + L  S +   +   I  + +         +  I+ I    +D+++     S+   G  G  + L + V LA ++   +           I ++  S+V+            S L   +S  G    ++    +  + +++ + +   + R+++ +LK +   + +S+ ACLG   + IRD FL    S +ED  ++  + +FL+  V   + G+++L     +  G   +   S G + SC+  V     D +   +  C      +      +LW +   SA+ +L+     W  + +P+
Sbjct:   47 LSYYKPPSPSSAEKVKANKDVASPLKELGLRISKFLGLDEEQSVQLLQCYLQEDYRGTRDSVKTVLQDERQSQALILKIADYYYEERTCILRCVLHLLTYFQDE-----RHPYRVEYADCVDKLEKELVSKYRQQFEELYKTEAPTWETHGNLMTERQVSRWFVQCLREQSMLLEIIFLYYAYFEMAPSDLLVLTK---MFKEQGFGS--RQTNRHLVDETMDPFVDRIGYFSALILVEGMDIESLHKCALDDRRELHQFAQDGLICQDMDCLMLTFGDIPHHAPVLLAWALLRHTLNPEETSSVVRKIGG---TAI-QLNVFQYLTRLLQS-----LASGGNDCTTSTACMCVYGLLSFV-----LTSLELHTLGNQQDIIDTACEVLADPSLPELFWGTEP-TSGLGIILDSVCGMFPHLLSPLLQLLRALVSGKSTAKK-----VYSFLDKMSFYNE--LYKHKPHDVISHEDGTLWRRQTPKLLYPLGGQTNLRIPQGTVGQVMLDDRAYL----VRWEYSYSSWTLFTCEIEMLLHVVS--------------TADVIQHCQRVKPIIDLVHKVISTDLSIADCLLPITSRIYMLLQRLTTVISPPVDVIASCVN----CLTVLAARNPAKVWTDLRHTGFLPFVAHPVSSLS--QMISAEGMNAGGYGNLLMNSEQPQGEYGVTIAFLRLITTLVKGQLGSTQSQGLVPC------VMFVLKEMLPSYHKWRYNSHGVREQIGCLILELIHAILNLCHETDLHSSHTPSLQFLCICSLAY---TEAGQTVINIMGIGVDTIDMVMAAQPRSDGAEG-QGQGQLLIKTVKLAFSVTNNV-----------IRLKPPSNVV------------SPLEQALSQHG----AHGNNLIAVLAKYIYHKHDPALPRLAIQLLKRLATVAPMSVYACLGNDAAAIRDAFLTRLQSKIEDMRIKVMILEFLTVAVET-QPGLIELFLNLEVKDGSDGSKEFSLGMW-SCLHAVLEL-IDSQQQDRYWCPPLLHRAAIAFLHALWQDRRDSAMLVLRTKPKFWENLTSPL 1017          
BLAST of Nuclear pore complex protein Nup188 vs. UniProt/SwissProt
Match: sp|Q6ZQH8|NU188_MOUSE (Nucleoporin NUP188 homolog OS=Mus musculus OX=10090 GN=Nup188 PE=1 SV=2)

HSP 1 Score: 70.4774 bits (171), Expect = 1.588e-10
Identity = 134/564 (23.76%), Postives = 226/564 (40.07%), Query Frame = 1
Query:  127 KYFQTILSQLQKLLDYYKRYDEKSIEIFKKS-EVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQDKTSYEFKDENSEEEMAIQGSEEKIELLETM-LIAAYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMD----NMFVSTDDLSSH-FLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCV-LFDLLSLLCYGIHLNSLELKI---RQDLVNTMC-VIVKPIIT--CSESQPLNSGFMKMLEDLSSSFPANLSMINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDG----DCEGYLMDGNIAWAVHYSIWDVIGAEVEL------TRRLISHGQR 1746
            KY+Q +L  L     YYK     S E  K + +V   +K   +++S++L L  E    + + YL  D +   + L+++L     + ++  KI  +YYEER  ++R + +    +++E                K  + K   +  +L  TE    +T      E       +Q   E+  LLE + L  AY      D +       MF+E GFG       L G    +    +RI    +LI++E  GMD    + +   D    H F  DG     ++ ++   G  P    +LL  +L+R+    +  +S     G    TAI +L +F YL  +L S       + G+       C+ ++ LLS       L SLEL     +QD+++T C V+  P +      ++P  SG   +L+ +   FP  LS +  +   +      ++      V  F++ +S++++    K     V+   DG   R    +       Q  L       G    D   YL    + W   YS W +   E+E+      T  +I H QR
Sbjct:   38 KYWQRLLEGL----SYYKPPSPSSAERVKANKDVASPLKELGLRVSKFLGLDEEQSVQLLQCYLQEDYRGTRDSLKTVLQDERQSQALTLKIADYYYEERTCILRCVLHLLTYFQDERHPYRAEYADCVDKLEKELVLKYRQQFEELYRTEAPTWETHGNLMTERQVSRWLVQCLREQSMLLEIIFLYYAYFEMAPSDLLVLTK---MFKEQGFGSRQTSRHLVG--GTMDPFVDRIGYFSALILVE--GMDIESLHKYALDDRRELHQFAQDGLICQDMDRAMLTLGDIPHHAPVLLAWALLRHTLSPEETSSVVRKIGG---TAI-QLNVFQYLTRLLRS-----LASGGNDCTTSTACMCVYGLLSFA-----LTSLELHTLGNQQDVIDTACEVLADPSLPELFWGTEP-TSGLGIILDSVCGMFPHLLSPLLQLLRALVSGKSTAKK-----VYSFLDKMSFYNE--LHKHKPHDVLSHEDGTLWRRQTPKLLYPLGGQTNLRIPQGTVGQVMLDDRAYL----VRWEYSYSSWTLFTCEIEMLLHVVSTADVIQHCQR 564          
BLAST of Nuclear pore complex protein Nup188 vs. TrEMBL
Match: A0A183B6N1 (Uncharacterized protein OS=Echinostoma caproni OX=27848 GN=ECPE_LOCUS14866 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.095e-23
Identity = 133/645 (20.62%), Postives = 256/645 (39.69%), Query Frame = 1
Query:   37 MSCSRNLQFCINH-------SFLLNLPNSKIY---DEQFIKYFQTILSQLQKLLDYYKRYDEKSIEIFKKSEVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLL---NDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESY-------KLIITE-------IGQDKTSYEFKDENSEEEMAIQGSEEKIELLETMLIAAYSMKDCRDRVT---FENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMF----VST----------------------------DDLSSHFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFP------------------------------------------IDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGL-------------------IVHCVLFDLLSLLCYGIHLNSLELK-------IRQD-----------LVNTMCVIVKPIITCSESQ----PLNSG----FMKMLEDLSSSFPANLSMINVIGCLM-------KKSDDGSQNE---IIEIVSEFIENLSWFSD 1494
            M+C   L F + H       SF L     K Y    E  ++    +   +   L Y+      S     K  +KD ++ F+ KLS +LNLS E  +D+  +Y+     DG  +++ +Q+ +T G+ +  ++ +I+ FY++ERLSL+ + R   CDW E ++ L+ ++ +++ F ++T   + +L  Y       + ++T+       + Q     +F+ ++  +    Q  +E++E+L  +    +++ D         F  +L  F    FGL+ +  +       L    ++I + Q+LI++  + +DN+     VST                            +    HFL +   L++L  S++  G +P  G LLLF ++    F                                           ++ + +  + +   A  AI  LG+F +L   L      I    G+ L L                     H  +FDLL LL   + L +L+         IR +             +T+ V+ + +   + +Q      +SG       ++E L+  FP +LS++++   LM        ++D+G   E   ++ +VSE I  L + ++
Sbjct:    1 MACINALAFSVAHRDFPEEVSFPLYPSTFKFYTDSQEVLVRELSKVKEHISNGLSYFTVKSSDS----NKPALKDQVQRFLTKLSTFLNLSEERCFDLLVHYIAARDTDGPFDEDQVQNFITDGHVS-DLLNRIRIFYWQERLSLLGLFRVMMCDWHESWVTLADVLFAMTSFRSRTEFLEHMLHEYTQAACATESLLTDGRYGFMRLTQPTVLVDFESQDEFDLAVAQRLKEQLEMLHIIFTGVHALSDADAPPASCFFSKLLDAFWSKSFGLQPSHVQPLAKHRHLA---DQICLTQTLILIRAANLDNLTLFKNVSTKPGPESMSGPRAAKRSTKRSNQDASINHESTGGHFLYNAHLLNRLLASLSALGDSPVHGPLLLFGAICATAFAPSVAPDSPPHRLDAGDLTPGDWGPVVDERKPWGGGNPGRDGGVEVSETAHLVAEQYAHMAIQTLGVFGFLTDQLTDLGKPIQNRPGAGLSLNLQESPLIQPGTDLNVIDFCAHVAVFDLLCLLAQHVVLWTLDSPTSAAANSIRSEQSSNRIACIRLFAHTLYVVAQHVHLITRAQDASDAPSSGIGLRIAGLIESLAEGFPCDLSLVHLCTALMVPAPSRGSQTDNGGAEESDSLVHLVSELITALPYLTE 637          
BLAST of Nuclear pore complex protein Nup188 vs. TrEMBL
Match: A0A0X3NLM9 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR147486 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 3.983e-22
Identity = 142/693 (20.49%), Postives = 301/693 (43.43%), Query Frame = 1
Query:   85 LNLPNSKIYDEQFIKYFQTILSQLQKLLDYYKRYDEKSIEIFKKSEVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQD--KTSY---EFKDENSEEEMAIQGSEEKIELLETMLIAAYSMKDC----RDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMD--NMFVSTDDL---SSHFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPI---DNNTSCS----MSSGTMAETAICKLGLFSYLKSMLGS----KPYMIT--TTEGSY-----------LGLIVHCVLFDLLSLLCYGIHLNSLEL----KIRQDL-VNTMCVIVKPIITCSES--------QP-------LNSGFMKMLEDLSSSFPANLSMINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRC---------MKMDCVMVVDSPDGDFD---RNSAKQCRLVRQYQPYLSKSLTLDGDCEGYLMD--GNIAWAVHYSIWDVIGAEVELTRRLIS--------------HGQRDMDLGVGPA-NISSIYSQFERLELILDFLATAVECRIQKDLIINIFCNLWSMI 1902
            + LP++++ +        T+  QL     Y+ +  E+ I      EV + +  FV K +  +++S    Y +++ +      L     QSM++   + + + ++++K Y+ ER++L+++ + A   W   + + +  + +++ F++   L + ++    ++  E  +D  KTS+   +   + S +    Q  +E    LE +LI    +        +   F  +L +F ++ F    ++ +L    +      +RI+ LQ LI++  + +D  ++F +  ++   S HFL D + +S+L  S++  GT  +DG+ LLF ++  ++F +   D++ S      +++   A TAI +L +F +L  +L +    KP   T    +GS+           +GL  H   FDLL+ +   I L SL+        Q+L V  +   +  ++ CS S         P       + S  + ++E ++  FP +L  +++   L+  +++   +  +E+V++ I ++ +F+             +K + V   ++ + D     R        V  ++ +   +++L       L    G I W   YS+W V+ A V       S               G R +     PA   + + + F RL   LDF+   +   I+    + I   +W+++
Sbjct:   10 IALPDAEVTETHLAIELLTVKEQLSSAFPYFTQ--ERKI----PPEVSEQVNVFVSKFASQMSISSGFSYALYEEFA-RQRSLSILAAQSMISSPSHAVHVTEELQKLYWNERIALVQLYKVACSHWLNCWSVTADCVFTLTSFKSHQELVQMLISHVDILYGET-EDLLKTSFYHTQIPPDTSIDSQICQKLQEATVTLEAVLIGVSGLPSSPTSRENAALFSKILDVFWKTSF---YSKKELLLICSSYRGLIDRIRSLQCLILIRAACLDAESLFTTESEMRGESGHFLFDTRLISRLLTSVSNLGTQRADGLFLLFAAVCGSSFSLEETDHDNSAQDDLIITASRYAVTAINQLNVFQFLLDLLVNTEPLKPMNPTHLRPQGSFELFHLPDSMSVIGLCEHLAAFDLLTFMAKQITLESLDRDPGSPTNQNLFVKILSKALSALVQCSGSIGMLSRSADPSAMGSLNIGSRVLPVIESVAQRFPYDLDFLDLCTALLSSTEE-RNDATVELVAQLICSVPYFAQPMTDEIAAALSPVKAEAVEGAETREQDMAVLLRQHWALPTDVLAHRGFNQYAVSLSPGTRSILRPKLGLIVWQHEYSVWPVLNAIVAAAEYSFSAENFGLSADKNPPRSGSRSILQPSQPALAAARLETAFSRLATCLDFVDACLLAGIEPGRCLAITDTMWNLV 690          

HSP 2 Score: 68.1662 bits (165), Expect = 2.807e-7
Identity = 83/370 (22.43%), Postives = 155/370 (41.89%), Query Frame = 1
Query: 2095 WNSELTP---INIKIIQSYLKFNICLIQNEK-----------YFDSEIGVIPSS------LIFGSINFVIRLVLDNVNKRTFQSS----------SDVTDLAMNCLSFIAEILSI-------KPNSYLALSDSRRARLELIQKVTHEILVNTSSVIKTILAISCMDV------------DILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVTNVTSSGF 3057
            W   + P      ++I +YL   + +++ E+           Y  S    +P++      L+F  +NFVI +     ++   + S          SD+  L    L F+ ++L+        K +   +LS         IQ    E+L +  +++   +A++ + V            D L     L      +    +   R  WL+LTL+  +F  P++++       +  S +++ L G                  V  +  + Y LK+L FL +  S  +SR ++++LK +VQ S   +   LG+ ++ ++++ L+  AS   DQI R++LFD+L+E V+        L GPG S+     SGF
Sbjct:  833 WYPSVPPSPSTRYRLISAYLDLALAVLEGERLAYLAGCSIDGYEQSSPSYLPTASPLLAFLVF-CVNFVIEVCQPGTSELAVKGSLQPLRDVCQRSDLFSLLNKALIFLVDLLTTHHLEEPSKESEDKSLSHVYAPGFYGIQTYARELLASHEAILSCFVALTTVPVSSLQLPADSLVFDFLRFPTRLQTDQRFVLVLGQPKERSTWLSLTLIHLLF-PPQVDA-----TSAPQSCLLECLKG------------------VLTTQGEAYFLKILRFLDFQCSTGLSRAAVNILKKMVQYSDKLVSPFLGKISTNLQNIILQRLASPSSDQITRSSLFDWLAEAVLFD-----ALKGPGPSL--FQGSGF 1170          
BLAST of Nuclear pore complex protein Nup188 vs. TrEMBL
Match: A0A0X3PCV0 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=TR147486 PE=4 SV=1)

HSP 1 Score: 116.316 bits (290), Expect = 5.897e-22
Identity = 142/693 (20.49%), Postives = 301/693 (43.43%), Query Frame = 1
Query:   85 LNLPNSKIYDEQFIKYFQTILSQLQKLLDYYKRYDEKSIEIFKKSEVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQD--KTSY---EFKDENSEEEMAIQGSEEKIELLETMLIAAYSMKDC----RDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMD--NMFVSTDDL---SSHFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPI---DNNTSCS----MSSGTMAETAICKLGLFSYLKSMLGS----KPYMIT--TTEGSY-----------LGLIVHCVLFDLLSLLCYGIHLNSLEL----KIRQDL-VNTMCVIVKPIITCSES--------QP-------LNSGFMKMLEDLSSSFPANLSMINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDG---------RCMKMDCVMVVDSPDGDFD---RNSAKQCRLVRQYQPYLSKSLTLDGDCEGYLMD--GNIAWAVHYSIWDVIGAEVELTRRLIS--------------HGQRDMDLGVGPA-NISSIYSQFERLELILDFLATAVECRIQKDLIINIFCNLWSMI 1902
            + LP++++ +        T+  QL     Y+ +  E+ I      EV + +  FV K +  +++S    Y +++ +      L     QSM++   + + + ++++K Y+ ER++L+++ + A   W   + + +  + +++ F++   L + ++    ++  E  +D  KTS+   +   + S +    Q  +E    LE +LI    +        +   F  +L +F ++ F  +     +  +   L++   RI+ LQ LI++  + +D  ++F +  ++   S HFL D + +S+L  S++  GT  +DG+ LLF ++  ++F +   D++ S      +++   A TAI +L +F +L  +L +    KP   T    +GS+           +GL  H   FDLL+ +   I L SL+        Q+L V  +   +  ++ CS S         P       + S  + ++E ++  FP +L  +++   L+  +++   +  +E+V++ I ++ +F+             +K + V   ++ + D     R        V  ++ +   +++L       L    G I W   YS+W V+ A V       S               G R +     PA   + + + F RL   LDF+   +   I+    + I   +W+++
Sbjct:   10 IALPDAEVTETHLAIELLTVKEQLSSAFPYFTQ--ERKI----PPEVSEQVNVFVSKFASQMSISSGFSYALYEEFA-RQRSLSILAAQSMISSPSHAVHVTEELQKLYWNERIALVQLYKVACSHWLNCWSVTADCVFTLTSFKSHQELVQMLISHVDILYGET-EDLLKTSFYHTQIPPDTSIDSQICQKLQEATVTLEAVLIGVSGLPSSPTSRENAALFSKILDVFWKTSFYSKKELLLICSSYRGLID---RIRSLQCLILIRAACLDAESLFTTESEMRGESGHFLFDTRLISRLLTSVSNLGTQRADGLFLLFAAVCGSSFSLEETDHDNSAQDDLIITASRYAVTAINQLNVFQFLLDLLVNTEPLKPMNPTHLRPQGSFELFHLPDSMSVIGLCEHLAAFDLLTFMAKQITLESLDRDPGSPTNQNLFVKILSKALSALVQCSGSIGMLSRSADPSAMGSLNIGSRVLPVIESVAQRFPYDLDFLDLCTALLSSTEE-RNDATVELVAQLICSVPYFAQPMTDEIAAALSPVKAEAVEGAETREQDMAVLLRQHWALPTDVLAHRGFNQYAVSLSPGTRSILRPKLGLIVWQHEYSVWPVLNAIVAAAEYSFSAENFGLSADKNPPRSGSRSILQPSQPALAAARLETAFSRLATCLDFVDACLLAGIEPGRCLAITDTMWNLV 690          

HSP 2 Score: 67.781 bits (164), Expect = 3.766e-7
Identity = 83/370 (22.43%), Postives = 155/370 (41.89%), Query Frame = 1
Query: 2095 WNSELTP---INIKIIQSYLKFNICLIQNEK-----------YFDSEIGVIPSS------LIFGSINFVIRLVLDNVNKRTFQSS----------SDVTDLAMNCLSFIAEILSI-------KPNSYLALSDSRRARLELIQKVTHEILVNTSSVIKTILAISCMDV------------DILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVTNVTSSGF 3057
            W   + P      ++I +YL   + +++ E+           Y  S    +P++      L+F  +NFVI +     ++   + S          SD+  L    L F+ ++L+        K +   +LS         IQ    E+L +  +++   +A++ + V            D L     L      +    +   R  WL+LTL+  +F  P++++       +  S +++ L G                  V  +  + Y LK+L FL +  S  +SR ++++LK +VQ S   +   LG+ ++ ++++ L+  AS   DQI R++LFD+L+E V+        L GPG S+     SGF
Sbjct:  833 WYPSVPPSPSTRYRLISAYLDLALAVLEGERLAYLAGCSIDGYEQSSPSYLPTASPLLAFLVF-CVNFVIEVCQPGTSELAVKGSLQPLRDVCQRSDLFSLLNKALIFLVDLLTTHHLEEPSKESEDKSLSHVYAPGFYGIQTYARELLASHEAILSCFVALTTVPVSSLQLPADSLVFDFLRFPTRLQTDQRFVLVLGQPKERSTWLSLTLIHLLF-PPQVDA-----TSAPQSCLLECLKG------------------VLTTQGEAYFLKILRFLDFQCSTGLSRAAVNILKKMVQYSDKLVSPFLGKISTNLQNIILQRLASPSSDQITRSSLFDWLAEAVLFD-----ALKGPGPSL--FQGSGF 1170          
BLAST of Nuclear pore complex protein Nup188 vs. TrEMBL
Match: A0A4E0RX58 (Uncharacterized protein OS=Fasciola hepatica OX=6192 GN=D915_002961 PE=4 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 5.321e-20
Identity = 118/516 (22.87%), Postives = 212/516 (41.09%), Query Frame = 1
Query:   37 MSCSRNLQFCINHSFLLNLPNSKIYDEQ--FIKYFQTILSQLQKLLDYYKRYDEKSIEIFKKSEVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLL---NDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLI--ITEIGQDKTSYEF---------KDENSEEEMAIQGSE---EKIELLETMLIAAYSMKDCRDRVT---FENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVSTD-----------------------------DLSS--------HFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNF-----------------------PIDN------------NTSCSMSSGTMAETAICKLGLFSYLKSMLG-------------SKPYMI------TTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLE 1245
            M+C   L FC+ H         + + E+   ++    +   L K L Y+   + KS    K+  +KD ++ F+ KLS +LNLS E   D+  +YL     DG  +++ +Q+ +  G  +  ++ +I+ FY+ ERLSL+ + R   CDW E ++  + ++ +++ F ++  L + +L+ Y      TE       Y F          D  S++E  +  S+   E++E+L  +L   +++ D     +   F  +L  F    FGL+ +  +       LV   +RI + Q LI++  + +DN+ +  +                             D SS        HFL D   L++L  S++  G +P  G LLLF ++    F                       P D+            + +  + +G  A +AI  LG+F +L   L              S P ++        T+ + +    H  +FDLL LL   + L +L+
Sbjct:    1 MACISALSFCVAH---------RDFSEEDILVRELSKVKEPLSKGLSYF---NAKSSTENKQPTLKDQVQRFLTKLSTFLNLSDERCLDLLVHYLAAQNTDGPSDEDQVQNFIADGRLS-DLLNRIRAFYWHERLSLLGLFRVTVCDWHESWVSQADVLFAMTPFASRIELLENMLKQYTQAASTTESLLADGYYGFMRLTQPTGMADVESQDEFDLTVSQYLKEQLEMLNVILTGVHALCDSDASPSSCFFSKLLEAFWSKSFGLQPSHVQPLSKHRHLV---DRICLTQGLILIRAANLDNLALYKNAFTKPSQGAVEALRSSKRLAKQSDPGRKIDQSSNRTKPEHKHFLYDAHLLNRLLASLSGLGDSPVHGPLLLFGAVCAIAFAPSVPPDFLNRLETGDAISCEWDPADDGKASGRDGWAEVSATAHLVAGQYAHSAIDTLGVFGFLSEQLTDLDRSVQSGPETESNPSLLELPPLQADTDLNLIDFCAHVAVFDLLCLLAQHVVLWTLD 500          

HSP 2 Score: 82.8037 bits (203), Expect = 1.109e-11
Identity = 152/664 (22.89%), Postives = 264/664 (39.76%), Query Frame = 1
Query: 2434 NTSSVIKTILAISCMDVDILLKQ----------CNLSNQMLGIYGTEEQLSR------LVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLD-------GNEPN-ESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTS-FIRDLFLRICAST----MEDQIVRANLFDFLSECVMCG---RHG-----VLQLIGP------GKSVTNVTSSGFYNSCITIVSHFK------FDDEISVKLTCSVSKLFSSLWINECYSAIEILKNMN-IWATVITPIKEFIKKLNGNALELNKVKKMSTLHHLFSFVGNVYGLFGMELYSNSGLMRSH-KDADFTNSFNELYTTDLFID-FLLVF-------ELNQLESRSANFD---RYMSLLLPAIIWWKTLLV----------------TALSMNPPEIGIKGLSDSEEIDLVLRIVDSISNLLSFSVICDSHNFTLILDHLSFSVLEILNKRIKSIPDNGMNSILKKLI-------PVTAIQYSHIVSFHNRHTDLLAACV----LIQHHRSDNSS-----------FQLDLESVIHSYLSILSNNPSLSTLERKVFIQAVNLCIAT-DTKSQPSTPHLVRPEWVHRLAEMGILHNSFVLLD 4122
            ++   + ++LA S + +  LL Q             SN ++ I G+  QL R      +VWL LTLV+ +     L  E  ++ +       +LL           P   +S LS  I++   V       Y+  +L +L YP+   + R ++ +LK + Q++ ++I+  L   +S  IRD  L   AS+     ED + R  LFD ++E V+     R G     +L+ + P      G + T  T     + C+ +++  K        D++SV L CSV+KL ++L++ E  + + +LK+ +  W  +  P+   +        ++    + S + H   + G+V  + G+EL+       S  +D  F    N L + D +   F LV         +  LE   +  D     +S L  A   WK LL+                T LS     +  KG+     +D ++R +  + + L  +V  D  N   +   +  +         KS PD      L +L+       P    Q  H+      H DLLA       L+   R+   S            Q+DL      Y++ L+   +L   +     QA++L +   DT S  S  +        RL + G+ +N  + L+
Sbjct: 1113 DSPCAVHSLLAFSSVPLHCLLAQFKALDQGLSVGTPSNTIIAISGSSPQLHRTRSLATVVWLGLTLVRRV-----LGLEHVMLEQHAGCTSAELLTHANALAVSRAPTPRASMLSSLIAY---VDPGTRVHYLAILLTYLRYPFHTGLCRSAVTLLKWLTQHTPVNIIDYLSPDSSVVIRDSVLDRLASSSSTLPEDPLTRIALFDLIAEAVLASPTDRSGKRTVPILRFLIPSPTPPAGLNKTRNTKPDCLDCCMAVLAEIKSVHGSALPDQLSVLLLCSVTKLIAALYLQEANTYLVMLKSKSRFWDFLTEPMFRLLDA------DVKTQNEFSQVEH--EYCGHVVSILGLELFCTQSCPGSPTQDNSFQQIVNRLTSEDAYTSWFQLVANACERAQSMCDLEPDVSPADCIGPILSSLYEATCRWKCLLMVHLDWLRQAETRIGKATQLSQTVEPLRTKGM-----MDQLIRGLHQLKSSLDLTVASDLANQLAVCLSIVVNYHHKHANDSKSAPDPDNQVRLAQLVDFLITVRPGLDEQARHL------HADLLACASTLWQLVHTTRTQPESGVQPSDDALHQLQIDLSDCAFGYVAQLAIYSNLLPADGAALRQAISLVLKLWDTTSMASALYA-------RLIQAGVFNNLLITLE 1742          
BLAST of Nuclear pore complex protein Nup188 vs. TrEMBL
Match: A0A504YQN2 (Uncharacterized protein OS=Fasciola gigantica OX=46835 GN=FGIG_05260 PE=4 SV=1)

HSP 1 Score: 108.227 bits (269), Expect = 1.766e-19
Identity = 117/516 (22.67%), Postives = 212/516 (41.09%), Query Frame = 1
Query:   37 MSCSRNLQFCINHSFLLNLPNSKIYDEQ--FIKYFQTILSQLQKLLDYYKRYDEKSIEIFKKSEVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLL---NDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLI--ITEIGQDKTSYEF---------KDENSEEEMAIQGSE---EKIELLETMLIAAYSMKDCRDRVT---FENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVSTD-----------------------------DLSS--------HFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNF-----------------------PIDN------------NTSCSMSSGTMAETAICKLGLFSYLKSMLG-------------SKPYMI------TTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLE 1245
            M+C   L FC+ H         + + E+   ++    +   L K L Y+   + KS    K+  +KD ++ F+ KLS +L+LS E   D+  +YL     DG  +++ +Q+ +  G  +  ++ +I+ FY+ ERLSL+ + R   CDW E ++  + ++ +++ F ++  L + +L+ Y      TE       Y F          D  S++E  +  S+   E++E+L  +L   +++ D     +   F  +L  F    FGL+ +  +       LV   +RI + Q LI++  + +DN+ +  +                             D SS        HFL D   L++L  S++  G +P  G LLLF ++    F                       P D+            + +  + +G  A +AI  LG+F +L   L              S P ++        T+ + +    H  +FDLL LL   + L +L+
Sbjct:    1 MACISALSFCVAH---------RDFSEEDILVRELSKVKEPLSKGLSYF---NAKSSTENKQPTLKDQVQRFLTKLSTFLDLSDERCLDLLVHYLAAQNTDGPSDEDQVQNFIADGRLS-DLLNRIRAFYWHERLSLLGLFRVTVCDWHESWVSQADVLFAMTPFASRIELLENMLKQYTQAASTTESLLADGYYGFMRLTQPTGMADVESQDEFDLTVSQYLKEQLEMLNVILTGVHALCDSDASPSSCFFSKLLEAFWSKSFGLQPSHVQPLSKHRHLV---DRICLTQGLILIRAANLDNLALYKNAFTKPSQGAVEALRPSKRLAKPSDPSRKIDQSSNRTKPEHRHFLYDAHLLNRLLASLSGLGDSPVHGPLLLFGAVCAIAFAPSVPPDFPNRLETGDAISCEWDPADDGKASGRDGWAEVSATAHLVAGQYAHSAIDTLGVFGFLSEQLTDLDRSVQSGPETESNPSLLELPPLQADTDLNLIDFCAHVAVFDLLCLLAQHVVLWTLD 500          

HSP 2 Score: 80.1073 bits (196), Expect = 6.492e-11
Identity = 88/372 (23.66%), Postives = 164/372 (44.09%), Query Frame = 1
Query: 2446 VIKTILAISCMDVDILLKQCNLSNQMLGIYGTEEQLSR------LVWLALTLVKFIFIGPELNSEDQIVIESGS----SVIMKLLDGNEPNES--SQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTS-FIRDLFLRICAST----MEDQIVRANLFDFLSECVMCG---RHG-----VLQLIGPGKSV------TNVTSSGFYNSCITIVSHFK------FDDEISVKLTCSVSKLFSSLWINECYSAIEILKNMN-IWATVITPIKEFIKKLNGNALELNKVKKMSTLHHLFSFVGNVYGLFGMELYSNSGLMRSH-KDADFTNSFNELYTTDLFIDF 3444
             + ++LA+S + +  LL Q    +Q     G+  QL R      +VWL LTLV+ +     +  E  +   S      +  + +     P  S  S L+  I    RV       Y+  +L +L YP+   + R ++ +LK + Q++ ++I+  L   +S  IRD  L   AS+     ED + R  LFD ++E V+     R G     +L+ + P  ++      T  T     + C+ +++  K        D++SV L CSV+KL ++L++ E  + + +LK+ +  W  +  P+   +        ++    + S + H   + G+V  + G+EL+       S  +D  F    + L + D +  +
Sbjct:  971 AVHSLLALSSVPLHCLLAQFKALDQG----GSSPQLHRTRSLATVVWLGLTLVRRVLGLEHVMLEQHVGCTSAELLTHANALAVSRAPTPRASMLSSLTAYIDPGTRV------HYLAILLTYLRYPFHTGLCRSAVTLLKWLTQHTPVNIIDYLSPDSSAVIRDSVLDRLASSSSTLPEDPLTRIALFDLIAEAVLASPTDRSGKRTVPILRFLIPSPTLPAGLDKTRNTKPDCLDCCMAVLTEIKSVHGSALPDQLSVLLLCSVTKLIAALYLQEANTYLVMLKSKSRFWDFLTEPMFRLLDA------DVKTQNEFSQVEH--EYCGHVVSILGLELFCTQSCPGSPTQDNSFQQIVSRLTSEDAYTSW 1324          
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Nematostella
Match: EDO41831 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S363])

HSP 1 Score: 60.8474 bits (146), Expect = 6.972e-9
Identity = 74/351 (21.08%), Postives = 146/351 (41.60%), Query Frame = 1
Query:  196 SIEIFKKSE-VKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQDKTSYEFKDENSEEEMAIQGSEEKIELLETMLIAAYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILE---LSGMDNMFVSTDDLSSHFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLG-------LFSYLKSMLGSKPYMITTTEGSYLGLIVHCVLFDLLSLL 1215
            S++  K+SE VKD+IK    KLS++++L     +++F NYL ND +     L+  L     T  +M KI  +Y+EERL +++ ++Y    W++                                         ++ F+++  E    +Q +          LI     ++C  ++T + +    Q  GFG+      ++  RA+ +    +I  LQ L+++E   L G+ N          H + +   + +L+     +G  P  G ++L  ++ R            ++  T  E A+ ++G       +F YL+SML  + +  ++        +V+ ++F +L L 
Sbjct:  116 SLDKIKQSENVKDFIK----KLSKFMDLDVIQTFELFSNYLHNDFRGTPQQLKQKLKNDSQTEHLMLKILDYYFEERLHILQCVKYLLSYWQD----------------------------------------PNHAFREQFMECLNGLQDN--------NTLITKEKTRNC--KLTLQYLQE--QSQGFGMRQINRHIFDGRAEALIP--QISYLQVLVLIESFDLEGLRNHMDDGSFTKHHIVQEPAIIEELDKIFVTWGDLPQHGPIMLAWAVFR-----------YVTMETDQEQAVRRIGSKALQCHVFEYLESMLTFEAFSASSPVAFICKSLVYGLMFIVLGLF 397          
BLAST of Nuclear pore complex protein Nup188 vs. Planmine SMEST
Match: SMESG000039965.1 (SMESG000039965.1)

HSP 1 Score: 3459.85 bits (8970), Expect = 0.000e+0
Identity = 1726/1741 (99.14%), Postives = 1730/1741 (99.37%), Query Frame = 1
Query:  193 KSIEIFKKSEVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQDKTSYEFKDENSEEEMAIQGSEEKIELLETMLIAAYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVSTDDLSSHFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLELKIRQDLVNTMCVIVKPIITCSESQPLNSGFMKMLEDLSSSFPANLSMINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDGDCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLATAVECRIQKDLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTTDDSNLIKQIVSVRNLFPNAQLSAERIISNQSLIEKIWNSELTPINIKIIQSYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQSSSDVTDLAMNCLSFIAEILSIKPNSYLALSDSRRARLELIQKVTHEILVNTSSVIKTILAISCMDVDILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVTNVTSSGFYNSCITIVSHFKFDDEISVKLTCSVSKLFSSLWINECYSAIEILKNMNIWATVITPIKEFIKKLNGNALELNKVKKMSTLHHLFSFVGNVYGLFGMELYSNSGLMRSHKDADFTNSFNELYTTDLFIDFLLVFELNQLESRSANFDRYMSLLLPAIIWWKTLLVTALSMNPPEIGIKGLSDSEEIDLVLRIVDSISNLLSFSVICDSHNFTLILDHLSFSVLEILNKRIKSIPDNGMNSILKKLIPVTAIQYSHIVSFHNRHTDLLAACVLIQHHRSDNSSFQLDLESVIHSYLSILSNNPSLSTLERKVFIQAVNLCIATDTKSQPSTPHLVRPEWVHRLAEMGILHNSFVLLDDCIKKNDXXXXXXXXXXXXIRVAHTNLGAIRIHQSFLLATLQSDIAIDDTDGNCVTFMSRLLQLAVVLINQNKSKSHEFGFRVVLVYWDRLYQMVSDGCQRLSRAVNSAEDYDRIWSYLSVGQFLFDLVWHLLVARGTWALFWPASLINELEKLLQISVNTIAGILSQPQTLFIKNSAYILHGKLRTAKQVHFTAAQSQPKVKSDNSYSSVDDAEKPASHMTVQLASLRLESILYELLHSALLIYSRSTLIGSEDFIYKSIDYNGRLLDESFSECRIEECNVPLXXXXXXXXXXXTHCLLRDDIPSIVIGNEKMAFNRDLMRQIHEIILATIVSHSWLHLSKSVDTSSNKASKNTFVSNLRSELNYYLSEFVKTRRRNTMSSSSPMNAAPRLTSTPYSRKQLSKLDTSSAYDSFDSLCVGIDQFKKALDLM 5415
            K IEIFKKSEVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQDKTSYEFKDENSEEEMAIQGSEEKIELLETMLIAAYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTR QLVNTNERIKVLQSLIILELSGMDNMFVSTDDLSSHFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSML SKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLELKIRQDLVNTMCVIVKPIITCSESQPLNSGFMKMLEDLSSSFPANLSMINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDGDCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLATAVECRIQ DLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTTD+SNLIKQIVSVRNLFPNAQLSAERIISNQSLIEKIWNSELTPINIKIIQSYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQSSSDVTDLAMNCL FI EILSIKPNSYLALSDSRRARLELIQK THEILVNTSSVIKTILAISCMDVDILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNE NESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKI RMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVTNVTSSGFYNSCITIVSHFKFDDEISVKLTCSVSKLFSSLWINECYSAIEILKNMNIWATVITPIKEFIKKLNGNALELNKVKKMSTLHHLFSFVGNVYGLFGMELYSNSGLMRSHKDADFTNSFNELYTTDLFIDFLLVFELNQLESRSANFDRYMSLLLPAIIWWKTLLVTALSMNPPEIGIKGLSDSEEIDLVLRIVDSISNLLSFSVICDSHNFTLILDHLSFSVLEILNKRIKSIPDNGMNSILKKLIPVTAIQYSHIVSFHNRHTDLLAACVLIQHHRSDNSSFQLDLESVIHSYLSILSNNPSLSTLERKVFIQAVNLCIATDTKSQPSTPHLVRPEWVHRLAE GILHNSFVLLDDCIKKNDLTLMPQTLMLLLIRVAHTNLGAIRIHQSFLLATLQSDIAIDDTDGNCVTFMSRLLQLAVVLINQNKSKSHEFGFRVVLVYWDRLYQMVSDGCQRLSRAVNSAEDYDRIWSYLSVGQFLFDLVWHLLVARGTWALFWPASLI+ELEKLLQISVNTIAGILSQPQTLFIKNSAYILHGKLRTAKQVHFTAAQSQPKVKSDNSYSSVDDAEKPASHMTVQLASLRLESILYELLHSALLIYSRSTLIGSEDFIYKSIDYNGRLLDESFSECRIEECNVPLSFGSFFSIISSTHCLLRDDIPSI+IGNEKMAFNRDLMRQIHEIILATIVSHSWLHLSKSVDTSSNKASKNTFVSNLRSELNYYLSEFVKTRRRNTMSSSSP+NAAPRLTSTPYSRKQLSKLDTSSA DSFDSLCVGIDQFKKALDLM
Sbjct:    3 KYIEIFKKSEVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLEDNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLILSKIILSVSGFENKTFLFKKILESYKLIITEIGQDKTSYEFKDENSEEEMAIQGSEEKIELLETMLIAAYSMKDCRDRVTFENVLSMFQESGFGLELNQTKLYGTRTQLVNTNERIKVLQSLIILELSGMDNMFVSTDDLSSHFLIDGKSLSKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAICKLGLFSYLKSMLCSKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLNSLELKIRQDLVNTMCVIVKPIITCSESQPLNSGFMKMLEDLSSSFPANLSMINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDSPDGDFDRNSAKQCRLVRQYQPYLSKSLTLDGDCEGYLMDGNIAWAVHYSIWDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLATAVECRIQTDLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTTDNSNLIKQIVSVRNLFPNAQLSAERIISNQSLIEKIWNSELTPINIKIIQSYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQSSSDVTDLAMNCLLFITEILSIKPNSYLALSDSRRARLELIQKFTHEILVNTSSVIKTILAISCMDVDILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLVKFIFIGPELNSEDQIVIESGSSVIMKLLDGNETNESSQLSGNISHKGRVTMSYSQQYVLKMLEFLAYPYSIKICRMSLDVLKLIVQNSSISIVACLGEKTSFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVTNVTSSGFYNSCITIVSHFKFDDEISVKLTCSVSKLFSSLWINECYSAIEILKNMNIWATVITPIKEFIKKLNGNALELNKVKKMSTLHHLFSFVGNVYGLFGMELYSNSGLMRSHKDADFTNSFNELYTTDLFIDFLLVFELNQLESRSANFDRYMSLLLPAIIWWKTLLVTALSMNPPEIGIKGLSDSEEIDLVLRIVDSISNLLSFSVICDSHNFTLILDHLSFSVLEILNKRIKSIPDNGMNSILKKLIPVTAIQYSHIVSFHNRHTDLLAACVLIQHHRSDNSSFQLDLESVIHSYLSILSNNPSLSTLERKVFIQAVNLCIATDTKSQPSTPHLVRPEWVHRLAETGILHNSFVLLDDCIKKNDLTLMPQTLMLLLIRVAHTNLGAIRIHQSFLLATLQSDIAIDDTDGNCVTFMSRLLQLAVVLINQNKSKSHEFGFRVVLVYWDRLYQMVSDGCQRLSRAVNSAEDYDRIWSYLSVGQFLFDLVWHLLVARGTWALFWPASLIDELEKLLQISVNTIAGILSQPQTLFIKNSAYILHGKLRTAKQVHFTAAQSQPKVKSDNSYSSVDDAEKPASHMTVQLASLRLESILYELLHSALLIYSRSTLIGSEDFIYKSIDYNGRLLDESFSECRIEECNVPLSFGSFFSIISSTHCLLRDDIPSILIGNEKMAFNRDLMRQIHEIILATIVSHSWLHLSKSVDTSSNKASKNTFVSNLRSELNYYLSEFVKTRRRNTMSSSSPLNAAPRLTSTPYSRKQLSKLDTSSASDSFDSLCVGIDQFKKALDLM 1743          
The following BLAST results are available for this feature:
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
NUP1883.549e-1619.96nucleoporin 188 [Source:HGNC Symbol;Acc:HGNC:17859... [more]
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
nup1882.801e-1223.01nucleoporin 188 [Source:ZFIN;Acc:ZDB-GENE-030131-7... [more]
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nup1888.429e-2021.23nucleoporin 188kDa [Source:NCBI gene;Acc:100135081... [more]
nup1889.499e-2021.23nucleoporin 188kDa [Source:NCBI gene;Acc:100135081... [more]
nup1881.197e-1921.23nucleoporin 188kDa [Source:NCBI gene;Acc:100135081... [more]
nup1881.824e-1721.23nucleoporin 188kDa [Source:NCBI gene;Acc:100135081... [more]
nup1881.429e-1023.10nucleoporin 188kDa [Source:NCBI gene;Acc:100135081... [more]
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Nup1882.271e-1123.76nucleoporin 188 [Source:MGI Symbol;Acc:MGI:2446190... [more]
back to top
BLAST of Nuclear pore complex protein Nup188 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|F6WXT2|NU188_XENTR1.065e-1721.19Nucleoporin NUP188 homolog OS=Xenopus tropicalis O... [more]
sp|Q5SRE5|NU188_HUMAN1.704e-1519.96Nucleoporin NUP188 homolog OS=Homo sapiens OX=9606... [more]
sp|Q6ZQH8|NU188_MOUSE1.588e-1023.76Nucleoporin NUP188 homolog OS=Mus musculus OX=1009... [more]
back to top
BLAST of Nuclear pore complex protein Nup188 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A183B6N11.095e-2320.62Uncharacterized protein OS=Echinostoma caproni OX=... [more]
A0A0X3NLM93.983e-2220.49Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0X3PCV05.897e-2220.49Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A4E0RX585.321e-2022.87Uncharacterized protein OS=Fasciola hepatica OX=61... [more]
A0A504YQN21.766e-1922.67Uncharacterized protein OS=Fasciola gigantica OX=4... [more]
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO418316.972e-921.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Nuclear pore complex protein Nup188 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000039965.10.000e+099.14SMESG000039965.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023829 ID=SMED30023829|Name=Nuclear pore complex protein Nup188|organism=Schmidtea mediterranea sexual|type=transcript|length=5446bp
CGATTTCACAAGATACTGAAAATTTAATTAAATTAAATGTCTTGTTCAAG
AAATTTACAATTCTGTATTAATCATTCATTTTTATTAAATCTTCCTAATT
CAAAAATATATGATGAACAGTTTATAAAATATTTCCAAACAATTTTATCT
CAGTTACAAAAGCTTTTAGATTATTATAAAAGATATGACGAAAAAAGCAT
TGAAATATTTAAGAAATCTGAAGTTAAAGATTATATTAAAAGTTTTGTGA
TTAAACTATCACAATATTTGAATTTATCATGTGAAATCGGTTATGATGTA
TTTAAAAATTATCTTCTGAACGATGGCAAACTCGAAGACAATGATTTACA
ATCTATGCTTACGAGGGGTTATAATACGATTTCAATAATGCAAAAGATAA
AAAAATTTTATTATGAAGAACGGTTAAGTTTGATAAGAATTATTCGATAC
GCATTTTGTGATTGGAAGGAAGAATTTCTAATTTTATCAAAAATTATTTT
GAGTGTTTCTGGTTTTGAGAATAAAACTTTTCTATTTAAAAAAATATTAG
AATCATATAAACTGATTATTACCGAAATTGGTCAAGATAAAACAAGCTAT
GAATTCAAAGACGAAAATTCTGAAGAAGAAATGGCAATTCAAGGATCTGA
GGAAAAAATTGAATTGTTAGAAACGATGCTTATCGCTGCTTATTCAATGA
AAGATTGCCGAGATAGAGTAACATTCGAAAATGTTTTGTCAATGTTCCAA
GAATCCGGATTCGGATTGGAATTGAATCAAACTAAATTGTATGGTACACG
AGCACAGCTGGTAAATACAAATGAAAGAATCAAAGTACTTCAATCATTAA
TAATTCTGGAATTGTCCGGGATGGATAACATGTTTGTTTCGACTGATGAT
TTATCCAGTCATTTTCTTATTGATGGCAAATCTCTCAGCAAACTCAATCT
TTCTATCAATAAATTTGGCACAAATCCGTCCGATGGGATACTACTCCTTT
TTATGTCGTTAATGCGAAACAATTTCCCTATTGACAACAATACCAGTTGC
TCAATGAGCTCAGGAACGATGGCTGAAACTGCCATCTGTAAATTGGGATT
GTTTTCATATCTCAAATCAATGCTCGGCTCTAAGCCATATATGATCACAA
CCACTGAGGGATCTTATCTGGGTTTAATCGTTCATTGCGTGCTTTTTGAC
TTATTGTCCCTACTGTGTTACGGAATACATTTGAATTCCCTGGAGTTGAA
AATCCGACAAGATCTCGTTAATACGATGTGCGTAATTGTCAAGCCGATCA
TCACATGCAGTGAGTCGCAACCGTTGAATAGTGGATTCATGAAAATGTTG
GAGGATCTGTCATCGAGTTTCCCGGCAAATTTGAGCATGATCAACGTGAT
CGGGTGTCTAATGAAGAAATCTGATGACGGATCACAAAATGAGATTATTG
AAATCGTCTCGGAATTCATTGAGAATCTCTCGTGGTTTTCCGACGGCAGA
TGCATGAAAATGGACTGTGTAATGGTTGTCGATAGTCCTGACGGTGATTT
TGATAGAAATTCTGCCAAGCAATGTCGGCTTGTTAGACAATATCAGCCCT
ACTTATCGAAATCTCTGACATTGGACGGTGATTGTGAGGGCTATTTGATG
GATGGAAATATCGCCTGGGCTGTCCATTACAGCATTTGGGATGTGATTGG
CGCAGAAGTTGAATTGACTCGACGATTGATTTCTCACGGACAGCGAGATA
TGGACCTCGGTGTCGGTCCGGCGAATATTTCGAGTATTTACAGTCAATTC
GAACGACTGGAACTCATTCTCGATTTCCTCGCTACCGCTGTAGAATGCCG
CATACAAAAAGATCTAATTATCAATATATTCTGCAATCTATGGTCGATGA
TTGAAAACGATTCCTTCTTTATTGAAGGTTGCGAGTCCCTGTTAATCACG
GTCATTAATTTGACGGGGAAAATTTTGTGTACCACAGATGACTCTAATCT
AATAAAGCAAATCGTTTCTGTTAGGAACTTGTTTCCTAACGCCCAGCTGT
CCGCAGAAAGAATCATTTCCAATCAGTCTCTGATAGAGAAAATCTGGAAC
TCTGAGCTCACTCCAATCAACATAAAAATTATTCAATCGTATTTGAAATT
CAATATCTGTTTGATTCAGAACGAGAAATATTTCGATTCAGAAATCGGCG
TCATACCTTCTTCACTGATTTTTGGTAGCATTAACTTTGTTATAAGGTTG
GTGTTGGACAATGTAAACAAGCGGACTTTTCAAAGCTCCTCGGACGTAAC
TGATCTCGCAATGAATTGTTTGTCGTTTATTGCTGAAATTTTGAGCATCA
AACCGAACTCCTATTTGGCTTTATCCGATTCTCGGAGAGCTCGCTTGGAA
TTGATTCAAAAAGTCACCCATGAAATACTGGTCAATACGAGCAGTGTAAT
AAAAACAATCCTTGCTATTTCTTGCATGGATGTTGATATCCTATTAAAAC
AATGCAACCTTTCCAACCAAATGCTGGGAATATACGGAACAGAGGAACAA
TTGAGTAGATTAGTATGGCTAGCATTGACATTGGTGAAATTCATCTTCAT
TGGGCCTGAATTGAACAGCGAAGACCAAATTGTCATTGAAAGCGGCTCAT
CTGTGATAATGAAATTGCTTGATGGCAACGAGCCCAACGAGTCGTCACAG
TTGTCAGGGAACATTTCCCATAAAGGCCGAGTAACTATGAGCTATTCTCA
GCAGTATGTCTTGAAAATGCTGGAATTTCTCGCATATCCATACAGCATTA
AAATATCTCGAATGTCATTGGATGTGCTGAAATTGATTGTACAAAACAGC
AGCATTTCGATTGTGGCCTGCCTTGGAGAGAAAACTTCATTTATCCGAGA
CTTGTTTCTGCGTATCTGTGCCAGCACGATGGAAGATCAAATAGTGCGTG
CGAATCTGTTTGATTTCCTCAGTGAATGTGTTATGTGCGGTCGACACGGG
GTGTTACAGTTGATTGGTCCAGGCAAATCCGTTACCAATGTCACATCGAG
CGGTTTCTATAACAGCTGTATCACTATTGTCTCTCATTTCAAGTTCGATG
ATGAAATATCCGTAAAACTAACCTGTTCAGTTTCCAAGTTGTTTTCATCT
CTGTGGATTAACGAATGTTATTCGGCTATTGAGATTTTGAAAAACATGAA
CATCTGGGCAACAGTAATCACCCCGATTAAAGAATTTATCAAAAAACTGA
ATGGAAATGCACTAGAACTGAACAAAGTAAAAAAAATGTCGACATTGCAT
CATTTGTTCAGTTTCGTTGGCAACGTTTATGGATTATTCGGAATGGAGCT
GTATTCGAATTCCGGCCTGATGAGATCTCATAAAGATGCAGATTTCACCA
ATTCATTCAATGAGCTCTACACAACGGATTTGTTTATCGATTTCCTTCTC
GTGTTTGAGCTCAACCAATTGGAATCGAGATCGGCAAATTTCGATCGCTA
TATGAGTCTACTGCTGCCTGCGATCATTTGGTGGAAAACCCTCCTCGTCA
CTGCACTCTCAATGAATCCCCCGGAAATCGGCATCAAGGGCCTCTCGGAC
TCCGAGGAAATCGATCTCGTTCTGAGAATCGTCGATAGCATTTCCAATCT
GCTTTCCTTTTCCGTGATCTGCGACAGTCACAATTTCACTCTCATTCTCG
ATCATTTGAGTTTTAGCGTCTTAGAGATTCTAAATAAGAGAATTAAATCG
ATTCCAGACAACGGGATGAATTCTATCCTCAAGAAATTGATTCCAGTTAC
AGCAATCCAATACTCGCATATTGTATCCTTCCATAACCGCCATACCGATC
TATTAGCGGCTTGCGTTCTCATTCAGCACCATCGTTCCGATAATTCTTCA
TTTCAACTCGATCTAGAATCAGTTATCCATTCATATCTGTCGATCCTTTC
CAACAATCCCTCTCTGTCGACACTGGAGAGGAAGGTTTTCATTCAAGCTG
TCAATCTCTGCATAGCAACCGACACGAAATCTCAACCCAGCACTCCTCAT
CTCGTTAGGCCGGAATGGGTGCACCGATTGGCTGAGATGGGAATTCTACA
CAATTCATTTGTCCTATTGGACGACTGTATCAAGAAAAACGATTTAACGC
TTATGCCGCAAACATTGATGCTGTTACTCATACGAGTTGCCCACACAAAT
CTCGGTGCGATCAGAATCCATCAGTCGTTTCTATTGGCAACCCTCCAGTC
TGATATCGCTATTGACGACACTGACGGCAATTGCGTGACCTTCATGTCGC
GTCTCCTCCAGCTGGCAGTAGTGCTGATCAATCAGAACAAATCCAAGTCT
CACGAATTCGGATTCCGGGTCGTTCTCGTCTACTGGGATCGATTGTACCA
AATGGTTTCCGACGGATGTCAGCGACTCAGTCGAGCAGTGAACTCTGCTG
AGGATTACGATCGGATCTGGTCGTATTTGAGTGTTGGACAATTCCTGTTC
GATCTCGTCTGGCACTTGCTGGTTGCCAGGGGAACCTGGGCGCTGTTCTG
GCCTGCGTCTCTCATTAATGAGCTGGAGAAACTGCTGCAAATCTCTGTCA
ACACGATCGCTGGGATTCTCTCTCAACCGCAAACACTTTTCATCAAGAAT
TCCGCTTACATTTTACACGGGAAACTCAGAACTGCCAAACAAGTACATTT
TACGGCAGCACAGAGTCAGCCCAAGGTGAAATCGGACAACAGCTATTCTT
CTGTGGACGATGCCGAGAAGCCCGCATCTCACATGACGGTGCAACTGGCC
TCCTTGAGGCTGGAATCGATTCTGTATGAACTTTTGCACAGTGCGCTGCT
CATTTATTCACGGTCGACACTGATTGGATCAGAGGACTTCATATATAAGT
CAATCGATTATAACGGAAGATTATTGGATGAAAGCTTCAGCGAATGCAGA
ATTGAAGAGTGTAATGTCCCTCTGTCCTTTGGTAGTTTCTTCTCGATAAT
CAGCTCTACTCATTGCCTATTGAGAGACGACATCCCGAGCATCGTGATCG
GGAATGAAAAGATGGCATTCAATCGAGATCTGATGCGGCAGATCCATGAG
ATCATATTGGCCACCATCGTGTCCCACTCCTGGCTCCATTTATCCAAATC
CGTCGACACCAGCTCCAACAAGGCTAGCAAGAACACTTTTGTCTCAAATT
TGCGATCGGAACTCAACTATTACCTGAGCGAGTTCGTGAAGACCAGGCGG
CGCAACACGATGTCATCTAGCAGCCCCATGAATGCCGCCCCGAGGTTGAC
CAGCACTCCATACTCAAGGAAACAGCTCTCTAAGCTCGACACGAGCTCAG
CCTATGATAGCTTTGATTCGCTCTGCGTCGGAATCGATCAATTCAAAAAG
GCATTAGATTTGATGTGATGTGTGTATTTAATAGATTTCGTAGTTG
back to top

protein sequence of SMED30023829-orf-1

>SMED30023829-orf-1 ID=SMED30023829-orf-1|Name=SMED30023829-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1794bp
MSCSRNLQFCINHSFLLNLPNSKIYDEQFIKYFQTILSQLQKLLDYYKRY
DEKSIEIFKKSEVKDYIKSFVIKLSQYLNLSCEIGYDVFKNYLLNDGKLE
DNDLQSMLTRGYNTISIMQKIKKFYYEERLSLIRIIRYAFCDWKEEFLIL
SKIILSVSGFENKTFLFKKILESYKLIITEIGQDKTSYEFKDENSEEEMA
IQGSEEKIELLETMLIAAYSMKDCRDRVTFENVLSMFQESGFGLELNQTK
LYGTRAQLVNTNERIKVLQSLIILELSGMDNMFVSTDDLSSHFLIDGKSL
SKLNLSINKFGTNPSDGILLLFMSLMRNNFPIDNNTSCSMSSGTMAETAI
CKLGLFSYLKSMLGSKPYMITTTEGSYLGLIVHCVLFDLLSLLCYGIHLN
SLELKIRQDLVNTMCVIVKPIITCSESQPLNSGFMKMLEDLSSSFPANLS
MINVIGCLMKKSDDGSQNEIIEIVSEFIENLSWFSDGRCMKMDCVMVVDS
PDGDFDRNSAKQCRLVRQYQPYLSKSLTLDGDCEGYLMDGNIAWAVHYSI
WDVIGAEVELTRRLISHGQRDMDLGVGPANISSIYSQFERLELILDFLAT
AVECRIQKDLIINIFCNLWSMIENDSFFIEGCESLLITVINLTGKILCTT
DDSNLIKQIVSVRNLFPNAQLSAERIISNQSLIEKIWNSELTPINIKIIQ
SYLKFNICLIQNEKYFDSEIGVIPSSLIFGSINFVIRLVLDNVNKRTFQS
SSDVTDLAMNCLSFIAEILSIKPNSYLALSDSRRARLELIQKVTHEILVN
TSSVIKTILAISCMDVDILLKQCNLSNQMLGIYGTEEQLSRLVWLALTLV
KFIFIGPELNSEDQIVIESGSSVIMKLLDGNEPNESSQLSGNISHKGRVT
MSYSQQYVLKMLEFLAYPYSIKISRMSLDVLKLIVQNSSISIVACLGEKT
SFIRDLFLRICASTMEDQIVRANLFDFLSECVMCGRHGVLQLIGPGKSVT
NVTSSGFYNSCITIVSHFKFDDEISVKLTCSVSKLFSSLWINECYSAIEI
LKNMNIWATVITPIKEFIKKLNGNALELNKVKKMSTLHHLFSFVGNVYGL
FGMELYSNSGLMRSHKDADFTNSFNELYTTDLFIDFLLVFELNQLESRSA
NFDRYMSLLLPAIIWWKTLLVTALSMNPPEIGIKGLSDSEEIDLVLRIVD
SISNLLSFSVICDSHNFTLILDHLSFSVLEILNKRIKSIPDNGMNSILKK
LIPVTAIQYSHIVSFHNRHTDLLAACVLIQHHRSDNSSFQLDLESVIHSY
LSILSNNPSLSTLERKVFIQAVNLCIATDTKSQPSTPHLVRPEWVHRLAE
MGILHNSFVLLDDCIKKNDLTLMPQTLMLLLIRVAHTNLGAIRIHQSFLL
ATLQSDIAIDDTDGNCVTFMSRLLQLAVVLINQNKSKSHEFGFRVVLVYW
DRLYQMVSDGCQRLSRAVNSAEDYDRIWSYLSVGQFLFDLVWHLLVARGT
WALFWPASLINELEKLLQISVNTIAGILSQPQTLFIKNSAYILHGKLRTA
KQVHFTAAQSQPKVKSDNSYSSVDDAEKPASHMTVQLASLRLESILYELL
HSALLIYSRSTLIGSEDFIYKSIDYNGRLLDESFSECRIEECNVPLSFGS
FFSIISSTHCLLRDDIPSIVIGNEKMAFNRDLMRQIHEIILATIVSHSWL
HLSKSVDTSSNKASKNTFVSNLRSELNYYLSEFVKTRRRNTMSSSSPMNA
APRLTSTPYSRKQLSKLDTSSAYDSFDSLCVGIDQFKKALDLM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005643nuclear pore
GO:0044611nuclear pore inner ring
Vocabulary: biological process
TermDefinition
GO:0006405RNA export from nucleus
GO:0006606protein import into nucleus
GO:0006810transport
GO:0015031protein transport
GO:0051028mRNA transport
Vocabulary: molecular function
TermDefinition
GO:0017056structural constituent of nuclear pore
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePANTHERPTHR31431FAMILY NOT NAMEDcoord: 34..1178