DNA helicase

Overview
NameDNA helicase
Smed IDSMED30023821
Length (bp)2437
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DNA helicase (SMED30023821) t-SNE clustered cells

Violin plots show distribution of expression levels for DNA helicase (SMED30023821) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DNA helicase (SMED30023821) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DNA helicase (SMED30023821) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023821

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023821SMESG000060238.1 SmedASXL_012910SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023821SMESG000060238.1 SmedASXL_012910SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
cephalic gangliaSMED30023821SMESG000060238.1 dd_Smed_v4_5956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023821SMESG000060238.1 dd_Smed_v4_5956_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023821SMESG000060238.1 Contig48512newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023821SMESG000060238.1 Contig48512uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
parapharyngeal regionSMED30023821SMESG000060238.1 dd_Smed_v6_5956_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
zeta neoblastSMED30023821SMESG000060238.1 dd_Smed_v4_5956_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023821SMESG000060238.1 SmWIOct06_033228GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023821SMESG000060238.1 SMED_04028_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023821SMESG000060238.1 SMED_04028_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DNA helicase vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 402/733 (54.84%), Postives = 530/733 (72.31%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIP--DENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNR----LIDEEEAKLSQERVVEI-RALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKL-LEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E+F+ FL +F   +   +EN   DI     +PLY+Q++ E++++   ++N++C H+  +D++L   LI YP+EVIP  D   + +F   Y D      I  RP+N   ++N+RNLNPED+DQL+T++G+VIR S++IPEM +A F+C VC + T+V  +RGRI +P  C +C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHTV+L+ + DLVD +QPGDRV VTGIYRA   R N +   +K+V+KT++DV+H++K+  +    L +E E KL  E+ VE+ + LS+KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ I++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANPI S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIAYA                   I P LSEEA   + E YV+MRK+G++ +G +SAYPRQLESLIRLAEAHA++RLS++V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA A+ KL L + +T    YQ++ +++R QSD  IT+DMFE+ L  L  ++ +  T KT+R
Sbjct:  151 VIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDI----TEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAH----------------STIMPRLSEEASQALIEAYVDMRKIGSS-RGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVR 861          
BLAST of DNA helicase vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 402/733 (54.84%), Postives = 530/733 (72.31%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIP--DENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNR----LIDEEEAKLSQERVVEI-RALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKL-LEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E+F+ FL +F   +   +EN   DI     +PLY+Q++ E++++   ++N++C H+  +D++L   LI YP+EVIP  D   + +F   Y D      I  RP+N   ++N+RNLNPED+DQL+T++G+VIR S++IPEM +A F+C VC + T+V  +RGRI +P  C +C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHTV+L+ + DLVD +QPGDRV VTGIYRA   R N +   +K+V+KT++DV+H++K+  +    L +E E KL  E+ VE+ + LS+KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ I++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANPI S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIAYA                   I P LSEEA   + E YV+MRK+G++ +G +SAYPRQLESLIRLAEAHA++RLS++V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA A+ KL L + +T    YQ++ +++R QSD  IT+DMFE+ L  L  ++ +  T KT+R
Sbjct:  151 VIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDI----TEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAH----------------STIMPRLSEEASQALIEAYVDMRKIGSS-RGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVR 861          
BLAST of DNA helicase vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 805.438 bits (2079), Expect = 0.000e+0
Identity = 402/733 (54.84%), Postives = 530/733 (72.31%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIP--DENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNR----LIDEEEAKLSQERVVEI-RALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKL-LEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E+F+ FL +F   +   +EN   DI     +PLY+Q++ E++++   ++N++C H+  +D++L   LI YP+EVIP  D   + +F   Y D      I  RP+N   ++N+RNLNPED+DQL+T++G+VIR S++IPEM +A F+C VC + T+V  +RGRI +P  C +C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHTV+L+ + DLVD +QPGDRV VTGIYRA   R N +   +K+V+KT++DV+H++K+  +    L +E E KL  E+ VE+ + LS+KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ I++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANPI S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIAYA                   I P LSEEA   + E YV+MRK+G++ +G +SAYPRQLESLIRLAEAHA++RLS++V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA A+ KL L + +T    YQ++ +++R QSD  IT+DMFE+ L  L  ++ +  T KT+R
Sbjct:  101 VIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDI----TEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAH----------------STIMPRLSEEASQALIEAYVDMRKIGSS-RGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVR 811          
BLAST of DNA helicase vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 786.563 bits (2030), Expect = 0.000e+0
Identity = 402/774 (51.94%), Postives = 530/774 (68.48%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIP--DENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVT-----------------------------------------GIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNR----LIDEEEAKLSQERVVEI-RALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKL-LEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E+F+ FL +F   +   +EN   DI     +PLY+Q++ E++++   ++N++C H+  +D++L   LI YP+EVIP  D   + +F   Y D      I  RP+N   ++N+RNLNPED+DQL+T++G+VIR S++IPEM +A F+C VC + T+V  +RGRI +P  C +C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHTV+L+ + DLVD +QPGDRV VT                                         GIYRA   R N +   +K+V+KT++DV+H++K+  +    L +E E KL  E+ VE+ + LS+KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ I++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANPI S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIAYA                   I P LSEEA   + E YV+MRK+G++ +G +SAYPRQLESLIRLAEAHA++RLS++V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA A+ KL L + +T    YQ++ +++R QSD  IT+DMFE+ L  L  ++ +  T KT+R
Sbjct:  151 VIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDI----TEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTDGVLLSSPRLESNGTILAHRNLRLPGSSHSPASASRVAGITGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAH----------------STIMPRLSEEASQALIEAYVDMRKIGSS-RGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVR 902          
BLAST of DNA helicase vs. Ensembl Human
Match: MCM4 (minichromosome maintenance complex component 4 [Source:HGNC Symbol;Acc:HGNC:6947])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 352/642 (54.83%), Postives = 445/642 (69.31%), Query Frame = 2
Query:  467 DCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNR----LIDEEEAKLSQERVVEI-RALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKL-LEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            D   + +F   Y D      I  RP+N   ++N+RNLNPED+DQL+T++G+VIR S++IPEM +A F+C                                             IKLQESPEDMPAG+TPHTV+L+ + DLVD +QPGDRV VTGIYRA   R N +   +K+V+KT++DV+H++K+  +    L +E E KL  E+ VE+ + LS+KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ I++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANPI S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIAYA                   I P LSEEA   + E YV+MRK+G++ +G +SAYPRQLESLIRLAEAHA++RLS++V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA A+ KL L + +T    YQ++ +++R QSD  IT+DMFE+ L  L  ++ +  T KT+R
Sbjct:    1 DMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQ--------------------------------------------IKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAH----------------STIMPRLSEEASQALIEAYVDMRKIGSS-RGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVR 580          
BLAST of DNA helicase vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 351/738 (47.56%), Postives = 490/738 (66.40%), Query Frame = 2
Query:  191 PQNLIYGTNINITNIMESFRSFLLQFKTE--IPDENFVTDI-----RFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNY-VDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQK-SKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYC---GHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            P+  ++GT I + ++  SFR FL  FK      DEN +T         + + P Y++++ E +      IN++  HL  +  +L   +I YP +VIP +D V + +F   +     + I  RP+N + +RN+R LNP D+DQL+T++G+V R S +IPEM   +F+C+VC    +   ++GRI +P  C  C   H  Q+VHN   F+DKQ++KLQESP+DMP+GETPHTV +Y +  LV+++QPGDR+TVTGI+RA   + N KQR + +V++T +D LHF+K   +RL  +    +++ER+ +I  LS++PD+ + L+ +IAP+IY ++ +K+GLL +LFGG  K+ +     + +RS I++LLCGDPGTSKSQ+LQYVY L PR QYTSGKGSS VGLTA +++D +T    LQ+GAL L+DNG+CCIDEFDKM ++ RSVLHEVMEQQ+LSIAKAGIICQL+AR SVLAAANP+ S W+  KTI+ENI LP TLLSRFDLIFLI+D QDE  D +L  H+V LY    G+ + TE   VD  +LRDYIAYAK                 NIHP LSEEA  ++ E+Y+ MRK G A  GQI+AYPRQLESLIRL+EAHA++RLS +V+V D  +A  L REALKQ+A+DP TG +D+ IL +G+S   RK  E +  A+ K L+  +   F   + L      +D+   R++F++ +N L  +  I  +   IR
Sbjct:  103 PRLYVWGTRICVADVQRSFRDFLTTFKISQLAEDENMMTGHDEALHEIDVNHPYYMERLLECNDAEVTHINLNLKHLNAFSEALYRKVIAYPADVIPYLDIVVNEVFAERFNRTLAQSIELRPFNAQKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAFGIESEVDKGRIEEPVVCTNCSNTHCFQLVHNRSVFLDKQVVKLQESPDDMPSGETPHTVSVYAHGSLVESVQPGDRITVTGIFRATGMKVNPKQRALASVYRTSIDALHFRKMDTSRLHQDNGETITEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTK-LRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFENDGNQEKTE--HVDMNLLRDYIAYAKA----------------NIHPKLSEEASQFIIEKYLFMRKAG-AQHGQITAYPRQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREALKQSAVDPSTGRVDVAILASGMSASGRKAVEAMCEAVLKQLKTAK--GFVTSKALFHTLKSADKTCQREVFDEAINELSKKESIARSGDRIR 818          
BLAST of DNA helicase vs. Ensembl Celegans
Match: mcm-4 (DNA replication licensing factor mcm-4 [Source:UniProtKB/Swiss-Prot;Acc:Q95XQ8])

HSP 1 Score: 684.1 bits (1764), Expect = 0.000e+0
Identity = 351/738 (47.56%), Postives = 490/738 (66.40%), Query Frame = 2
Query:  191 PQNLIYGTNINITNIMESFRSFLLQFKTE--IPDENFVTDI-----RFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNY-VDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQK-SKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYC---GHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            P+  ++GT I + ++  SFR FL  FK      DEN +T         + + P Y++++ E +      IN++  HL  +  +L   +I YP +VIP +D V + +F   +     + I  RP+N + +RN+R LNP D+DQL+T++G+V R S +IPEM   +F+C+VC    +   ++GRI +P  C  C   H  Q+VHN   F+DKQ++KLQESP+DMP+GETPHTV +Y +  LV+++QPGDR+TVTGI+RA   + N KQR + +V++T +D LHF+K   +RL  +    +++ER+ +I  LS++PD+ + L+ +IAP+IY ++ +K+GLL +LFGG  K+ +     + +RS I++LLCGDPGTSKSQ+LQYVY L PR QYTSGKGSS VGLTA +++D +T    LQ+GAL L+DNG+CCIDEFDKM ++ RSVLHEVMEQQ+LSIAKAGIICQL+AR SVLAAANP+ S W+  KTI+ENI LP TLLSRFDLIFLI+D QDE  D +L  H+V LY    G+ + TE   VD  +LRDYIAYAK                 NIHP LSEEA  ++ E+Y+ MRK G A  GQI+AYPRQLESLIRL+EAHA++RLS +V+V D  +A  L REALKQ+A+DP TG +D+ IL +G+S   RK  E +  A+ K L+  +   F   + L      +D+   R++F++ +N L  +  I  +   IR
Sbjct:  103 PRLYVWGTRICVADVQRSFRDFLTTFKISQLAEDENMMTGHDEALHEIDVNHPYYMERLLECNDAEVTHINLNLKHLNAFSEALYRKVIAYPADVIPYLDIVVNEVFAERFNRTLAQSIELRPFNAQKTRNMRGLNPNDVDQLITISGMVTRTSSLIPEMRSGYFQCAVCAFGIESEVDKGRIEEPVVCTNCSNTHCFQLVHNRSVFLDKQVVKLQESPDDMPSGETPHTVSVYAHGSLVESVQPGDRITVTGIFRATGMKVNPKQRALASVYRTSIDALHFRKMDTSRLHQDNGETITEERIQQIIELSKRPDIMDALAQSIAPSIYEHDDVKRGLLCLLFGGTRKDDETTNKTK-LRSEINILLCGDPGTSKSQMLQYVYRLLPRSQYTSGKGSSAVGLTASVSRDADTKQLVLQTGALVLADNGVCCIDEFDKMNESARSVLHEVMEQQTLSIAKAGIICQLNARASVLAAANPVDSKWNRNKTIVENITLPHTLLSRFDLIFLIVDAQDEMQDRRLGNHLVSLYFENDGNQEKTE--HVDMNLLRDYIAYAKA----------------NIHPKLSEEASQFIIEKYLFMRKAG-AQHGQITAYPRQLESLIRLSEAHAKIRLSQEVSVDDVEKAFTLWREALKQSAVDPSTGRVDVAILASGMSASGRKAVEAMCEAVLKQLKTAK--GFVTSKALFHTLKSADKTCQREVFDEAINELSKKESIARSGDRIR 818          
BLAST of DNA helicase vs. Ensembl Celegans
Match: mcm-5 (DNA replication licensing factor mcm-5 [Source:UniProtKB/Swiss-Prot;Acc:Q21902])

HSP 1 Score: 328.176 bits (840), Expect = 2.743e-100
Identity = 223/687 (32.46%), Postives = 352/687 (51.24%), Query Frame = 2
Query:  233 IMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMD----CVADSLFK---SNYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCN----NVTKVPCERGRIIDPEFCNQCQAKHTQQ-------IVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQ-RENSKQRVIKAVFKTYLDVL--HFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTE------PGTVDT-----------------AMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRK-VGNAG------KGQISAYP---RQLESLIRLAEAHARMRLSDQVTVADCLEARRLQR-EALKQAAIDPLTGL 2128
            ++  +R  + QF+      NF+ D        +Y  ++K         + I+ +HL  +D  +   L  +P +V+PA++     VAD +           H+  +T   + E   +LR +    + Q+V ++G+++  +++  +  K   +C  C     +V+  P   G  + P  C   Q    Q+       ++ + CE +D Q +KLQE+PED+P GE P  + L+  + L D + PG+RVT+ G+Y      ++    + ++ +   YL VL  H + S     +       +ER+   + L+Q+ D YE ++ +IAP+IYG+  IKK +  +LFGG     KKL  G   R +I+VLL GDPGT+KSQLL++V  ++P G YTSGKGSS  GLTA + +DP++ S  ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD  +   +NI   PT+LSRFD+I+++ D  D   DA LA+H++ ++   +   E      P T  T                   L+ ++ YA++                N  P L+ +A   +   YV+MR  V NA       K   SA P   RQLE+++R+AE+ A+M L    T     EA RL R   ++ AA   L G+
Sbjct:   28 LIAEYRQLITQFR------NFIRDFSTGGFGMIYRDQLKRNYFSHEYRLEINLNHLKNFDEDIEMKLRKFPGKVLPALEEAAKIVADEITTPRPKGEEKLHDIQVTLTLD-EYPTSLRQVKSAQVSQVVKISGIIVAAAQVRSKATKVTLQCRQCKHTIPDVSIKPGLEGFAL-PRTCAAPQQGQMQRCPIDPYIMLPDKCECVDYQTLKLQENPEDVPHGEMPRHLQLFTERYLTDKVVPGNRVTIVGVYSIKKLIQKKGGDKSLQGIRTPYLRVLGIHMETSGPGRTNFTTFTPEEERM--FKTLAQRKDAYELIAKSIAPSIYGSADIKKSIACLLFGG---ARKKLPDGITRRGDINVLLLGDPGTAKSQLLKFVEQVSPIGVYTSGKGSSAAGLTASVIRDPQSRSFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDESRG-DDNIDFMPTILSRFDMIYIVKDTHDVLKDATLAKHVIEVHVNASAAKERDIAGVPKTATTDSDGVMTMFDTDGFLTIEFLKKFVTYARL----------------NCGPRLTPQASEKLVNHYVKMRNPVVNADAFKSGKKAHNSAIPITVRQLEAIVRIAESIAKMELQQFATDKHVEEALRLFRVSTIEAAATGNLAGV 684          
BLAST of DNA helicase vs. Ensembl Celegans
Match: mcm-5 (DNA replication licensing factor mcm-5 [Source:UniProtKB/Swiss-Prot;Acc:Q21902])

HSP 1 Score: 328.176 bits (840), Expect = 2.743e-100
Identity = 223/687 (32.46%), Postives = 352/687 (51.24%), Query Frame = 2
Query:  233 IMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMD----CVADSLFK---SNYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCN----NVTKVPCERGRIIDPEFCNQCQAKHTQQ-------IVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQ-RENSKQRVIKAVFKTYLDVL--HFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTE------PGTVDT-----------------AMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRK-VGNAG------KGQISAYP---RQLESLIRLAEAHARMRLSDQVTVADCLEARRLQR-EALKQAAIDPLTGL 2128
            ++  +R  + QF+      NF+ D        +Y  ++K         + I+ +HL  +D  +   L  +P +V+PA++     VAD +           H+  +T   + E   +LR +    + Q+V ++G+++  +++  +  K   +C  C     +V+  P   G  + P  C   Q    Q+       ++ + CE +D Q +KLQE+PED+P GE P  + L+  + L D + PG+RVT+ G+Y      ++    + ++ +   YL VL  H + S     +       +ER+   + L+Q+ D YE ++ +IAP+IYG+  IKK +  +LFGG     KKL  G   R +I+VLL GDPGT+KSQLL++V  ++P G YTSGKGSS  GLTA + +DP++ S  ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD  +   +NI   PT+LSRFD+I+++ D  D   DA LA+H++ ++   +   E      P T  T                   L+ ++ YA++                N  P L+ +A   +   YV+MR  V NA       K   SA P   RQLE+++R+AE+ A+M L    T     EA RL R   ++ AA   L G+
Sbjct:   28 LIAEYRQLITQFR------NFIRDFSTGGFGMIYRDQLKRNYFSHEYRLEINLNHLKNFDEDIEMKLRKFPGKVLPALEEAAKIVADEITTPRPKGEEKLHDIQVTLTLD-EYPTSLRQVKSAQVSQVVKISGIIVAAAQVRSKATKVTLQCRQCKHTIPDVSIKPGLEGFAL-PRTCAAPQQGQMQRCPIDPYIMLPDKCECVDYQTLKLQENPEDVPHGEMPRHLQLFTERYLTDKVVPGNRVTIVGVYSIKKLIQKKGGDKSLQGIRTPYLRVLGIHMETSGPGRTNFTTFTPEEERM--FKTLAQRKDAYELIAKSIAPSIYGSADIKKSIACLLFGG---ARKKLPDGITRRGDINVLLLGDPGTAKSQLLKFVEQVSPIGVYTSGKGSSAAGLTASVIRDPQSRSFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDESRG-DDNIDFMPTILSRFDMIYIVKDTHDVLKDATLAKHVIEVHVNASAAKERDIAGVPKTATTDSDGVMTMFDTDGFLTIEFLKKFVTYARL----------------NCGPRLTPQASEKLVNHYVKMRNPVVNADAFKSGKKAHNSAIPITVRQLEAIVRIAESIAKMELQQFATDKHVEEALRLFRVSTIEAAATGNLAGV 684          
BLAST of DNA helicase vs. Ensembl Celegans
Match: mcm-2 (DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6])

HSP 1 Score: 329.331 bits (843), Expect = 1.309e-99
Identity = 206/614 (33.55%), Postives = 324/614 (52.77%), Query Frame = 2
Query:  332 YIQKMKEMSLLRRAWINIDCSHLA--QYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHE---PILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERG-RIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRE-NSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHN----KTTEPGT---------------VDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREAL 2095
            YIQ +K M+   R  + +  + L+    ++++   L   P E++  MD  A  +  + Y  +      I  R     +  ++R L    L+ L+   G+V   S I+P++    + C  C  +     ++    + P  C  CQ K   ++      + + Q I +QESP  + AG  P +  +    DL D+ +PGD + VTG+Y        N KQ     VF T +   H   +K+++  ++   L+ E +  IR LSQ P++ +R+  +IAP+IYG++ +K+ + + LF G   E K  GA   +R +I+VLLCGDPGT+KSQ L+Y  ++ PR   T+G+G+S VGLTAY+ + P T   TL++GA+ L+D G+C IDEFDKM+D  R+ +HE MEQQS+SI+KAGI+  LHAR +V+AA+NPIG  ++  +T  EN+ L   +LSRFD++ +I D  D   D +LA+ +VG +  H+    K  + G                +   +LR YI YA+                E  HP L E+     +  + +MRK   A  G ++   R +ES+IRL+EAHA++ L   V   DC  A R+  E+ 
Sbjct:  189 YIQMIKSMAADNRESLEVSFTDLSDDNGEQNISYFLPEAPNEMLAIMDRAATEVVMNMYPFYSRVCNEIKVRISQLPVEEDIRMLRQVHLNMLIRTAGVVTIASGILPQLAVVKYDCVACGYLLGPFVQQNDEEVRPTICPSCQGKGPFELNVENTVYHNYQRITMQESPNKVAAGRLPRSKDVILLGDLCDSCKPGDEIEVTGVYTNNFDGSLNYKQGF--PVFNTLIHANHI-TNKDKMASDQ---LTDEDIKAIRELSQDPNISQRVFSSIAPSIYGHDDVKRAIALALFRG---EAKNPGAKHRLRGDINVLLCGDPGTAKSQFLRYAAHIAPRSVLTTGQGASAVGLTAYVQRHPVTREWTLEAGAMVLADKGVCLIDEFDKMSDQDRTSIHEAMEQQSISISKAGIVTSLHARCTVIAASNPIGGRYNPTRTFAENVDLTEPILSRFDVLCVIRDSVDSVEDERLAKFVVGNHRTHHPDAKKIVKEGDELEEDQMDERTGVRLIPQDLLRKYIIYAR----------------EKCHPTLPEQHSEKFSNIFAQMRKESMA-TGSVAITVRHVESMIRLSEAHAKLHLRSYVNDEDCAAAIRVMLESF 776          
BLAST of DNA helicase vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0345797)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 385/736 (52.31%), Postives = 523/736 (71.06%), Query Frame = 2
Query:  158 TTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKN-RLIDEEEAK---LSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKI 2344
            TT+    S   PQ +++GTN+ ++     F+SF+++F     +++ +++   + + PLY+QK++E+  L   ++N++C+HL  +D+ L   LI YP+EVIP  D   + +F   Y        I  RP+N + +RN+R+LNPED+DQL++++G+VIR S +IPEM +A F C++C+  T V  +RGRI  P  C  C   H  +++HN  EF DKQ++KLQESP+DM AG+TPH V+LY + DLVD +QPGDRVTVTGIYRA   +       +K+V+KT++DV+HF+K  N RL ++EE K      ERV  ++ L++KPD+Y+RL+ AIAP+IY N+ IKKG+L+ LFGG  K+   LG  +N RS IH+LLCGDPGTSKSQ+LQYV+NL PR QYTSG+GSS VGLTAY+TKDPET    LQ+GAL L+DNG+CCIDEFDKM D+TRSVLHEVMEQQ+LSIAKAGIICQL+ARTS+LAAANP  S W+ +K II+N+QLP TLLSRFDLIFL+LDPQDE +D +LA H+V LY       E    D ++LRDYIAYA+                E++ P LS+EA+  + + YV+MRKVG AG+GQISAYPRQLESLIRL+EAHA++RLS+QV + D  EA RL REALKQ+A DPL+G ID+ ILTTG+S   RK+  +L  AI + L+++ + LT  YQ++  +++  S  MITR+ FED L  ++ E  I
Sbjct:  139 TTDPVSESSQAPQLVVWGTNVVVSQCKSKFKSFIMRFIDPSAEQDEISE-NIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFERYPAALLEHQIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEVDRGRINQPTLCTNCNTNHCFRLIHNRSEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVDVVHFRKVDNKRLYEDEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGR-QNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYYVTRHEEEDTMFDMSVLRDYIAYAR----------------EHLSPTLSDEAQQRLIQAYVDMRKVG-AGRGQISAYPRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPLSGKIDVGILTTGLSTAARKKRADLVAAIKENLKKKGKVLTVPYQKLFSDIKEGSQIMITREQFEDALKEVQDEGAI 855          
BLAST of DNA helicase vs. Ensembl Fly
Match: dpa (gene:FBgn0015929 transcript:FBtr0088982)

HSP 1 Score: 778.089 bits (2008), Expect = 0.000e+0
Identity = 385/736 (52.31%), Postives = 523/736 (71.06%), Query Frame = 2
Query:  158 TTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKN-RLIDEEEAK---LSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKI 2344
            TT+    S   PQ +++GTN+ ++     F+SF+++F     +++ +++   + + PLY+QK++E+  L   ++N++C+HL  +D+ L   LI YP+EVIP  D   + +F   Y        I  RP+N + +RN+R+LNPED+DQL++++G+VIR S +IPEM +A F C++C+  T V  +RGRI  P  C  C   H  +++HN  EF DKQ++KLQESP+DM AG+TPH V+LY + DLVD +QPGDRVTVTGIYRA   +       +K+V+KT++DV+HF+K  N RL ++EE K      ERV  ++ L++KPD+Y+RL+ AIAP+IY N+ IKKG+L+ LFGG  K+   LG  +N RS IH+LLCGDPGTSKSQ+LQYV+NL PR QYTSG+GSS VGLTAY+TKDPET    LQ+GAL L+DNG+CCIDEFDKM D+TRSVLHEVMEQQ+LSIAKAGIICQL+ARTS+LAAANP  S W+ +K II+N+QLP TLLSRFDLIFL+LDPQDE +D +LA H+V LY       E    D ++LRDYIAYA+                E++ P LS+EA+  + + YV+MRKVG AG+GQISAYPRQLESLIRL+EAHA++RLS+QV + D  EA RL REALKQ+A DPL+G ID+ ILTTG+S   RK+  +L  AI + L+++ + LT  YQ++  +++  S  MITR+ FED L  ++ E  I
Sbjct:  139 TTDPVSESSQAPQLVVWGTNVVVSQCKSKFKSFIMRFIDPSAEQDEISE-NIDVNQPLYLQKLEEIHTLEEPYLNLNCAHLKTFDQDLYRQLICYPQEVIPGFDMAINEMFFERYPAALLEHQIQVRPFNADKTRNMRSLNPEDMDQLISISGMVIRSSNVIPEMREAFFSCNICSFSTTVEVDRGRINQPTLCTNCNTNHCFRLIHNRSEFTDKQLVKLQESPDDMAAGQTPHNVLLYAHNDLVDKVQPGDRVTVTGIYRATPLKTGGLSSSVKSVYKTHVDVVHFRKVDNKRLYEDEEGKDHIFPPERVELLQLLAKKPDIYDRLARAIAPSIYENDDIKKGILLQLFGGTKKKHATLGR-QNFRSEIHLLLCGDPGTSKSQMLQYVFNLVPRSQYTSGRGSSAVGLTAYVTKDPETRQLVLQTGALVLADNGVCCIDEFDKMNDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPAESQWNKRKNIIDNVQLPHTLLSRFDLIFLVLDPQDEIFDKRLASHLVSLYYVTRHEEEDTMFDMSVLRDYIAYAR----------------EHLSPTLSDEAQQRLIQAYVDMRKVG-AGRGQISAYPRQLESLIRLSEAHAKVRLSNQVELLDVEEAWRLHREALKQSATDPLSGKIDVGILTTGLSTAARKKRADLVAAIKENLKKKGKVLTVPYQKLFSDIKEGSQIMITREQFEDALKEVQDEGAI 855          
BLAST of DNA helicase vs. Ensembl Fly
Match: Mcm5 (gene:FBgn0017577 transcript:FBtr0082279)

HSP 1 Score: 323.553 bits (828), Expect = 8.317e-99
Identity = 247/757 (32.63%), Postives = 370/757 (48.88%), Query Frame = 2
Query:  146 DDYGTTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIP----AMDCVADSLFK---SNYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVT---KV-PCERGRIIDPEFCNQCQAKHTQ------QIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYR----AASQRENSKQRVIKAVFKTYLDVL----------HFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKT--TEP--GTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQ----------ISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTL--TFSYQRVLDELRNQ 2275
            DD G         D  Q+      IN+  + + ++ F+  F     +ENF            Y   +K   L  R ++ I+   L  +D +L + L   P E +     A   VAD +      +    H+  +    N   + N+R L  + + +LV + G+++  S I  +  +   +C  C+ V    KV P   G  + P  CN  QA   +       I+ + C+ +D Q +KLQE P+ +P GE P  + L+C + L + + PG+RV + GIY         R + +++ +  V   Y+ V+             +  N   DEEE           R ++   D+YERLS ++AP+I+G+  IKK +  MLFGG     K+L  G   R +I+VLL GDPGT+KSQLL++V  + P   YTSGKGSS  GLTA + KDP+T +  ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN I   WD+ K   ENI   PT+LSRFD+IF++ D  DE  D  LA+HI+ ++   NK+  +EP  G +  +  + YI Y +                 +  P LSE A   +   YV MR    +G GQ          I    RQLE++IR++E+ A++RL    T     EA RL + +   AA   +TG +       G  G   + ++E    I K L+ R  +    S Q +L +   Q
Sbjct:    5 DDAGVFFSDNFGGDNQQD----AQINLQAVKKKYKEFIRTFN----EENFFYK---------YRDTLKRNYLNGRYFLEIEMEDLVGFDETLADKLNKQPTEHLEIFEEAAREVADEITAPRPEHEEHMHDIQILLSSNANPT-NIRQLKSDCVSKLVKIAGIIVAASGISAKATRMSIQCLSCSTVIPNLKVNPGLEGYAL-PRKCNTEQAGRPKCPLDPFFIMPDKCKCVDFQTLKLQELPDFVPQGEIPRHLQLFCDRSLCERVVPGNRVLIQGIYSIRKVGKPSRRDGREKAVVGVRAPYMRVVGITVDSEGAGAISRYSNITSDEEE---------HFRRMAASGDIYERLSQSLAPSIFGSRDIKKAITCMLFGG---SRKRLPDGLCRRGDINVLLLGDPGTAKSQLLKFVEKVAPIAVYTSGKGSSAAGLTASVMKDPQTRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSIFGRWDDTKG-EENIDFMPTILSRFDMIFIVKDIHDESRDITLAKHIINVHLSSNKSAPSEPAEGEISLSTFKKYIHYCRT----------------HCGPRLSEAAGEKLKSRYVLMR----SGAGQQEKASDKRLSIPITVRQLEAVIRISESLAKIRLQPFATDEHVNEALRLFQVSTLDAA---MTGSL------AGAEGFTTEEDQETLNRIEKQLKRRFAIGSQVSEQNILQDFLRQ 700          
BLAST of DNA helicase vs. Ensembl Fly
Match: Mcm2 (gene:FBgn0014861 transcript:FBtr0081827)

HSP 1 Score: 322.398 bits (825), Expect = 7.653e-97
Identity = 217/643 (33.75%), Postives = 329/643 (51.17%), Query Frame = 2
Query:  227 TNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHE---PILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRI-IDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRE-NSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKT---------TEPGTVDTA---MLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQA 2104
            T I   F+SFL  F  E     +   IR          +M E ++   +   +  + LA  +  L   L   P +++   D VA  +  S +  +      I  R     +   LR      L+QLV   G+V   + ++P++    + C  C  V     +     I P  C +CQ+     I      + + Q I LQESP  +PAG  P +  +    DL D  +PGD + VTGIY        N+ Q     VF T +   H     ++ + +    L+ E +  I+ LS+ P + ER+  ++AP+IYG++ IK+ L + LFGG   E+K  G    +R +I++L+CGDPGT+KSQ L+Y   + PR  +T+G+G+S VGLTAY+ ++P +   TL++GAL L+D G+C IDEFDKM D  R+ +HE MEQQS+SI+KAGI+  L AR +V+AAANPIG  +D   T  EN+ L   +LSRFD++ ++ D  D   D +LA+ +V  +  H+ +          +  TVD     +LR YI YAK                ENI P L+   E+ + + Y ++R+   A  G +    R +ES+IR++EAHARM L + V  AD   A R+  E+  +A
Sbjct:  178 TEIANRFQSFLRTFVDERGAYTYRDRIR----------RMCEQNM---SSFVVSYTDLANKEHVLAYFLPEAPFQMLEIFDKVAKDMVLSIFPTYERVTTEIHVRISELPLIEELRTFRKLHLNQLVRTLGVVTATTGVLPQLSVIKYDCVKCGYVLGPFVQSQNTEIKPGSCPECQSTGPFSINMEQTLYRNYQKITLQESPGRIPAGRIPRSKDVILLADLCDQCKPGDELEVTGIYTNNYDGSLNTDQGF--PVFATVIIANHVVVKDSKQVVQ---SLTDEDIATIQKLSKDPRIVERVVASMAPSIYGHDYIKRALALALFGG---ESKNPGEKHKVRGDINLLICGDPGTAKSQFLKYTEKVAPRAVFTTGQGASAVGLTAYVRRNPVSREWTLEAGALVLADQGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSMTFSENVNLSEPILSRFDVLCVVKDEFDPMQDQQLAKFVVHSHMKHHPSEEEQPELEEPQLKTVDEIPQDLLRQYIVYAK----------------ENIRPKLTNIDEDKIAKMYAQLRQESFA-TGSLPITVRHIESVIRMSEAHARMHLRENVMEADVSMAIRMMLESFIEA 782          
BLAST of DNA helicase vs. Ensembl Fly
Match: Mcm7 (gene:FBgn0020633 transcript:FBtr0076585)

HSP 1 Score: 309.686 bits (792), Expect = 1.208e-93
Identity = 195/527 (37.00%), Postives = 294/527 (55.79%), Query Frame = 2
Query:  530 RPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFC--NQCQAKHTQQIVH---NCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQ-KSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGT----VDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRL 2080
            +P + E + ++R +  + + +LVTV G+V R +E+ P M+ A + C  C + T  P           C  + C+       ++      +F+  Q +K+QE  + +P G  P ++ + C  ++    QPGD + V+G++     R    Q +   + +T+L        +KN  I +++A+L+ E +        + D YERL+ ++AP IYG+  +KK LL++L GG  K       G  +R NI++ L GDPG +KSQLL Y+  L  R QYT+G+GSS VGLTA + KDP TG  TL+ GAL L+D G+CCIDEFDKM D  R+ +HEVMEQQ++SIAKAGI+  L+AR S+LAAANP    ++ ++T+ +NIQLP  LLSRFDL++LI D  D   D +LA+HI  +   H+ + +P T    +D  ++R YI   K                   +P + +E  +Y+   YVE+R+     K       R L  ++RL+ A AR+RLSD V   D  EA RL
Sbjct:  139 KPLSTEKAHSIREVKAQHIGKLVTVRGIVTRCTEVKPMMVVATYTCDRCGSETYQPVNSLSFTPVHDCPSDDCRVNKAGGRLYLQTRGSKFVKFQEVKMQEHSDQVPVGHIPRSMTIMCRGEVTRMAQPGDHIVVSGVF-LPLMRTGFAQMIQGLLSETFLQAHRIICINKNDEISDKDAELTPEEL----EELAQDDFYERLATSLAPEIYGHLDVKKALLLLLVGGVDKRPD----GMKIRGNINICLMGDPGVAKSQLLGYISRLAVRSQYTTGRGSSGVGLTAAVMKDPLTGEMTLEGGALVLADQGVCCIDEFDKMADQDRTAIHEVMEQQTISIAKAGIMTTLNARVSILAAANPAFGRYNPRRTVEQNIQLPAALLSRFDLLWLIQDKPDRDNDLRLAKHITYV---HSHSKQPPTRVKALDMNLMRRYINLCK-----------------RKNPTIPDELTDYIVGAYVELRREARNQKDMTFTSARNLLGILRLSTALARLRLSDSVEKDDVAEALRL 636          
BLAST of DNA helicase vs. Ensembl Zebrafish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 819.691 bits (2116), Expect = 0.000e+0
Identity = 401/731 (54.86%), Postives = 525/731 (71.82%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E F+ FL QF    PD     +   + ++PLY+QK+ E+S++    +N++C+H+  +D  L   LI YP+EVIP  D   + LF   + D      I  RPY+   +RN+RNLNPED+DQL+T++G+VIR S++IPEM +A F+C VC   T+V  +RGRI +P  C  C   H+  +VHN   F DKQMIKLQESPEDMPAG+TPHT V+Y + DLVD +QPGDRV +TGIYRAA  R N +Q  +K+V+KT++D +HF+K+  + +     D E+   ++ERV  ++ L+ KPD+YERLS A+AP+IY +E IKKG+L+ LFGG  K+  + G G N R+ +++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM+D TRSVLHEVMEQQ+LSIAKAGIICQL+ARTS+LAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIA+A+                  +HP LSEEA   + E YV+MRK+G +G+G +SAYPRQLESLIRLAEAHA++R S +V   D  EA+RL REALKQ+A DP TG +DI+ILTTG+S   RKR EE+A+A+ KL++ + +T    YQ++ D+LR QS+  IT+DMF++ L LL  E+ +  T KT+R
Sbjct:  133 VIWGTDVNVGTCKEKFQRFLQQFTD--PDSREEENAGLDLNEPLYMQKLDEISVVGEPVLNVNCTHIQTFDADLYRQLICYPQEVIPTFDMSVNELFFDRFPDSVLEHQIQVRPYSAIKTRNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRCQVCAFNTRVEVDRGRIAEPAVCRNCNTTHSMALVHNRSVFSDKQMIKLQESPEDMPAGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAPMRLNPRQSQVKSVYKTHIDAIHFRKTDEKRLHGLDEDGEQKLFTKERVALLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFTQTGRG-NFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQIEEEHLDMAVLKDYIAFART----------------TVHPRLSEEASQALIEAYVDMRKIG-SGRGMVSAYPRQLESLIRLAEAHAKVRFSGKVETIDVEEAKRLHREALKQSATDPRTGFVDISILTTGMSATARKRKEEVAQALKKLIQSKGKTPAMKYQQLFDDLRGQSEAAITKDMFDEALRLLADEDYLTVTGKTVR 843          
BLAST of DNA helicase vs. Ensembl Zebrafish
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 335.88 bits (860), Expect = 3.119e-103
Identity = 230/697 (33.00%), Postives = 355/697 (50.93%), Query Frame = 2
Query:  218 INITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIP----AMDCVADSLFKSNYV--DFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVC----NNVTKVPCERGRIIDPEFCNQCQAKHTQ------QIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYR----AASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTE--PGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQ------ISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER 2224
            +  + I + FR FL QF+       F            Y  ++K    L   WI ++   LA +D  L + L   P E +P    A   VAD + +   V  +  + I     +     ++R+L  E + +LV + G++I  + +  +  +   +C  C    +N+   P  +G  + P  CN  QA   +       I+ + C  +D Q  +LQE+P+ +P GE P  + LYC + L D + PG+RVTV GIY     A ++ +   +     +   YL V+                +S +   E+R+L+  P +Y+ L+ ++AP+IYG++ +KK +  +LFGG     K+L  G   R +I++L+ GDPGT+KSQLL++V   +P G YTSGKGSS  GLTA + +DP T    ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD+ K   +NI   PT+LSRFD+IF+I D  D+Q D  LARH++ ++      TE   G +  A L+ YIAY++V                   P LS  A   +   YV MR      + +      I    RQLE+++R+AE+ A+M+L       +  EA RL + +   AA   L+G +      +GV G   + ++E+   I K L+ R
Sbjct:   27 VKRSQIKKKFREFLRQFRVGTDRTGFTYK---------YRDELKRHYTLGEYWIEVEMEDLASFDEDLSDCLYKLPAENLPLLEEAAQEVADEVTRPRPVGEETVQDIQVMLKSDAHPASIRSLKSEQVSRLVKIPGIIISSTAVRAKATRVCLQCRGCRAVISNIPLPPGLQGYAL-PRKCNTEQAGRVKCPVDPYFIIPDRCVCVDFQTQRLQEAPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRVTVMGIYSIKKVAQTKAKGRDKGTGVGIRSAYLRVVGIDVDTEGAGRGATGSVSPQEEEELRSLAASPSVYDSLARSLAPSIYGSDDLKKAIACLLFGG---SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPTTRGFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDDTKG-EDNIDFMPTILSRFDMIFIIKDHHDQQRDMTLARHVMNVHLSAQTQTEGVEGEIPLATLKKYIAYSRV----------------KCGPRLSAAAAEKLKNRYVLMRSGAKEHERETDRRVSIPITVRQLEAVVRIAESLAKMKLQPIAGEEEVDEALRLFQVSTLDAA---LSGSL------SGVEGFTTQEDQEMISRIEKQLKRR 684          
BLAST of DNA helicase vs. Ensembl Zebrafish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:ZFIN;Acc:ZDB-GENE-020419-24])

HSP 1 Score: 325.479 bits (833), Expect = 7.510e-98
Identity = 210/611 (34.37%), Postives = 319/611 (52.21%), Query Frame = 2
Query:  329 LYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDF----HEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCE-RGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTE------------PGTVDTA-----MLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREAL 2095
            ++ +++ +M    +  + ++   LA  +  L   L   P E++   D  A  +  + Y  +    HE I  R  N  +   LR+L    L+QL+  +G+V   + ++P++    + C+ CN +     + + + + P  C +CQ+    +I      + + Q I +QESP  + AG  P +       DLVD  +PGD + +TGIY        +       VF T +   H  +    +     A+L+ E V  I ALS+   + ER+  +I P+IY +E IK+GL + LFGG   E K  G    +R +I+VLLCGDPGT+KSQ L+YV  +  R  +T+G+G+S VGLTAY+ + P +   TL++GAL L+D G+C IDEFDKM D  R+ +HE MEQQS+SI+KAGI+  L AR +V+AAANPIG  +D   T  EN+ L   ++SRFD++ ++ D  D   D  LAR +VG +  H+ + +            P T D       +LR YI YAK                E + P L++  ++ V   Y ++RK   A  G I    R +ES+IR+AEAHARM L D V   D   A R+  E+ 
Sbjct:  202 VFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHE-IHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCNFILGPFFQSQNQEVKPGSCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDMCKPGDEIELTGIYHNNYDGSLNMANGF-PVFATVILANHIARKDEGVA---VAELTDEDVKAIVALSKDERIGERIFASIGPSIYAHEDIKRGLALALFGG---EAKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNTFDVPPIPQELLRKYIIYAK----------------ERVRPKLNQMDQDKVARIYSDLRKESMA-TGSIPITVRHIESMIRMAEAHARMHLRDYVLEDDVNMAIRVMLESF 787          
BLAST of DNA helicase vs. Ensembl Zebrafish
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:ZFIN;Acc:ZDB-GENE-120927-1])

HSP 1 Score: 309.686 bits (792), Expect = 2.784e-92
Identity = 201/628 (32.01%), Postives = 317/628 (50.48%), Query Frame = 2
Query:  521 ILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEF---IDKQMIKLQE--SPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYL---DVLHFQKSKNRLIDEEEAK-----LSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGG---RVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNK----------------------TTEPGTVDT--------------AMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTLTFSYQ 2248
            I  R YN E    L++L      + V + G V+R+S I P  +K  F C+ C +   V    G+   P  C Q + +      +    F   +D Q IK+QE  S +   +G  P T+     QDLVD+  PGD VT+TG+ + +++  +++ +  K +F  Y+    V + +  K++ + E E +      S + +  I+ +  + DL++ +  ++ P IYG+  +K GL + LFGG    V +  ++     +R + H+L+ GDPG  KSQ+LQ V N+ PRG Y  G  ++  GLT  +++D  +G   L++GAL L D GICCIDEFDKM    +++L E MEQQS+S+AKAGI+C L ARTS++AAANP+G  ++  KT+ EN+++   LLSRFDL+F++LD  +E +D  L+ H++ +  G +                       ++E    DT               +LR Y+ YA+                  +HP LS EA   + + Y+E+RK  N          RQLESLIRL EA AR+ L ++ T +D  +   + + +L     D   G +D +    G     R + ++   A+ KL E      F  Q
Sbjct:  206 ISARLYNYEPLTPLKSLRANLYGKFVVIRGTVVRVSNIKPLCMKLAFVCNSCGDTQSVTLPDGKYTMPTKCLQSECRGRSFTPNRSSPFTLTVDWQTIKVQELMSGDQRESGRIPRTIECELTQDLVDSCVPGDMVTITGVIKVSNEEGSTRNKKDKCMFLLYIQANSVSNSKGQKSKAVSESEGQGPSVEFSIKDLYAIQEIQAQEDLFKLIVNSLCPVIYGHLLVKAGLALALFGGCQKYVDDKNRI----PIRGDPHMLIVGDPGLGKSQMLQAVCNVAPRGVYVCGNTTTTSGLTVSLSRDSGSGDYALEAGALVLGDQGICCIDEFDKMGSQHQALL-EAMEQQSISLAKAGIVCTLPARTSIIAAANPVGGHYNKGKTVSENLKMGSALLSRFDLVFILLDTPNEDHDHLLSEHVMAMRAGKSGAVSGAAATRFNTHESSISILEVSSEKPLADTLKLVPGEAFDPIPHQLLRKYVGYAR----------------HYVHPTLSAEAAQVLQDFYLELRK-QNQTADSTPITTRQLESLIRLTEARARVELREKATQSDAEDVVEIMKHSLTDTYSDEF-GRLDFDRSQLGSGMSNRSKVKKFVSALNKLAERTSKSMFELQ 810          
BLAST of DNA helicase vs. Ensembl Zebrafish
Match: mcm6l (MCM6 minichromosome maintenance deficient 6, like [Source:ZFIN;Acc:ZDB-GENE-050913-141])

HSP 1 Score: 300.442 bits (768), Expect = 3.707e-89
Identity = 208/672 (30.95%), Postives = 329/672 (48.96%), Query Frame = 2
Query:  233 IMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLF----------KSNYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQ--CQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTG----------IYRAASQRENSKQRVIKAVFKT----YLDVLHFQKSKNRL----------------------------IDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAG--KGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRL 2080
            + E  +   L+F  E  D+N          D LY+   +E+    R  + +  S++  Y++ L   +      V P + C A   F          K  YV F E   +R       + +R L+   +  L+ ++G V+R   + PE++   F C  C +V K   ++ +   P  C    C  +    +  N   F+D Q +++QE+  ++P G  P +V +    + V+T Q GDR   TG          +  A ++ E S +   K  F+      L  L  ++   RL                            +  +   L  E+V E   +SQ  +LY  L  ++ PTI+GN+ IK+G+L+MLFGG  K T +   G ++R +I+V + GDP TSKSQ L++V +  PR  YTSGK SS  GLTA + KD E+    +++GAL L+DNG+CCIDEFDKM    +  +HE MEQQ++SI KAG+   L+ARTS+LAAANPI   ++  K++ +N+ +   ++SRFDL F+++D  +E  D  +AR IV L+  + ++ E     T  ++ YI +A+                    P ++ EA+ +V ++Y  +R+    G  K       RQLES++RL+E  AR+  SD+V      EA RL
Sbjct:   16 LSEKCQKLFLEFLEEFQDKN---------GDALYLSDAQELIRPERNTLTVSFSNIEHYNQQLATTIQEEYYRVYPFL-CRAVRHFARDHGNIPPSKEFYVAFSE-FPSR-------QKIRELSTVRIGTLLRISGQVVRTHPVHPELVSGTFLCLDCQSVIKDVEQQFKYTQPTICKNPVCANRRRFMLDTNKSRFVDFQKVRIQETQAELPRGSIPRSVEVILRAEAVETAQAGDRCDFTGTLIVVPDVSAMALAGTRAETSSRVTGKEGFEADGIQGLKALGVRELSYRLAFLANYVAPTNPRFGGKELRQEDQTAESVKNQMTVLEWEKVFE---MSQDKNLYHNLCTSLFPTIHGNDEIKRGILLMLFGGVAKTTME---GTSLRGDINVCIVGDPSTSKSQFLKHVEDFAPRAVYTSGKASSAAGLTAAVVKDEESHEFVIEAGALMLADNGVCCIDEFDKMDLKDQVAIHEAMEQQTISITKAGVKATLNARTSILAAANPIDGRYNRAKSLKQNVNMSAPIMSRFDLFFILVDECNEVTDYAIARRIVDLHARNVESVE-RVYSTDEIQRYILFAR-----------------QFQPKITVEAQEFVVDQYKRLRQRDGGGTTKSAWRITVRQLESMLRLSEGMARLYCSDEVQPKHVKEAFRL 645          
BLAST of DNA helicase vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:448137])

HSP 1 Score: 807.364 bits (2084), Expect = 0.000e+0
Identity = 391/731 (53.49%), Postives = 527/731 (72.09%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E F+ F+ +F   +  E    ++  + ++P+Y+Q+++E++++   ++N+DC HL  +D+ L   L+ YP+EVIP  D  A+ +F   Y D      I  RPYN   +RN+R+LNPED+DQL+T++G+VIR S+IIPEM +A FKC VC   T+V  +RGRI +P  C  C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHT +LY + DLVD +QPGDRV VTGIYRA   R N + R +K+V+KT++DV+H++K+  + +     D E+   ++ERV  ++ L+ KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ +++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  +   +D A+L+DYIAYA+                  ++P L EEA   + E YV+MRK+G +G+G +SAYPRQLESLIRL+EAHA++R S +V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA+ + KL++ + +T    YQ++ ++LR QSD  +T+DMF++ L+ L  E+ +  T KT+R
Sbjct:  133 VIWGTDVNVATCKEKFQRFVQRFIDPLAKEE--ENVGLDLNEPIYMQRLEEINVVGEPFLNVDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAFTTRVEIDRGRISEPSVCKHCNTTHSMALIHNRSMFSDKQMIKLQESPEDMPAGQTPHTTILYGHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVRNVKSVYKTHIDVIHYRKTDAKRLHGIDEDTEQKMFTEERVAMLKELAAKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDETYDRRLAHHLVALYYQSEEQMKEEHLDMAVLKDYIAYART----------------YVNPRLGEEASQALIEAYVDMRKIG-SGRGMVSAYPRQLESLIRLSEAHAKVRFSSKVETIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATARKRKEELAQVLKKLIQSKGKTPALKYQQLFEDLRGQSDAAVTKDMFDEALHALADEDYLTVTGKTVR 843          
BLAST of DNA helicase vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:448137])

HSP 1 Score: 803.127 bits (2073), Expect = 0.000e+0
Identity = 391/731 (53.49%), Postives = 527/731 (72.09%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E F+ F+ +F   +  E    ++  + ++P+Y+Q+++E++++   ++N+DC HL  +D+ L   L+ YP+EVIP  D  A+ +F   Y D      I  RPYN   +RN+R+LNPED+DQL+T++G+VIR S+IIPEM +A FKC VC   T+V  +RGRI +P  C  C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHT +LY + DLVD +QPGDRV VTGIYRA   R N + R +K+V+KT++DV+H++K+  + +     D E+   ++ERV  ++ L+ KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ +++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  +   +D A+L+DYIAYA+                  ++P L EEA   + E YV+MRK+G +G+G +SAYPRQLESLIRL+EAHA++R S +V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA+ + KL++ + +T    YQ++ ++LR QSD  +T+DMF++ L+ L  E+ +  T KT+R
Sbjct:  198 VIWGTDVNVATCKEKFQRFVQRFIDPLAKEE--ENVGLDLNEPIYMQRLEEINVVGEPFLNVDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAFTTRVEIDRGRISEPSVCKHCNTTHSMALIHNRSMFSDKQMIKLQESPEDMPAGQTPHTTILYGHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVRNVKSVYKTHIDVIHYRKTDAKRLHGIDEDTEQKMFTEERVAMLKELAAKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDETYDRRLAHHLVALYYQSEEQMKEEHLDMAVLKDYIAYART----------------YVNPRLGEEASQALIEAYVDMRKIG-SGRGMVSAYPRQLESLIRLSEAHAKVRFSSKVETIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATARKRKEELAQVLKKLIQSKGKTPALKYQQLFEDLRGQSDAAVTKDMFDEALHALADEDYLTVTGKTVR 908          
BLAST of DNA helicase vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:448137])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 391/737 (53.05%), Postives = 527/737 (71.51%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTG------IYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E F+ F+ +F   +  E    ++  + ++P+Y+Q+++E++++   ++N+DC HL  +D+ L   L+ YP+EVIP  D  A+ +F   Y D      I  RPYN   +RN+R+LNPED+DQL+T++G+VIR S+IIPEM +A FKC VC   T+V  +RGRI +P  C  C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHT +LY + DLVD +QPGDRV VTG      IYRA   R N + R +K+V+KT++DV+H++K+  + +     D E+   ++ERV  ++ L+ KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ +++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  +   +D A+L+DYIAYA+                  ++P L EEA   + E YV+MRK+G +G+G +SAYPRQLESLIRL+EAHA++R S +V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA+ + KL++ + +T    YQ++ ++LR QSD  +T+DMF++ L+ L  E+ +  T KT+R
Sbjct:  149 VIWGTDVNVATCKEKFQRFVQRFIDPLAKEE--ENVGLDLNEPIYMQRLEEINVVGEPFLNVDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAFTTRVEIDRGRISEPSVCKHCNTTHSMALIHNRSMFSDKQMIKLQESPEDMPAGQTPHTTILYGHNDLVDKVQPGDRVNVTGVALNSGIYRAVPIRVNPRVRNVKSVYKTHIDVIHYRKTDAKRLHGIDEDTEQKMFTEERVAMLKELAAKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDETYDRRLAHHLVALYYQSEEQMKEEHLDMAVLKDYIAYART----------------YVNPRLGEEASQALIEAYVDMRKIG-SGRGMVSAYPRQLESLIRLSEAHAKVRFSSKVETIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATARKRKEELAQVLKKLIQSKGKTPALKYQQLFEDLRGQSDAAVTKDMFDEALHALADEDYLTVTGKTVR 865          
BLAST of DNA helicase vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:448137])

HSP 1 Score: 713.375 bits (1840), Expect = 0.000e+0
Identity = 346/637 (54.32%), Postives = 459/637 (72.06%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQRE 2089
            +I+GT++N+    E F+ F+ +F   +  E    ++  + ++P+Y+Q+++E++++   ++N+DC HL  +D+ L   L+ YP+EVIP  D  A+ +F   Y D      I  RPYN   +RN+R+LNPED+DQL+T++G+VIR S+IIPEM +A FKC VC   T+V  +RGRI +P  C  C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHT +LY + DLVD +QPGDRV VTGIYRA   R N + R +K+V+KT++DV+H++K+  + +     D E+   ++ERV  ++ L+ KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ +++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  +   +D A+L+DYIAYA+                  ++P L EEA   + E YV+MRK+G +G+G +SAYPRQLESLIRL+EAHA++R S +V   D  EA+RL RE
Sbjct:  155 VIWGTDVNVATCKEKFQRFVQRFIDPLAKEE--ENVGLDLNEPIYMQRLEEINVVGEPFLNVDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAFTTRVEIDRGRISEPSVCKHCNTTHSMALIHNRSMFSDKQMIKLQESPEDMPAGQTPHTTILYGHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVRNVKSVYKTHIDVIHYRKTDAKRLHGIDEDTEQKMFTEERVAMLKELAAKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDETYDRRLAHHLVALYYQSEEQMKEEHLDMAVLKDYIAYART----------------YVNPRLGEEASQALIEAYVDMRKIG-SGRGMVSAYPRQLESLIRLSEAHAKVRFSSKVETIDVEEAKRLHRE 771          
BLAST of DNA helicase vs. Ensembl Xenopus
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:448137])

HSP 1 Score: 644.81 bits (1662), Expect = 0.000e+0
Identity = 305/548 (55.66%), Postives = 405/548 (73.91%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAK 1822
            +I+GT++N+    E F+ F+ +F   +  E    ++  + ++P+Y+Q+++E++++   ++N+DC HL  +D+ L   L+ YP+EVIP  D  A+ +F   Y D      I  RPYN   +RN+R+LNPED+DQL+T++G+VIR S+IIPEM +A FKC VC   T+V  +RGRI +P  C  C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHT +LY + DLVD +QPGDRV VTGIYRA   R N + R +K+V+KT++DV+H++K+  + +     D E+   ++ERV  ++ L+ KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ +++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  +   +D A+L+DYIAYA+
Sbjct:  149 VIWGTDVNVATCKEKFQRFVQRFIDPLAKEE--ENVGLDLNEPIYMQRLEEINVVGEPFLNVDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAFTTRVEIDRGRISEPSVCKHCNTTHSMALIHNRSMFSDKQMIKLQESPEDMPAGQTPHTTILYGHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVRNVKSVYKTHIDVIHYRKTDAKRLHGIDEDTEQKMFTEERVAMLKELAAKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDETYDRRLAHHLVALYYQSEEQMKEEHLDMAVLKDYIAYAR 693          
BLAST of DNA helicase vs. Ensembl Mouse
Match: Mcm4 (minichromosome maintenance complex component 4 [Source:MGI Symbol;Acc:MGI:103199])

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 399/733 (54.43%), Postives = 524/733 (71.49%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIP--DENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNR----LIDEEEAKL-SQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKL-LEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E+F+ FL  F   +   +EN   DI      PLY+Q++ E+++    ++N++C H+  + ++L   LI YP+EVIP  D   + +F   Y D      I  RP+N   ++++RNLNPED+DQL+T++G+VIR S++IPEM +A F+C VC + T+V  +RGRI +P  C  C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHT+VL+ + DLVD +QPGDRV VTGIYRA   R N +   +K+V+KT++DV+H++K+  +    L +E E KL S++RV  ++ LS+KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ I++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANPI S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIAYA                   I P LSEEA   + E YV MRK+G++ +G +SAYPRQLESLIRLAEAHA++R S++V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA A+ KL L + +T    YQ++ +++R QSD  IT+DMFE+ L  L  ++ +  T KT+R
Sbjct:  150 VIWGTDVNVATCKENFQRFLQCFTDPLAKEEENVGIDI----TQPLYMQQLGEINITGEPFLNVNCEHIKSFSKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKSMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEIDRGRIAEPCSCVHCHTTHSMALIHNRSFFSDKQMIKLQESPEDMPAGQTPHTIVLFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVKLLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQVEEEFLDMAVLKDYIAYAH----------------STIMPRLSEEASQALIEAYVNMRKIGSS-RGMVSAYPRQLESLIRLAEAHAKVRFSNKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALRKLILSKGKTPALKYQQLFEDIRGQSDTAITKDMFEEALRALADDDFLTVTGKTVR 860          
BLAST of DNA helicase vs. Ensembl Mouse
Match: Mcm2 (minichromosome maintenance complex component 2 [Source:MGI Symbol;Acc:MGI:105380])

HSP 1 Score: 334.724 bits (857), Expect = 3.302e-101
Identity = 215/617 (34.85%), Postives = 327/617 (53.00%), Query Frame = 2
Query:  329 LYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHE---PILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCE-RGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKA----VFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKT-------TEPGTVDTAM-------------LRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREAL 2095
            ++ +++ +M    R  + ++   LA  +  L   L   P E++   D  A  +  + Y  +      I  R  +  +   LR+L    L+QL+  +G+V   + ++P++    + CS CN V    C+ + + + P  C +CQ+    +I      + + Q I++QESP  + AG  P +       DLVD+ +PGD + +TGIY       N    +  A    VF T +   H  K  N++   E   L+ E V  I  LS+   + E++  +IAP+IYG+E IK+GL + LFGG   E K  G    +R +I+VLLCGDPGT+KSQ L+Y+  ++ R  +T+G+G+S VGLTAY+ + P +   TL++GAL L+D G+C IDEFDKM D  R+ +HE MEQQS+SI+KAGI+  L AR +V+AAANPIG  +D   T  EN+ L   ++SRFD++ ++ D  D   D  LAR +VG +  H+ +       T  GT++ AM             L+ YI YAK                E + P L++  ++ V   Y ++RK   A  G I    R +ES+IR+AEAHARM L D V   D   A R+  E+ 
Sbjct:  214 VFKERISDMCKENRESLVVNYEDLAAREHVLAYFLPEAPAELLQIFDEAALEVVLAMYPKYDRITNHIHVRISHLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLSMVKYNCSKCNFVLGPFCQSQNQEVKPGSCPECQSAGPFEINMEETIYQNYQRIRIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYH-----NNYDGSLNTANGFPVFATIILANHVAKKDNKVAVGE---LTDEDVKMITGLSKDQQIGEKIFASIAPSIYGHEDIKRGLALALFGG---EPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYIEKVSSRAIFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVIAAANPIGGRYDPSLTFSENVDLTEPIISRFDVLCVVRDTVDPVQDEMLARFVVGSHVRHHPSNKKDEGLTNGGTLEPAMPNTYGVEPLPQEVLKKYIIYAK----------------ERVRPKLNQMDQDKVARMYSDLRKESMA-TGSIPITVRHIESMIRMAEAHARMHLRDYVMEDDVNMAIRVMMESF 802          
BLAST of DNA helicase vs. Ensembl Mouse
Match: Mcm5 (minichromosome maintenance complex component 5 [Source:MGI Symbol;Acc:MGI:103197])

HSP 1 Score: 329.717 bits (844), Expect = 6.126e-101
Identity = 224/700 (32.00%), Postives = 350/700 (50.00%), Query Frame = 2
Query:  227 TNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEISRNL-------------RNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNN----VTKVPCERGRIIDPEFCNQCQAKHTQ------QIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIY---RAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEP--GTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAG------KGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER 2224
            + +   F+ FL Q++       F            Y  ++K    L   WI ++   LA +D  L ++L   P E +  ++  A  +         E    RP   E+ +++             R L  + +  LV + G++I  S +  +  +   +C  C+N    +   P   G  + P  CN  QA   +       I+ + C+ +D Q +KLQE P+ +P GE P  + LYC + L D + PG+RVT+ GIY   +        + RV   +  +Y+ VL  Q   +         +S +   E R L+  P++YE +S +I+P+I+G   +KK +  +LFGG     K+L  G   R +I++L+ GDPGT+KSQLL++V   +P G YTSGKGSS  GLTA + +DP + +  ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD  K   +NI   PT+LSRFD+IF++ D  +E+ D  LA+H++ L+      T+   G +D A ++ +IAY +                    P LS EA   +   Y+ MR            +  I    RQLE+++R+AEA ++M+L    T AD  EA RL + +   AA   L+G +      +GV G   + ++E+   I K L+ R
Sbjct:   29 SQLQRRFKEFLRQYRVGTDRTGFTFK---------YRDELKRHYNLGEYWIEVEMEDLASFDEELADHLHKQPAEHLQLLEEAAKEVAD-------EVTRPRPAGDELLQDIQVMLKSDASPSSIRILKSDMMSHLVKIPGIIISASAVRAKATRISIQCRSCHNTLTNIAMRPGLEGYAL-PRKCNMDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLNPSKGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGSVSPQEEEEFRRLAALPNIYELISKSISPSIFGGMDMKKAIACLLFGG---SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKG-EDNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVMTLHVSALTQTQAVEGEIDLAKMKKFIAYCRA----------------RCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAA---LSGNL------SGVEGFTTQEDQEMLSRIEKQLKRR 682          
BLAST of DNA helicase vs. Ensembl Mouse
Match: Mcm5 (minichromosome maintenance complex component 5 [Source:MGI Symbol;Acc:MGI:103197])

HSP 1 Score: 329.717 bits (844), Expect = 6.126e-101
Identity = 224/700 (32.00%), Postives = 350/700 (50.00%), Query Frame = 2
Query:  227 TNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEISRNL-------------RNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNN----VTKVPCERGRIIDPEFCNQCQAKHTQ------QIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIY---RAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEP--GTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAG------KGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER 2224
            + +   F+ FL Q++       F            Y  ++K    L   WI ++   LA +D  L ++L   P E +  ++  A  +         E    RP   E+ +++             R L  + +  LV + G++I  S +  +  +   +C  C+N    +   P   G  + P  CN  QA   +       I+ + C+ +D Q +KLQE P+ +P GE P  + LYC + L D + PG+RVT+ GIY   +        + RV   +  +Y+ VL  Q   +         +S +   E R L+  P++YE +S +I+P+I+G   +KK +  +LFGG     K+L  G   R +I++L+ GDPGT+KSQLL++V   +P G YTSGKGSS  GLTA + +DP + +  ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD  K   +NI   PT+LSRFD+IF++ D  +E+ D  LA+H++ L+      T+   G +D A ++ +IAY +                    P LS EA   +   Y+ MR            +  I    RQLE+++R+AEA ++M+L    T AD  EA RL + +   AA   L+G +      +GV G   + ++E+   I K L+ R
Sbjct:   29 SQLQRRFKEFLRQYRVGTDRTGFTFK---------YRDELKRHYNLGEYWIEVEMEDLASFDEELADHLHKQPAEHLQLLEEAAKEVAD-------EVTRPRPAGDELLQDIQVMLKSDASPSSIRILKSDMMSHLVKIPGIIISASAVRAKATRISIQCRSCHNTLTNIAMRPGLEGYAL-PRKCNMDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLNPSKGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGSVSPQEEEEFRRLAALPNIYELISKSISPSIFGGMDMKKAIACLLFGG---SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKG-EDNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVMTLHVSALTQTQAVEGEIDLAKMKKFIAYCRA----------------RCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAA---LSGNL------SGVEGFTTQEDQEMLSRIEKQLKRR 682          
BLAST of DNA helicase vs. Ensembl Mouse
Match: Mcm5 (minichromosome maintenance complex component 5 [Source:MGI Symbol;Acc:MGI:103197])

HSP 1 Score: 329.717 bits (844), Expect = 6.126e-101
Identity = 224/700 (32.00%), Postives = 350/700 (50.00%), Query Frame = 2
Query:  227 TNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEISRNL-------------RNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNN----VTKVPCERGRIIDPEFCNQCQAKHTQ------QIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIY---RAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEP--GTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAG------KGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER 2224
            + +   F+ FL Q++       F            Y  ++K    L   WI ++   LA +D  L ++L   P E +  ++  A  +         E    RP   E+ +++             R L  + +  LV + G++I  S +  +  +   +C  C+N    +   P   G  + P  CN  QA   +       I+ + C+ +D Q +KLQE P+ +P GE P  + LYC + L D + PG+RVT+ GIY   +        + RV   +  +Y+ VL  Q   +         +S +   E R L+  P++YE +S +I+P+I+G   +KK +  +LFGG     K+L  G   R +I++L+ GDPGT+KSQLL++V   +P G YTSGKGSS  GLTA + +DP + +  ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD  K   +NI   PT+LSRFD+IF++ D  +E+ D  LA+H++ L+      T+   G +D A ++ +IAY +                    P LS EA   +   Y+ MR            +  I    RQLE+++R+AEA ++M+L    T AD  EA RL + +   AA   L+G +      +GV G   + ++E+   I K L+ R
Sbjct:   29 SQLQRRFKEFLRQYRVGTDRTGFTFK---------YRDELKRHYNLGEYWIEVEMEDLASFDEELADHLHKQPAEHLQLLEEAAKEVAD-------EVTRPRPAGDELLQDIQVMLKSDASPSSIRILKSDMMSHLVKIPGIIISASAVRAKATRISIQCRSCHNTLTNIAMRPGLEGYAL-PRKCNMDQAGRPKCPLDPYFIMPDKCKCVDFQTLKLQELPDAVPHGEMPRHMQLYCDRYLCDKVVPGNRVTIMGIYSIKKFGLNPSKGRDRVGVGIRSSYIRVLGIQVDTDGSGRSFAGSVSPQEEEEFRRLAALPNIYELISKSISPSIFGGMDMKKAIACLLFGG---SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVEKCSPIGVYTSGKGSSAAGLTASVIRDPSSRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDETKG-EDNIDFMPTILSRFDMIFIVKDEHNEERDMMLAKHVMTLHVSALTQTQAVEGEIDLAKMKKFIAYCRA----------------RCGPRLSAEAAEKLKNRYIIMRSGARQHERDSDRRSSIPITVRQLEAIVRIAEALSKMKLQPFATEADVEEALRLFQVSTLDAA---LSGNL------SGVEGFTTQEDQEMLSRIEKQLKRR 682          
BLAST of DNA helicase vs. UniProt/SwissProt
Match: sp|Q5XK83|MCM4A_XENLA (DNA replication licensing factor mcm4-A OS=Xenopus laevis OX=8355 GN=mcm4-a PE=1 SV=1)

HSP 1 Score: 810.061 bits (2091), Expect = 0.000e+0
Identity = 393/731 (53.76%), Postives = 529/731 (72.37%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E F+ F+ +F   +  E    ++  + ++P+Y+Q+++E++++   ++NIDC HL  +D+ L   L+ YP+EVIP  D  A+ +F   Y D      I  RPYN   +RN+R+LNPED+DQL+T++G+VIR S+IIPEM ++ FKC VC   T+V  +RGRI +P  C  C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHT +LY + DLVD +QPGDRV VTGIYRA   R N + R +K+V+KT++DV+H++K+ ++ +     D E+   ++ERV  ++ L+ KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ +++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  +   +D A+L+DYIAYA+                  ++P L EEA   + E YV+MRK+G +G+G +SAYPRQLESLIRL+EAHA++R S +V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA+ + KL++ + +T  F YQ++ ++LR QSD  IT+DMF++ L+ L  E+ +  T KT+R
Sbjct:  146 VIWGTDVNVAICKEKFQRFVQRFIDPLAKEE--ENVGLDLNEPIYMQRLEEINVVGEPFLNIDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQESFFKCQVCAFTTRVEIDRGRIAEPSVCKHCNTTHSMALIHNRSMFSDKQMIKLQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVRNVKSVYKTHIDVIHYRKTDSKRLHGIDEDTEQKMFTEERVAVLKELAAKPDIYERLAAALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDETYDRRLAHHLVALYYQSEEQLKEEHLDMAVLKDYIAYART----------------YVNPRLGEEASQALIEAYVDMRKIG-SGRGMVSAYPRQLESLIRLSEAHAKVRFSSKVETIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATARKRKEELAQVLKKLIQSKGKTPAFKYQQLFEDLRGQSDAAITKDMFDEALHALADEDYLTVTGKTVR 856          
BLAST of DNA helicase vs. UniProt/SwissProt
Match: sp|Q6GL41|MCM4_XENTR (DNA replication licensing factor mcm4 OS=Xenopus tropicalis OX=8364 GN=mcm4 PE=2 SV=1)

HSP 1 Score: 806.979 bits (2083), Expect = 0.000e+0
Identity = 391/731 (53.49%), Postives = 527/731 (72.09%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E F+ F+ +F   +  E    ++  + ++P+Y+Q+++E++++   ++N+DC HL  +D+ L   L+ YP+EVIP  D  A+ +F   Y D      I  RPYN   +RN+R+LNPED+DQL+T++G+VIR S+IIPEM +A FKC VC   T+V  +RGRI +P  C  C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHT +LY + DLVD +QPGDRV VTGIYRA   R N + R +K+V+KT++DV+H++K+  + +     D E+   ++ERV  ++ L+ KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ +++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  +   +D A+L+DYIAYA+                  ++P L EEA   + E YV+MRK+G +G+G +SAYPRQLESLIRL+EAHA++R S +V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA+ + KL++ + +T    YQ++ ++LR QSD  +T+DMF++ L+ L  E+ +  T KT+R
Sbjct:  151 VIWGTDVNVATCKEKFQRFVQRFIDPLAKEE--ENVGLDLNEPIYMQRLEEINVVGEPFLNVDCDHLRSFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAFTTRVEIDRGRISEPSVCKHCNTTHSMALIHNRSMFSDKQMIKLQESPEDMPAGQTPHTTILYGHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVRNVKSVYKTHIDVIHYRKTDAKRLHGIDEDTEQKMFTEERVAMLKELAAKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDETYDRRLAHHLVALYYQSEEQMKEEHLDMAVLKDYIAYART----------------YVNPRLGEEASQALIEAYVDMRKIG-SGRGMVSAYPRQLESLIRLSEAHAKVRFSSKVETIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATARKRKEELAQVLKKLIQSKGKTPALKYQQLFEDLRGQSDAAVTKDMFDEALHALADEDYLTVTGKTVR 861          
BLAST of DNA helicase vs. UniProt/SwissProt
Match: sp|P33991|MCM4_HUMAN (DNA replication licensing factor MCM4 OS=Homo sapiens OX=9606 GN=MCM4 PE=1 SV=5)

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 402/733 (54.84%), Postives = 530/733 (72.31%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIP--DENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNR----LIDEEEAKLSQERVVEI-RALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKL-LEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E+F+ FL +F   +   +EN   DI     +PLY+Q++ E++++   ++N++C H+  +D++L   LI YP+EVIP  D   + +F   Y D      I  RP+N   ++N+RNLNPED+DQL+T++G+VIR S++IPEM +A F+C VC + T+V  +RGRI +P  C +C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHTV+L+ + DLVD +QPGDRV VTGIYRA   R N +   +K+V+KT++DV+H++K+  +    L +E E KL  E+ VE+ + LS+KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ I++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANPI S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIAYA                   I P LSEEA   + E YV+MRK+G++ +G +SAYPRQLESLIRLAEAHA++RLS++V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA A+ KL L + +T    YQ++ +++R QSD  IT+DMFE+ L  L  ++ +  T KT+R
Sbjct:  151 VIWGTDVNVAACKENFQRFLQRFIDPLAKEEENVGIDI----TEPLYMQRLGEINVIGEPFLNVNCEHIKSFDKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKNMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEMDRGRIAEPSVCGRCHTTHSMALIHNRSLFSDKQMIKLQESPEDMPAGQTPHTVILFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVELLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLLLDPQDEAYDRRLAHHLVALYYQSEEQAEEELLDMAVLKDYIAYAH----------------STIMPRLSEEASQALIEAYVDMRKIGSS-RGMVSAYPRQLESLIRLAEAHAKVRLSNKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALKKLILSKGKTPALKYQQLFEDIRGQSDIAITKDMFEEALRALADDDFLTVTGKTVR 861          
BLAST of DNA helicase vs. UniProt/SwissProt
Match: sp|P30664|MCM4B_XENLA (DNA replication licensing factor mcm4-B OS=Xenopus laevis OX=8355 GN=mcm4-b PE=1 SV=3)

HSP 1 Score: 805.823 bits (2080), Expect = 0.000e+0
Identity = 392/731 (53.63%), Postives = 528/731 (72.23%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E F+ F+ +F    P      ++  + ++P+Y+Q+++E++++   ++NIDC HL  +D+ L   L+ YP+EVIP  D  A+ +F   Y D      I  RPYN   +RN+R+LNPED+DQL+T++G+VIR S+IIPEM +A FKC VC   T+V  +RGRI +P  C  C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHT +LY + DLVD +QPGDRV VTGIYRA   R N + R +K+V+KT++DV+H++K+ ++ +     D E+   ++ERV  ++ L+ KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ +++LLCGDPGTSKSQLLQYV+NL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  +   +D A+L+DYIAYA+                  ++P LSEEA   + E YV MRK+G +G+G +SAYPRQLESLIRL+EAHA++R S++V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA+ + KL++ + +T    YQ++ ++LR QSD  IT+DMF++ L+ L  ++ +  T KT+R
Sbjct:  151 VIWGTDVNVATCKEKFQRFVQRFID--PSAKEEDNVGLDLNEPIYMQRLEEINVVGDPFLNIDCDHLRNFDQDLYRQLVCYPQEVIPTFDMAANEIFFERYPDSILEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQIIPEMQEAFFKCQVCAFTTRVEIDRGRIAEPSVCKHCNTTHSMALIHNRSMFSDKQMIKLQESPEDMPAGQTPHTTILYGHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVRNVKSVYKTHIDVIHYRKTDSKRLHGIDEDTEQKLFTEERVAMLKELAAKPDIYERLAAALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEVNILLCGDPGTSKSQLLQYVFNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALYYQSEEQMKEEHLDMAVLKDYIAYART----------------YVNPRLSEEASQALIEAYVSMRKIG-SGRGMVSAYPRQLESLIRLSEAHAKVRFSNKVETIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATARKRKEELAQVLKKLIQSKGKTPALKYQQLFEDLRGQSDAAITKDMFDEALHALADDDYLTVTGKTVR 861          
BLAST of DNA helicase vs. UniProt/SwissProt
Match: sp|P49717|MCM4_MOUSE (DNA replication licensing factor MCM4 OS=Mus musculus OX=10090 GN=Mcm4 PE=1 SV=1)

HSP 1 Score: 791.956 bits (2044), Expect = 0.000e+0
Identity = 399/733 (54.43%), Postives = 524/733 (71.49%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFKTEIP--DENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNR----LIDEEEAKL-SQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKL-LEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E+F+ FL  F   +   +EN   DI      PLY+Q++ E+++    ++N++C H+  + ++L   LI YP+EVIP  D   + +F   Y D      I  RP+N   ++++RNLNPED+DQL+T++G+VIR S++IPEM +A F+C VC + T+V  +RGRI +P  C  C   H+  ++HN   F DKQMIKLQESPEDMPAG+TPHT+VL+ + DLVD +QPGDRV VTGIYRA   R N +   +K+V+KT++DV+H++K+  +    L +E E KL S++RV  ++ LS+KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+    G G+  R+ I++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM ++TRSVLHEVMEQQ+LSIAKAGIICQL+ARTSVLAAANPI S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIAYA                   I P LSEEA   + E YV MRK+G++ +G +SAYPRQLESLIRLAEAHA++R S++V   D  EA+RL REALKQ+A DP TG++DI+ILTTG+S   RKR EELA A+ KL L + +T    YQ++ +++R QSD  IT+DMFE+ L  L  ++ +  T KT+R
Sbjct:  150 VIWGTDVNVATCKENFQRFLQCFTDPLAKEEENVGIDI----TQPLYMQQLGEINITGEPFLNVNCEHIKSFSKNLYRQLISYPQEVIPTFDMAVNEIFFDRYPDSILEHQIQVRPFNALKTKSMRNLNPEDIDQLITISGMVIRTSQLIPEMQEAFFQCQVCAHTTRVEIDRGRIAEPCSCVHCHTTHSMALIHNRSFFSDKQMIKLQESPEDMPAGQTPHTIVLFAHNDLVDKVQPGDRVNVTGIYRAVPIRVNPRVSNVKSVYKTHIDVIHYRKTDAKRLHGLDEEAEQKLFSEKRVKLLKELSRKPDIYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSHTGRGK-FRAEINILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMNESTRSVLHEVMEQQTLSIAKAGIICQLNARTSVLAAANPIESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQVEEEFLDMAVLKDYIAYAH----------------STIMPRLSEEASQALIEAYVNMRKIGSS-RGMVSAYPRQLESLIRLAEAHAKVRFSNKVEAIDVEEAKRLHREALKQSATDPRTGIVDISILTTGMSATSRKRKEELAEALRKLILSKGKTPALKYQQLFEDIRGQSDTAITKDMFEEALRALADDDFLTVTGKTVR 860          
BLAST of DNA helicase vs. TrEMBL
Match: H2KVN7 (DNA helicase OS=Clonorchis sinensis OX=79923 GN=CLF_112775 PE=3 SV=1)

HSP 1 Score: 924.85 bits (2389), Expect = 0.000e+0
Identity = 467/818 (57.09%), Postives = 581/818 (71.03%), Query Frame = 2
Query:  122 TTLRPGVNDD-------------------YGTTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFV--TDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHF-----QKSKNRLIDEEEAKLSQ--------ERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKT------------------------------TEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIRKR 2374
            +++RPGVND+                    GTTE S +S   PQ +I+GT++NI  +M  F+ FLL F    P E+    T    +P  PLY+Q ++++S+  +  ++IDC HL Q    L   L+ +PKEVIPA D   ++LF   + D      I  RP+NC  +RNLR+L+P+DLDQLV+V+GLVIRLS +IPEM++A FKC+VC  +T VPCERG + +PE C++C + HT Q+ HN C F+DKQMIKLQESPE+MPA +TPHTV LY ++DLVD ++PGDRV VTGIYRA   R +++QR +KAV+KTY+DVLHF     Q   +R + + +A + Q        ER+ E + L++KPDLYERL+ AIAPTIY NE +KKG+L+ LFGG  K+    G GE  RS I++LLCGDPGTSKSQLLQYVY LTPRGQYTSGKGSS VGLTA++TKDPET   TLQ+GAL L+DNGICCIDEFDKMTD+TRSVLHEVMEQQ+LSIAKAGI+CQLHARTS+LAAANP+GS WD  KTII+NIQLP TLLSRFDLIFLILDPQDE +DA+LARH+VGLY   + T                               +P  +D   L+DYI+YAK                 N  P +SEEA  Y+  EYVEMRK+G +G+GQISAYPRQLESL+RLAEAHAR+RLS++VT  DC EARRLQREALKQAAIDP+TG ID+NILTTGVS  +RKR EE+A A++ LLEER R LTF Y R+L+ELR++S+RMITR+ FEDGLN+LK  NKIDW   TIRKR
Sbjct:   88 SSVRPGVNDEAAMRAVLSQSGPLVATEGLVGTTETSSLSG--PQTVIWGTDVNIARVMSQFKHFLLTFVPSEPIEHLTLTTGRPLDPVRPLYLQLLEDLSISGQTHLDIDCEHLRQAHPQLYTQLVTFPKEVIPACDAATNALFLDRFRDAQLERSIQIRPFNCAQARNLRSLDPDDLDQLVSVSGLVIRLSSLIPEMMRAEFKCAVCGAMTSVPCERGCLTEPEACSRCHSAHTSQLQHNRCLFVDKQMIKLQESPENMPASQTPHTVSLYAHEDLVDKVKPGDRVMVTGIYRAVPLRMSNRQRTLKAVYKTYVDVLHFVVESDQLHSDRSVADHDAYVKQGSLRHFREERIQEFQTLARKPDLYERLAAAIAPTIYENEDVKKGILLQLFGGTRKDFSSKGRGE-FRSEINILLCGDPGTSKSQLLQYVYRLTPRGQYTSGKGSSAVGLTAFVTKDPETRQLTLQTGALVLADNGICCIDEFDKMTDSTRSVLHEVMEQQTLSIAKAGILCQLHARTSILAAANPVGSKWDPSKTIIDNIQLPHTLLSRFDLIFLILDPQDEVFDARLARHLVGLYYRGSSTGTTNVTTSSARSHRGARQAIVPMEIADEDSNDPANIDIDFLKDYISYAKT----------------NYQPKMSEEAGEYLVREYVEMRKLG-SGRGQISAYPRQLESLVRLAEAHARLRLSNEVTADDCREARRLQREALKQAAIDPVTGTIDVNILTTGVSSSMRKRREEMAAAVWTLLEERPRVLTFVYSRILEELRSRSERMITREAFEDGLNMLKNANKIDWAGNTIRKR 885          
BLAST of DNA helicase vs. TrEMBL
Match: A0A4S2MKT6 (DNA helicase OS=Opisthorchis felineus OX=147828 GN=CRM22_000524 PE=3 SV=1)

HSP 1 Score: 923.694 bits (2386), Expect = 0.000e+0
Identity = 468/822 (56.93%), Postives = 581/822 (70.68%), Query Frame = 2
Query:  122 TTLRPGVNDD-------------------YGTTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFV--TDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHF-----QKSKNRLIDEEEAKLSQ--------ERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKT----------------------------------TEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIRKR 2374
            +++RPGVND+                    GTTE S +S   PQ +I+GT++NI  +M  F+ FLL F    P E+    T    +P  PLY+Q ++++S+  +  ++IDC HL Q    L   L+ +PKEVIPA D   ++LF   + D      I  RP+NC  +RNLR+L+P+DLDQLV+V+GLVIRLS +IPEM++A FKC+VC  +T VPCERG + +PE C++C + HT Q+ HN C F+DKQMIKLQESPE+MPA +TPHTV LY ++DLVD ++PGDRV VTGIYRA   R +++QR +KAV+KTY+DVLHF     Q   +R + + +A + Q        ER+ E + L++KPDLYERL+ AIAPTIY NE +KKG+L+ LFGG  K+    G GE  RS I++LLCGDPGTSKSQLLQYVY LTPRGQYTSGKGSS VGLTA++TKDPET   TLQ+GAL L+DNGICCIDEFDKMTD+TRSVLHEVMEQQ+LSIAKAGI+CQLHARTS+LAAANP+GS WD  KTII+NIQLP TLLSRFDLIFLILDPQDE +DA+LARH+VGLY   + T                                   +P  +D   L+DYI+YAK                 N  P LSEEA  Y+  EYVEMRK+G +G+GQISAYPRQLESL+RLAEAHAR+RLS++VT  DC EARRLQREALKQAAIDP+TG ID+NILTTGVS  +RKR EE+A A++ LLEER R LTF Y R+L+ELR++S+RMITR+ FEDGLN+LK  NKIDW   TIRKR
Sbjct:   88 SSVRPGVNDEAAMRAVLSQSGPLVATEGLVGTTETSSLSG--PQTVIWGTDVNIARVMSQFKHFLLTFVPSEPIEHLTLTTGRPLDPVRPLYLQLLEDLSISGQTHLDIDCEHLRQAHPQLYTQLVTFPKEVIPACDAATNALFLDRFRDAQLERSIQIRPFNCAQARNLRSLDPDDLDQLVSVSGLVIRLSSLIPEMMRAEFKCAVCGAMTSVPCERGCLTEPEACSRCHSAHTSQLQHNRCLFVDKQMIKLQESPENMPASQTPHTVSLYAHEDLVDKVKPGDRVMVTGIYRAVPLRMSNRQRTLKAVYKTYVDVLHFVVESDQLHSDRSVADHDAYVKQGSLRQFREERIQEFQTLARKPDLYERLAAAIAPTIYENEDVKKGILLQLFGGTRKDFSSKGRGE-FRSEINILLCGDPGTSKSQLLQYVYRLTPRGQYTSGKGSSAVGLTAFVTKDPETRQLTLQTGALVLADNGICCIDEFDKMTDSTRSVLHEVMEQQTLSIAKAGILCQLHARTSILAAANPVGSKWDPSKTIIDNIQLPHTLLSRFDLIFLILDPQDEVFDARLARHLVGLYYRGSSTGTTDVTYQPTTSSARSHRGARQAIVPMEVADEDSNDPANIDIDFLKDYISYAKT----------------NYQPKLSEEAGEYLVREYVEMRKLG-SGRGQISAYPRQLESLVRLAEAHARLRLSNEVTADDCREARRLQREALKQAAIDPVTGTIDVNILTTGVSSSMRKRREEMAAAVWTLLEERPRVLTFVYSRILEELRSRSERMITREAFEDGLNMLKNANKIDWAGNTIRKR 889          
BLAST of DNA helicase vs. TrEMBL
Match: A0A074ZC04 (DNA helicase OS=Opisthorchis viverrini OX=6198 GN=T265_07572 PE=3 SV=1)

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 468/818 (57.21%), Postives = 582/818 (71.15%), Query Frame = 2
Query:  122 TTLRPGVNDD-------------------YGTTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFV--TDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHF-----QKSKNRLIDEEEAKLSQ--------ERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLY------------------------------CGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIRKR 2374
            +++RPGVND+                    GTTE S +S   PQ +I+GT++NI  +M  F+ FLL F    P E+    T    +P  PLY+Q ++++S+  +  ++IDC HL Q    L   LI +PKEVIPA D   ++LF   + D      I  RP+NC  +RNLR+L+P+DLDQLV+V+GLVIRLS +IPEM++A FKC+VC  +T VPCERG + +PE C++C + HT Q+ HN C F+DKQMIKLQESPE+MPA +TPHTV LY ++DLVD ++PGDRV VTGIYRA   R +++QR +KAV+KTY+DVLHF     Q   +R + + +A + Q        ER+ E + L++KPDLYERL+ AIAPTIY NE +KKG+L+ LFGG  K+    G GE  RS I++LLCGDPGTSKSQLLQYVY LTPRGQYTSGKGSS VGLTA++TKDPET   TLQ+GAL L+DNGICCIDEFDKMTD+TRSVLHEVMEQQ+LSIAKAGI+CQLHARTS+LAAANP+GS WD  KTII+NIQLP TLLSRFDLIFLILDPQDE +DA+LARH+VGLY                                 +++ +P  +D   L+DYI+YAK                 N  P +SEEA  Y+  EYVEMRK+G +G+GQISAYPRQLESL+RLAEAHAR+RLS++VT  DC EARRLQREALKQAAIDP+TG ID+NILTTGVS  +RKR EE+A AI+ LLEER R LTF Y R+L+ELR++S+RMITR+ FEDGLN+LK  NKIDW   TIRKR
Sbjct:   88 SSVRPGVNDEAAMRAVLSQSGPLVATEGLVGTTETSSLSG--PQTVIWGTDVNIARVMSQFKHFLLTFVPSAPIEHLTLTTGRPLDPVRPLYLQLLEDLSISGQTHLDIDCEHLRQAHPQLYTQLITFPKEVIPACDAATNALFLDRFRDAQLERSIQIRPFNCAQARNLRSLDPDDLDQLVSVSGLVIRLSSLIPEMMRAEFKCAVCGAMTSVPCERGCLTEPEACSRCHSAHTCQLQHNRCLFVDKQMIKLQESPENMPASQTPHTVSLYAHEDLVDKVKPGDRVMVTGIYRAVPLRMSNRQRTLKAVYKTYVDVLHFVIESDQLHSDRSVADHDAYVKQGSLRQFREERIQEFQTLARKPDLYERLAAAIAPTIYENEDVKKGILLQLFGGTRKDFSSKGRGE-FRSEINILLCGDPGTSKSQLLQYVYRLTPRGQYTSGKGSSAVGLTAFVTKDPETRQLTLQTGALVLADNGICCIDEFDKMTDSTRSVLHEVMEQQTLSIAKAGILCQLHARTSILAAANPVGSKWDPSKTIIDNIQLPHTLLSRFDLIFLILDPQDEVFDARLARHLVGLYYRGSSTGTTDVTTSTTRSHRGARQAIAPMEVVDDESNDPANIDIDFLKDYISYAKT----------------NYQPKMSEEAGEYLVREYVEMRKLG-SGRGQISAYPRQLESLVRLAEAHARLRLSNEVTADDCREARRLQREALKQAAIDPVTGTIDVNILTTGVSSSMRKRREEMAAAIWTLLEERPRVLTFVYSRILEELRSRSERMITREAFEDGLNMLKNANKIDWAGNTIRKR 885          
BLAST of DNA helicase vs. TrEMBL
Match: A0A3R7H8Y2 (DNA helicase OS=Clonorchis sinensis OX=79923 GN=mcm4-a PE=3 SV=1)

HSP 1 Score: 921.768 bits (2381), Expect = 0.000e+0
Identity = 466/818 (56.97%), Postives = 581/818 (71.03%), Query Frame = 2
Query:  122 TTLRPGVNDD-------------------YGTTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFV--TDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHF-----QKSKNRLIDEEEAKLSQ--------ERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKT------------------------------TEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIRKR 2374
            +++RPGVND+                    GTTE S +S   PQ +I+GT++NI  +M  F+ FLL F    P E+    T    +P  PLY+Q ++++S+  +  ++IDC HL Q    L   L+ +PKEVIPA D   ++LF   + D      I  RP+NC  +RNLR+L+P+DLDQLV+V+GLVIRLS +IPEM++A FKC+VC  +T VPCERG + +PE C++C + HT Q+ HN C F+DKQMIKLQESPE+MPA +TPHTV LY ++DLVD ++PGDRV VTGIYRA   R +++QR +KAV+KTY+DVLHF     Q   +R + + +A + Q        ER+ E + L++KPDLYERL+ AIAPTIY NE +KKG+L+ LFGG  K+    G GE  RS I++LLCGDPGTSKSQLLQYVY LTPRGQYTSGKGSS VGLTA++TKDPET   TLQ+GAL L+DNGICCIDEFDKMTD+TRSVLHEVMEQQ+LSIAKAGI+CQLHARTS+LAAANP+GS WD  KTII+NIQLP TLLSRFDLIFLILDPQDE +DA+LARH+VGLY   + T                               +P  +D   L+DYI+YAK                 N  P +SEEA  Y+  EYVEMRK+G +G+GQISAYPRQLESL+RLAEAHAR+RLS++VT  DC EARRLQREALKQAAIDP+TG ID+NILTTGVS  +RKR EE+A A++ LLEER R LTF Y R+++ELR++S+RMITR+ FEDGLN+LK  NKIDW   TIRKR
Sbjct:  298 SSVRPGVNDEAAMRAVLSQSGPLVATEGLVGTTETSSLSG--PQTVIWGTDVNIARVMSQFKHFLLTFVPSEPIEHLTLTTGRPLDPVRPLYLQLLEDLSISGQTHLDIDCEHLRQAHPQLYTQLVTFPKEVIPACDAATNALFLDRFRDAQLERSIQIRPFNCAQARNLRSLDPDDLDQLVSVSGLVIRLSSLIPEMMRAEFKCAVCGAMTSVPCERGCLTEPEACSRCHSAHTSQLQHNRCLFVDKQMIKLQESPENMPASQTPHTVSLYAHEDLVDKVKPGDRVMVTGIYRAVPLRMSNRQRTLKAVYKTYVDVLHFVVESDQLHSDRSVADHDAYVKQGSLRHFREERIQEFQTLARKPDLYERLAAAIAPTIYENEDVKKGILLQLFGGTRKDFSSKGRGE-FRSEINILLCGDPGTSKSQLLQYVYRLTPRGQYTSGKGSSAVGLTAFVTKDPETRQLTLQTGALVLADNGICCIDEFDKMTDSTRSVLHEVMEQQTLSIAKAGILCQLHARTSILAAANPVGSKWDPSKTIIDNIQLPHTLLSRFDLIFLILDPQDEVFDARLARHLVGLYYRGSSTGTTNVTTSSARSHRGARQAIVPMEIADEDSNDPANIDIDFLKDYISYAKT----------------NYQPKMSEEAGEYLVREYVEMRKLG-SGRGQISAYPRQLESLVRLAEAHARLRLSNEVTADDCREARRLQREALKQAAIDPVTGTIDVNILTTGVSSSMRKRREEMAAAVWTLLEERPRVLTFVYSRIIEELRSRSERMITREAFEDGLNMLKNANKIDWAGNTIRKR 1095          
BLAST of DNA helicase vs. TrEMBL
Match: G4VM72 (DNA helicase OS=Schistosoma mansoni OX=6183 GN=Smp_172530 PE=3 SV=1)

HSP 1 Score: 910.212 bits (2351), Expect = 0.000e+0
Identity = 464/789 (58.81%), Postives = 569/789 (72.12%), Query Frame = 2
Query:  122 TTLRPGVNDDY-------------------GTTERSGISHDLPQNL---IYGTNINITNIMESFRSFLLQFKTEIPDE-----NFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNY--VDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLY--------CGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIRKR 2374
            +++RPGVND+                    GTT+ S  S    +N+   I+GT++NI  +M  F+ FLL +   IP +     N  T    +P  PLY+Q+M+++++     ++IDC HL      L   L+ +PKEVIPA D    +LF   +  V     I  RP+NC  SR+LR+L+P+DLDQLVTV+GLVIRLS +IPEM++A FKC++C  +T VPCERGRI +PE C +C + HT Q+ HN C F+DKQMIKLQESPE+MPA +TPHTV++Y +++LVD IQPGDRV VTGIYRA   R +++QR +KAV+KTY+DVLHF +  + L      + ++ER+ E   L++KPDLYERL+  IAPTIY NE IKKG+L+ LFGG  K+    G G + RS I++LLCGDPGTSKSQLLQYVY LTPRGQYTSGKGSS VGLTAYITKD ET   TLQ+GAL L+DNGICCIDEFDKM+D+TRSVLHEVMEQQ+LSIAKAGI+CQLHARTS+LAAANPIGS WD  KTII+NIQLP TLLSRFDLIFLILDPQDE YD +LARH+VGLY               +P  V+  +L+DYIAYAK+                   P L+EEA  Y+  EYVEMRK+G +G+GQISAYPRQLESL+RLAEAHAR+RLS+ VT  DC EARRLQREALKQAAIDPLTG IDINILTTG+S  +RKR EE+A AI+ LLEER R LTF Y RVL++LR +S+RMITR+ FEDGLN LK  NKIDW   TIRKR
Sbjct:   92 SSVRPGVNDEVAVRAVLSQSGPLVPATGVPGTTDGSTASGPQARNIFTVIWGTDVNIAQVMSRFKHFLLTY---IPPDLTGQPNLTTGQPIDPQRPLYLQRMEDLAISGSTALDIDCEHLRSARPDLYTQLVTFPKEVIPACDAATHALFLDRFREVQLERSIQIRPFNCARSRDLRSLDPDDLDQLVTVSGLVIRLSPLIPEMMRAEFKCAICGAMTSVPCERGRIAEPEACIRCHSAHTAQLQHNRCLFVDKQMIKLQESPENMPASQTPHTVLMYAHEELVDKIQPGDRVIVTGIYRAIPLRMSNRQRTLKAVYKTYIDVLHFLEEAHIL-----RQFTEERIEEFHTLARKPDLYERLAAGIAPTIYENEDIKKGILLQLFGGTRKDFTAKGRG-DFRSEINILLCGDPGTSKSQLLQYVYRLTPRGQYTSGKGSSAVGLTAYITKDAETRQLTLQTGALVLADNGICCIDEFDKMSDSTRSVLHEVMEQQTLSIAKAGILCQLHARTSILAAANPIGSKWDPSKTIIDNIQLPHTLLSRFDLIFLILDPQDEVYDTRLARHLVGLYYRGAVLLDMDSQTDDDPSFVNGKLLKDYIAYAKM----------------KYFPKLTEEAGEYLVREYVEMRKLG-SGRGQISAYPRQLESLVRLAEAHARLRLSNHVTADDCREARRLQREALKQAAIDPLTGTIDINILTTGISSSVRKRREEMAMAIWSLLEERPRVLTFVYSRVLEDLRARSERMITRENFEDGLNFLKNTNKIDWAGNTIRKR 854          
BLAST of DNA helicase vs. Ensembl Cavefish
Match: mcm4 (minichromosome maintenance complex component 4 [Source:ZFIN;Acc:ZDB-GENE-030131-9544])

HSP 1 Score: 816.994 bits (2109), Expect = 0.000e+0
Identity = 406/733 (55.39%), Postives = 528/733 (72.03%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQF--KTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNR----LIDEEEAKL-SQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            +I+GT++N+    E F+ FL +F       DEN   D+    ++PLY+QK+ E+S++    +N++CSH+  +D  L   LI YP+EVIP  D   + LF   + D      I  RPYN   +RN+R+LNPED+DQL+T++G+VIR S++IPEM +A F+C VC   T+V  +RGRI +P  C  C   H+  +VHN   F DKQMIKLQESPEDMPAG+TPHT V+Y + DLVD +QPGDRV +TGIYRAA  R N +Q  +K+V+KT++D +HF+K+  R    L +E E KL ++ERV  ++ L+ KPD+YERLS A+AP+IY +E IKKG+L+ LFGG  K+  + G G N R+ +++LLCGDPGTSKSQLLQYV+NL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM+D+TRSVLHEVMEQQ+LSIAKAGIICQL+ARTS+LAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +      +D A+L+DYIAYA+                  I+P LSEEA   + E YV+MRK+G +G+G +SAYPRQLESLIRLAEAHA++R SD+V   D  EA+RL REALKQ+A DP TG +DI+ILTTG+S   RKR EE+A+A+ KL++ + +T    YQ++ D+LR QS+  IT+DMF++ L  L  E+ +  T KT+R
Sbjct:  103 VIWGTDVNVGTCKEKFQRFLQRFIDPESREDENASLDL----NEPLYLQKLDEISVVGDPVLNVNCSHIQAFDADLYRQLISYPQEVIPTFDMSVNELFFDRFPDSVLEHQIQVRPYNALKTRNMRSLNPEDIDQLITISGMVIRTSQLIPEMQEAFFRCQVCAFSTRVEVDRGRIAEPAVCRHCNTTHSLALVHNRSVFSDKQMIKLQESPEDMPAGQTPHTTVVYAHNDLVDKVQPGDRVNITGIYRAAPMRVNPRQSQVKSVYKTHIDAIHFRKTDERRLHSLDEENEQKLFTEERVATLKELAAKPDVYERLSSALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRG-NFRAEVNILLCGDPGTSKSQLLQYVFNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDSTRSVLHEVMEQQTLSIAKAGIICQLNARTSILAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVALYYQSEEQIVEEYLDMAVLKDYIAYART----------------YINPRLSEEASQALIEAYVDMRKIG-SGRGMVSAYPRQLESLIRLAEAHAKVRFSDKVETIDVEEAKRLHREALKQSATDPRTGFVDISILTTGMSATARKRKEEVAQALKKLIQSKGKTPAMKYQQLFDDLRGQSEAAITKDMFDEALRALADEDYLTVTGKTVR 813          
BLAST of DNA helicase vs. Ensembl Cavefish
Match: mcm5 (minichromosome maintenance complex component 5 [Source:NCBI gene;Acc:103021452])

HSP 1 Score: 342.428 bits (877), Expect = 9.147e-106
Identity = 235/701 (33.52%), Postives = 359/701 (51.21%), Query Frame = 2
Query:  215 NINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIP----AMDCVADSLFKSNYV--DFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVC----NNVTKVPCERGRIIDPEFCNQCQAKHTQ------QIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYR----AASQRENSKQRVIKAVFKTYLDVLHFQ---KSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTE--PGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAG------KGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER 2224
            ++  + I + FR FL QF+       F            Y  ++K    L   W+ ++   LA +D  L + L   P E +P    A   VAD + +   V  +  + I     +     ++R+L  E + +LV + G++I  S +  +  +   +C  C    +N+   P  +G  + P  CN  QA   +       I+ + C  +D Q ++LQESP+ +P GE P  + LYC + L D + PG+RVT+ GIY     A S+ +   +     +   YL V+  Q   +   R      + L +E   E+RAL+  P +Y+ ++ ++AP+IYG++ +KK +  +LFGG     K+L  G   R +I++L+ GDPGT+KSQLL++V   +P G YTSGKGSS  GLTA + +DP T    ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD+ K   +NI   PT+LSRFD+IF+I D  D Q D  LARH++ ++      TE   G +  A L+ YIAYA+V                   P LS  A   +   YV MR            +  I    RQLE+++R+AE+ A+M+L       +  EA RL + +   AA   L+G +      +GV G   + ++E+   I K L+ R
Sbjct:   27 SVKRSQIKKRFREFLRQFRVGTDRTGFTYK---------YRDELKRHYTLGEYWVEVEMEDLASFDEDLSDCLYKLPTENLPLLEEAAQEVADEVTRPRPVGEETVQDIQVMLKSDAHPASIRSLKSEQVSRLVKIPGIIISSSAVRAKATRVCLQCRGCRAVISNIPLPPGLQGYAL-PRKCNTEQAGRVKCPVDPYFIIPDRCVCVDFQTLRLQESPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRVTIMGIYSIKKMATSKTKGRDKGAGVGIRSAYLRVVGIQVDTEGAGRGATGSVSPLEEE---ELRALAASPAVYDSIARSLAPSIYGSDDLKKAIACLLFGG---SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPNTRGFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDDTKG-EDNIDFMPTILSRFDMIFIIKDQHDHQRDMTLARHVMNVHLSAQTQTEGVEGEIPLATLKKYIAYARV----------------KCGPRLSAAAAEKLKNRYVVMRSGAREHERESDRRASIPITVRQLEAVVRIAESLAKMKLQAIAGEEEVDEALRLFQVSTLDAA---LSGSL------SGVEGFTTQEDQEMISRIEKQLKRR 685          
BLAST of DNA helicase vs. Ensembl Cavefish
Match: mcm5 (minichromosome maintenance complex component 5 [Source:NCBI gene;Acc:103021452])

HSP 1 Score: 330.102 bits (845), Expect = 1.370e-101
Identity = 227/695 (32.66%), Postives = 343/695 (49.35%), Query Frame = 2
Query:  215 NINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVC----NNVTKVPCERGRIIDPEFCNQCQAKHTQ------QIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYR----AASQRENSKQRVIKAVFKTYLDVLHFQ---KSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTE--PGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAG------KGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER 2224
            ++  + I + FR FL QF+       F            Y  ++K    L   W+ ++   LA +D  L + L   P E +P                                       E + +LV + G++I  S +  +  +   +C  C    +N+   P  +G  + P  CN  QA   +       I+ + C  +D Q ++LQESP+ +P GE P  + LYC + L D + PG+RVT+ GIY     A S+ +   +     +   YL V+  Q   +   R      + L +E   E+RAL+  P +Y+ ++ ++AP+IYG++ +KK +  +LFGG     K+L  G   R +I++L+ GDPGT+KSQLL++V   +P G YTSGKGSS  GLTA + +DP T    ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD+ K   +NI   PT+LSRFD+IF+I D  D Q D  LARH++ ++      TE   G +  A L+ YIAYA+V                   P LS  A   +   YV MR            +  I    RQLE+++R+AE+ A+M+L       +  EA RL + +   AA   L+G +      +GV G   + ++E+   I K L+ R
Sbjct:   27 SVKRSQIKKRFREFLRQFRVGTDRTGFTYK---------YRDELKRHYTLGEYWVEVEMEDLASFDEDLSDCLYKLPTENLPL-------------------------------------SEQVSRLVKIPGIIISSSAVRAKATRVCLQCRGCRAVISNIPLPPGLQGYAL-PRKCNTEQAGRVKCPVDPYFIIPDRCVCVDFQTLRLQESPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRVTIMGIYSIKKMATSKTKGRDKGAGVGIRSAYLRVVGIQVDTEGAGRGATGSVSPLEEE---ELRALAASPAVYDSIARSLAPSIYGSDDLKKAIACLLFGG---SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPNTRGFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVFGRWDDTKG-EDNIDFMPTILSRFDMIFIIKDQHDHQRDMTLARHVMNVHLSAQTQTEGVEGEIPLATLKKYIAYARV----------------KCGPRLSAAAAEKLKNRYVVMRSGAREHERESDRRASIPITVRQLEAVVRIAESLAKMKLQAIAGEEEVDEALRLFQVSTLDAA---LSGSL------SGVEGFTTQEDQEMISRIEKQLKRR 642          
BLAST of DNA helicase vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 328.561 bits (841), Expect = 3.068e-99
Identity = 210/611 (34.37%), Postives = 321/611 (52.54%), Query Frame = 2
Query:  329 LYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDF----HEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCE-RGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTV-----------------DTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREAL 2095
            ++ +++ +M    +  + ++   LA  +  L   L   P E++   D  A  +  + Y  +    HE I  R  N  +   LR+L    L+QL+  +G+V   + ++P++    + C+ C+ +     + + + + P  C +CQ+    +I      + + Q I +QESP  + AG  P +       DLVD  +PGD + +TGIY        +       VF T +   H  +  +R+     A+L+ E V  I ALS+   + ER+  +I P+IYG+E IK+GL + LFGG   E K  G    +R +I+VL+CGDPGT+KSQ L+YV  +  R  +T+G+G+S VGLTAY+ + P T   TL++GAL L+D G+C IDEFDKM D  R+ +HE MEQQS+SI+KAGI+  L AR +V+AAANPIG  +D   T  EN+ L   ++SRFD++ ++ D  D   D  LAR +VG +  H+ + + G V                    +LR YI YAK                E + P L++  ++ V   Y ++RK   A  G I    R +ES+IR+AEAHARM L D V   D   A R+  E+ 
Sbjct:  193 VFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHE-IHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPGSCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNMANGF-PVFATVILANHIARKDDRVA---VAELTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGG---EAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAK----------------ERVRPKLNQMDQDKVARIYSDLRKESMA-TGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESF 778          
BLAST of DNA helicase vs. Ensembl Cavefish
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:103045462])

HSP 1 Score: 328.561 bits (841), Expect = 3.595e-99
Identity = 210/611 (34.37%), Postives = 321/611 (52.54%), Query Frame = 2
Query:  329 LYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDF----HEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCE-RGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTV-----------------DTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREAL 2095
            ++ +++ +M    +  + ++   LA  +  L   L   P E++   D  A  +  + Y  +    HE I  R  N  +   LR+L    L+QL+  +G+V   + ++P++    + C+ C+ +     + + + + P  C +CQ+    +I      + + Q I +QESP  + AG  P +       DLVD  +PGD + +TGIY        +       VF T +   H  +  +R+     A+L+ E V  I ALS+   + ER+  +I P+IYG+E IK+GL + LFGG   E K  G    +R +I+VL+CGDPGT+KSQ L+YV  +  R  +T+G+G+S VGLTAY+ + P T   TL++GAL L+D G+C IDEFDKM D  R+ +HE MEQQS+SI+KAGI+  L AR +V+AAANPIG  +D   T  EN+ L   ++SRFD++ ++ D  D   D  LAR +VG +  H+ + + G V                    +LR YI YAK                E + P L++  ++ V   Y ++RK   A  G I    R +ES+IR+AEAHARM L D V   D   A R+  E+ 
Sbjct:  202 VFKERISDMCKENKESLLVNYEELASREHVLAYFLPEAPAEMLKIFDEAAKEVVLAMYPKYDRIAHE-IHVRIGNLPLVEELRSLRQLHLNQLIRTSGVVTSCTGVLPQLGMVKYNCNKCSFILGPFFQSQNQEVKPGSCPECQSLGPFEINMEQTVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDHCKPGDEIELTGIYHNNYDGSLNMANGF-PVFATVILANHIARKDDRVA---VAELTDEDVKAIVALSKDERIGERIFASIGPSIYGHEDIKRGLALALFGG---EAKNPGGKHKVRGDINVLMCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVTREWTLEAGALVLADRGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFSENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSNKEGGVAGLEEVVLPNSSDVPPIPQELLRKYIIYAK----------------ERVRPKLNQMDQDKVARIYSDLRKESMA-TGSIPITVRHIESMIRMAEAHARMHLRDYVQEDDVNMAIRVMLESF 787          
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Match: mcm5 (minichromosome maintenance complex component 5 [Source:ZFIN;Acc:ZDB-GENE-021209-1])

HSP 1 Score: 286.189 bits (731), Expect = 2.148e-87
Identity = 185/516 (35.85%), Postives = 277/516 (53.68%), Query Frame = 2
Query:  716 IDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIY---RAASQREN-SKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAK-AGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEP--GTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNA------GKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER 2224
            IDP F           I+ + C+ +D Q +KLQE+P+ +P GE P  + LYC + L D + PG+R+TV GIY   +A ++ +   + R    +   YL V+      +         L  +   EIR L+  P +YE ++ +IAP+IYG   IKK +  +L GG     K+L  G   R +I++LL GDPGT+KSQLL++V   +P G YTSGKGSS  GLTA + +DP T +  ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++S  +  GI   L++R SVLAAAN +   WD+ K   ENI   PT+LSRFD+IF+I D  +E+ D  LA+H++ ++       +   G ++ + L+ +IAY +                    P +S EA   +   YV MR            +  I    RQLE+++R++E+ A+MRL    T A   EA RL + +   AA   L+G +      +G  G   + ++EL   + K L+ R
Sbjct:   17 IDPYF-----------IMPDKCKCVDYQTLKLQEAPDAVPHGEMPRHMQLYCDRYLCDRVVPGNRITVMGIYSIKKAFTKMQGKGRDRTGAGIRNPYLRVVGITVDTDGAGRSMGIALHPQEEEEIRQLAASPSVYETIARSIAPSIYGFMDIKKAIASLLIGG---SRKRLPDGLTRRGDINLLLLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVMRDPATRNFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISTLRIGGITTTLNSRCSVLAAANSVFGRWDDSKG-EENIDFMPTILSRFDMIFIIKDEHNEKRDMILAKHVMNVHLNAKTQMQAVEGEIELSTLKKFIAYCR----------------SKCGPRMSAEACEKLKNRYVLMRSGAREHDRDRDHRNSIPITVRQLEAIVRISESQAKMRLQPFATEAHVDEALRLFQVSTLDAA---LSGSL------SGAEGFTTQEDQELLARVEKQLKRR 492          
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Match: mcm8 (minichromosome maintenance 8 homologous recombination repair factor [Source:ZFIN;Acc:ZDB-GENE-120927-1])

HSP 1 Score: 291.582 bits (745), Expect = 2.007e-86
Identity = 210/662 (31.72%), Postives = 321/662 (48.49%), Query Frame = 2
Query:  536 YNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAK--HTQQIVHN----CCEFIDKQMIKLQE--SPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQREN-SKQRVIKAVFKTYLDVLHFQKSKNRLID---EEEA-----KLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGEN---MRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGH--------NKTTEPGTVDTA-------------------------------MLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKI 2344
            YN E    L+NL      +LV + G V+R+  I P   +  F C+ C     +    G+   P    +C  +   ++  + N      E +D Q IK+QE    E   AG  P TV      DLVD+  PGD +T+TGI + AS  E  +K    K +F  Y+  +    +K +  D   E+ A       S + +  ++ +  +P L+  L  +I PTIYG+E +K GL + LFGG     ++ G  +N   +R + HVL+ GDPG  KSQ+LQ V N+ PRG Y  G  ++  GLT  ++KD  +G   L++GAL L D G+CCIDEFDKM +  +++L E MEQQS+S+AKAG++C L ARTS++AAANP+   ++  KT+ EN+++   LLSRFDL+F+++D  DE+ D  L+ H++ ++ G         ++   PG   TA                               +LR Y+ YA+                  + P LS EA   + + Y+E+R+  + G G      RQLESLIRL EA AR+ L +  T  D  +   + + +      D L G +       G     R   +    A+ +  E+     F+ Q++         + + RD+   GL +  FE  I
Sbjct:  203 YNYEPLTQLKNLRANCYGRLVAIRGTVVRVGNIKPLCTRLAFSCNACGTEQVLRLPYGKFTLPTKRVKCADEDCRSRTFMPNRRSQLTETVDWQNIKVQELMHGEQREAGRIPRTVECELTHDLVDSCVPGDVITLTGIVKVASSDEGRNKSNKDKCMFLLYIQAVAVSNTKGQRSDGGGEDTAPGVALDFSLKELYAVQEIQAQPHLFRLLVHSICPTIYGHELVKAGLALALFGG----VQRYGTDKNRIPVRGDPHVLIVGDPGLGKSQMLQAVCNIAPRGVYVCGNTTTTAGLTVTLSKDGPSGDYALEAGALVLGDQGLCCIDEFDKMPNQHQALL-EAMEQQSISLAKAGVVCSLPARTSIVAAANPVCGHYNKSKTVSENLKMGSALLSRFDLVFILVDTPDEERDHVLSEHVMAMHAGKRMLAGASVSRAAAPGLKLTASSSSDDVLGGLSLSDRLKARRGEALDPVPHSLLRKYVGYAR----------------RYVRPCLSAEAAQTLQDFYLELRRQHHGGDG-TPITTRQLESLIRLTEARARLELRENATKEDADDVIDIMKHSFSDTLSDEL-GTLHFERTQHGSGMSNRSAAKRFVTALARCSEQICNTMFTMQQL---------QQLARDI---GLQVADFEGFI 829          
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006035.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006035.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 281.952 bits (720), Expect = 6.051e-84
Identity = 182/518 (35.14%), Postives = 277/518 (53.47%), Query Frame = 2
Query:  557 NLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFC--NQCQAKHTQQIVH---NCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQR--ENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHI--VGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQ 2083
            ++R++    + +LVTV G+V R +E+ P M+ A + C  C   T  P      +    C    CQ   +   ++      +F+  Q +K+QE  + +P G  P  + +    +     QPGD +++TGI+    ++     +Q ++   F     V+   K+++  +D EE   S     E+R ++++ D YE+L+ +IAP IYG+E +KK LL++L GG  +  +    G  +R NI++ L GDPG +KSQLL Y+  L PR QYT+G+GSS VGLTA + +DP TG  TL+ GAL L+D+G+CCIDEFDKM D+ R+ +HEVMEQQ++SIAK         RT VL           +  +    I+LP  LLSRFDL++LI D  D   D +LA+HI  V  +C H   ++   +D  ++R YIA                   +   P + +   +Y+T  YVEMRK     K       R L +++RL+ A AR+RL D V   D  EAR ++
Sbjct:  147 SVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIASTSFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQGLLSETFLEAHRVVKMNKTEDNELDVEELSES-----ELRQITEE-DFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDRSPR----GMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRTRVLQLVGYGRGGGGSCCSRWLGIKLPAALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHC-HQPPSQHTPLDMKLMRRYIALC-----------------QRRQPAVPDTLADYITAAYVEMRKEARVSKDTTFTSARTLLAILRLSTALARLRLVDVVEKEDVNEARLME 636          
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008164.1 (pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:ENSPMAG00000007367.1 transcript:ENSPMAT00000008164.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 263.077 bits (671), Expect = 9.511e-80
Identity = 168/447 (37.58%), Postives = 248/447 (55.48%), Query Frame = 2
Query:  446 KEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKA-HF----------KCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQ--KPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLY 1747
            KE++  +D      F+S YV        R  +       R L    L  +V V G+V + S + P+++++ H+          K S   ++   P         E  N  + ++   I      + D Q I LQE PE  PAG+ P +  +    DLVD  +PGDRV V G +R    +   K       F+T L       +  ++  E     S E V +I+  S+    +++++LS ++AP+I+G+E IKK +L +L GG     K L  G  +R +I+VLL GDP  +KSQ+L+YV +  PR   T+G+GSS VGLTA +T D ETG   L++GA+ L D G+ CIDEFDKMTD  R+ +HEVMEQ  ++IAKAGI  +L+AR SVLAAANPI   +D  KT +ENI L  +LLSRFDL+F++LD  D +YD +++ H++ ++
Sbjct:   18 KELVGNVDGTYAKQFESFYVGLEGSFGARHLSP------RTLTSRFLGNMVCVEGIVTKCSLVRPKVVRSVHYCPATQKSIERKYSDLTSLDAFPSSAAYPTKDEESNPLETEYGLSI------YRDHQTISLQEMPEKAPAGQLPRSADVVLDDDLVDRCKPGDRVQVIGTFRCLPGK---KAGYTSGTFRTIL----IGNNVKQMNKEVVPTFSGEDVNKIKTFSKTHSKNIFDQLSKSLAPSIHGHEYIKKAVLCLLLGG---TEKILDNGSRIRGDINVLLIGDPSVAKSQMLRYVLHTAPRAIPTTGRGSSGVGLTAAVTTDQETGERRLEAGAMVLGDRGVVCIDEFDKMTDMDRTAIHEVMEQGRVTIAKAGIHARLNARCSVLAAANPIYGRYDQYKTPMENIGLQDSLLSRFDLLFIVLDQTDPEYDREISDHVLRMH 442          
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006014.1 (pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 gene:ENSPMAG00000005356.1 transcript:ENSPMAT00000006014.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 265.774 bits (678), Expect = 5.358e-78
Identity = 182/528 (34.47%), Postives = 276/528 (52.27%), Query Frame = 2
Query:  557 NLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFC--NQCQAKHTQQIVH---NCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQR--ENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKA--GIICQLHA-------RTSVLAAANPIGSC-WDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHI--VGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQ 2083
            ++R++    + +LVTV G+V R +E+ P M+ A + C  C   T  P      +    C    CQ   +   ++      +F+  Q +K+QE  + +P G  P  + +    +     QPGD +++TGI+    ++     +Q ++   F     V+   K+++  +D EE   S     E+R ++++ D YE+L+ +IAP IYG+E +KK LL++L GG  +  +    G  +R NI++ L GDPG +KSQLL Y+  L PR QYT+G+GSS VGLTA + +DP TG  TL+ GAL L+D+G+CCIDEFDKM D+ R+ +HEVMEQQ++SIAK   G+     A       RT     A+ I  C W               LLSRFDL++LI D  D   D +LA+HI  V  +C H   ++   +D  ++R YIA                   +   P + +   +Y+T  YVEMRK     K       R L +++RL+ A AR+RL D V   D  E R ++
Sbjct:  147 SVRDVKANSIGRLVTVRGVVTRATEVKPMMVVATYTCDQCGAETYQPIASTSFMPLALCPSRDCQTNKSGGRLYLQSRGSKFVKFQELKIQEHSDQVPVGCIPRAMTVCVRGENTRLAQPGDHISITGIFLPVLKQGFRAMQQGLLSETFLEAHRVVKMNKTEDNELDVEELSES-----ELRQITEE-DFYEKLAASIAPEIYGHEDVKKALLLLLVGGVDRSPR----GMKIRGNINICLMGDPGVAKSQLLCYIDRLAPRSQYTTGRGSSGVGLTAAVLQDPLTGEMTLEGGALVLADHGVCCIDEFDKMADSDRTSIHEVMEQQTISIAKVTWGVGASTRALCSDGGGRTVAAGRASRIDDCVWLALMLPA-------ALLSRFDLLWLIQDKPDRDNDIRLAQHITYVHQHC-HQPPSQHTPLDMKLMRRYIALC-----------------QRRQPAVPDTLADYITAAYVEMRKEARVSKDTTFTSARTLLAILRLSTALARLRLVDVVEKEDVNEMRLME 639          
BLAST of DNA helicase vs. Ensembl Yeast
Match: MCM4 (Essential helicase component of heterohexameric MCM2-7 complexes; MCM2-7 complexes bind pre-replication complexes on DNA and melt DNA prior to replication; forms an Mcm4p-6p-7p subcomplex; shows nuclear accumulation in G1; homolog of S. pombe Cdc21p [Source:SGD;Acc:S000006223])

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 326/772 (42.23%), Postives = 485/772 (62.82%), Query Frame = 2
Query:  200 LIYGTNINITNIMESFRSFLLQFK---TEIPDE-----NFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRS--LCNNLIIYPKEVIPAMD-----CVADSLFKSNYVDFH-EPILT-----RPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQ--CQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLID--------------------EEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHN--KTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKG---QISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIRK 2371
            +I+GTN++I     +FR+FL+ FK    +I DE     N  TD     ++  YI+++ EM  L  + +N+D  +L  Y ++  L + L+ YP+EVI  MD     C+  SL   N +D+  + I T     RPYN    + +R LNP D+D+L+ + GLV+R + +IP+M  A FKC+VC++   V  +RG I +P  C +  C   ++  ++HN C F DKQ+IKLQE+P+ +P G+TPH++ L  Y +LVD+ + GDR+ VTG +R+   R NS+QRV+K+++KTY+DV+H +K  ++ +D                    EE  +++ + + +IR ++ + DLY  L+ +IAP+IY  E +KKG+L+ LFGG     K    G   R +I++LLCGDP TSKSQ+LQYV+ +TPRG YTSGKGSS VGLTAYIT+D +T    L+SGAL LSD G+CCIDEFDKM+D+TRSVLHEVMEQQ++SIAKAGII  L+AR+S+LA+ANPIGS ++    + ENI LPP LLSRFDL++L+LD  DE+ D +LA+H+  LY        ++   +    L  YI+YAK                E+IHPI++E A+  +   YV MRK+G+  +    +I+A  RQLES+IRLAEAHA+M+L + V + D  EA RL R A+K  A DP TG ID+N++ TG S   RK  E+L+R I  +L+++ + + S+  ++ ++   S   +     ++ L+ L+ E+K+    + +R+
Sbjct:  179 IIWGTNVSIQECTTNFRNFLMSFKYKFRKILDEREEFINNTTD-----EELYYIKQLNEMRELGTSNLNLDARNLLAYKQTEDLYHQLLNYPQEVISIMDQTIKDCMV-SLIVDNNLDYDLDEIETKFYKVRPYNVGSCKGMRELNPNDIDKLINLKGLVLRSTPVIPDMKVAFFKCNVCDHTMAVEIDRGVIQEPARCERIDCNEPNSMSLIHNRCSFADKQVIKLQETPDFVPDGQTPHSISLCVYDELVDSCRAGDRIEVTGTFRSIPIRANSRQRVLKSLYKTYVDVVHVKKVSDKRLDVDTSTIEQELMQNKVDHNEVEEVRQITDQDLAKIREVAAREDLYSLLARSIAPSIYELEDVKKGILLQLFGG---TNKTFTKGGRYRGDINILLCGDPSTSKSQILQYVHKITPRGVYTSGKGSSAVGLTAYITRDVDTKQLVLESGALVLSDGGVCCIDEFDKMSDSTRSVLHEVMEQQTISIAKAGIITTLNARSSILASANPIGSRYNPNLPVTENIDLPPPLLSRFDLVYLVLDKVDEKNDRELAKHLTNLYLEDKPEHISQDDVLPVEFLTMYISYAK----------------EHIHPIITEAAKTELVRAYVGMRKMGDDSRSDEKRITATTRQLESMIRLAEAHAKMKLKNVVELEDVQEAVRLIRSAIKDYATDPKTGKIDMNLVQTGKSVIQRKLQEDLSREIMNVLKDQASDSMSFNELIKQINEHSQDRVESSDIQEALSRLQQEDKVIVLGEGVRR 925          
BLAST of DNA helicase vs. Ensembl Yeast
Match: MCM7 (Component of the Mcm2-7 hexameric helicase complex; MCM2-7 primes origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation in S-phase; forms an Mcm4p-6p-7p subcomplex [Source:SGD;Acc:S000000406])

HSP 1 Score: 318.546 bits (815), Expect = 1.034e-96
Identity = 216/592 (36.49%), Postives = 323/592 (54.56%), Query Frame = 2
Query:  557 NLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVC--------NNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKA--VFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPG--TVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNA------GKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQR---EALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTLTFSYQRVLDELR 2269
            ++R +  + L QL+TV G++ R+S++ P +    + C  C        N+ T  P         E C+Q Q K    +     +F   Q  K+QE  + +P G  P ++ ++    LV ++ PGD V VTGI+  A     +  + +KA  + +TYL+    ++ K +          +ERV+E   L    D+Y RL+ +IAP IYGN  +KK LL++L        K++G G  +R +I+V L GDPG +KSQLL+ +  ++PRG YT+GKGSS VGLTA + KDP T    L+ GAL L+DNGICCIDEFDKM ++ R+ +HEVMEQQ++SI+KAGI   L+ARTS+LAAANP+   ++ + + ++NI LP  LLSRFD++FL+LD      D KLA H+  ++  HNK  +     V+ + +R+YIAYAK  R                 P++SE   +YV + Y+ +R+            GQ  A PR L  +IRL++A A++RL+D V + D  EA RL R   E+L Q                T  S        ++   I K+L+E    T SY+ ++  +R
Sbjct:  226 SVRQIKGDFLGQLITVRGIITRVSDVKPAVEVIAYTCDQCGYEVFQEVNSRTFTPLSE---CTSEECSQNQTKGQLFMSTRASKFSAFQECKIQELSQQVPVGHIPRSLNIHVNGTLVRSLSPGDIVDVTGIFLPAPY---TGFKALKAGLLTETYLEAQFVRQHKKKFASFSLTSDVEERVME---LITSGDVYNRLAKSIAPEIYGNLDVKKALLLLL---VGGVDKRVGDGMKIRGDINVCLMGDPGVAKSQLLKAICKISPRGVYTTGKGSSGVGLTAAVMKDPVTDEMILEGGALVLADNGICCIDEFDKMDESDRTAIHEVMEQQTISISKAGINTTLNARTSILAAANPLYGRYNPRLSPLDNINLPAALLSRFDILFLMLDIPSRDDDEKLAEHVTYVHM-HNKQPDLDFTPVEPSKMREYIAYAKTKR-----------------PVMSEAVNDYVVQAYIRLRQDSKREMDSKFSFGQ--ATPRTLLGIIRLSQALAKLRLADMVDIDDVEEALRLVRVSKESLYQE---------------TNKSKEDESPTTKIFTIIKKMLQETGKNTLSYENIVKTVR 770          
BLAST of DNA helicase vs. Ensembl Yeast
Match: MCM5 (Component of the Mcm2-7 hexameric helicase complex; MCM complex is important for priming origins of DNA replication in G1 and becomes an active ATP-dependent helicase that promotes DNA melting and elongation when activated by Cdc7p-Dbf4p in S-phase [Source:SGD;Acc:S000004264])

HSP 1 Score: 314.694 bits (805), Expect = 8.030e-96
Identity = 224/732 (30.60%), Postives = 357/732 (48.77%), Query Frame = 2
Query:  227 TNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFK-------------------SNYVDFHEPILTRPYNCEISRN-------LRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIID------PEFC-------------NQCQAKHTQQ--------IVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIK--------AVFKTYLDVLHFQKS-KNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGH-----NKTTEPGT-VDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRK------VGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRL-QREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELAR 2197
            T I++SF++F+L+F+    D  F+           Y  +++   L++   + ++  HL  Y+  +   L   P ++IP  +     + K                   +  +D    +L      ++  N       LR+L+ E + ++V ++G++I  S +          C  C + T +       I       P  C             +    + T++        I+H   +FID+Q +KLQE PE +P GE P  + + C + L + + PG RVT+ GIY   + +  +              A+   Y+ +L  Q   +   I       ++E   E   LS+ P LYE L+ +IAP+I+GNE IKK ++ +L GG     K L  G  +R +I+VLL GDPGT+KSQLL++V  ++P   YTSGKGSS  GLTA + +DP T    L+ GA+ L+D G+ CIDEFDKM D  R  +HE MEQQ++SIAKAGI   L++RTSVLAAANPI   +D+ K+  +NI    T+LSRFD+IF++ D  +E+ D  +A H++ ++ G+     N+  E G+ +    ++ YI Y ++                   P LS +A   ++  +V +RK      + +  +  I    RQLE++IR+ E+ A++ LS         EA RL Q   +  A+ DP+ GL   N  +      IR+  +EL R
Sbjct:   25 TEIIKSFKNFILEFRL---DSQFI-----------YRDQLRNNILVKNYSLTVNMEHLIGYNEDIYKKLSDEPSDIIPLFETAITQVAKRISILSRAQSANNNDKDPENTSMDTDSLLLNSLPTFQLILNSNANQIPLRDLDSEHVSKIVRLSGIIISTSVLSSRATYLSIMCRNCRHTTSITINNFNSITGNTVSLPRSCLSTIESESSMANESNIGDESTKKNCGPDPYIIIHESSKFIDQQFLKLQEIPELVPVGEMPRNLTMTCDRYLTNKVIPGTRVTIVGIYSIYNSKNGAGSGRSGGGNGGSGVAIRTPYIKILGIQSDVETSSIWNSVTMFTEEEEEEFLQLSRNPKLYEILTNSIAPSIFGNEDIKKAIVCLLMGG---SKKILPDGMRLRGDINVLLLGDPGTAKSQLLKFVEKVSPIAVYTSGKGSSAAGLTASVQRDPMTREFYLEGGAMVLADGGVVCIDEFDKMRDEDRVAIHEAMEQQTISIAKAGITTVLNSRTSVLAAANPIYGRYDDLKSPGDNIDFQTTILSRFDMIFIVKDDHNEERDISIANHVINIHTGNANAMQNQQEENGSEISIEKMKRYITYCRL----------------KCAPRLSPQAAEKLSSNFVTIRKQLLINELESTERSSIPITIRQLEAIIRITESLAKLELSPIAQERHVDEAIRLFQASTMDAASQDPIGGL---NQASGTSLSEIRRFEQELKR 720          
BLAST of DNA helicase vs. Ensembl Yeast
Match: MCM2 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; relative distribution to the nucleus increases upon DNA replication stress [Source:SGD;Acc:S000000119])

HSP 1 Score: 283.878 bits (725), Expect = 1.097e-83
Identity = 199/668 (29.79%), Postives = 320/668 (47.90%), Query Frame = 2
Query:  233 IMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDF---HEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVT----KVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKL-----SQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHN-------------------------------------------KTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEA 2071
            I    +SFLL++  E                 +Y  +++ +  +    + ++  HLA+    L   L   P+E++   D VA    + +Y D+   H  I  R  +     +LR L   +L  LV V G+V R + + P++    F C  C ++     +   E  RI    FC  C++K   ++      + + Q + LQE+P  +P G  P    +    DLVD  +PG+ V VTGIY+  +   N   +    VF T ++    ++ +    +E E  L     ++E   E R +S+   + +++  ++AP+IYG+  IK  +   LFGG     K +    ++R +I+VLL GDPGT+KSQ+L+YV     R  + +G+G+S VGLTA + KDP T   TL+ GAL L+D G+C IDEFDKM D  R+ +HE MEQQS+SI+KAGI+  L AR S++AAANP G  +++   + +N+ L   +LSRFD++ ++ D  DE+ D +LA  +V  +   +                                           K  E   +   +L  YI YA+                  I+P L +   + V+  Y ++R+  +   G      R LES++R+AE+ A+MRLS+ V+  D   A
Sbjct:  207 IARELKSFLLEYTDET-------------GRSVYGARIRTLGEMNSESLEVNYRHLAESKAILALFLAKCPEEMLKIFDLVAMEATELHYPDYARIHSEIHVRISDFPTIYSLRELRESNLSSLVRVTGVVTRRTGVFPQLKYVKFNCLKCGSILGPFFQDSNEEIRI---SFCTNCKSKGPFRVNGEKTVYRNYQRVTLQEAPGTVPPGRLPRHREVILLADLVDVSKPGEEVEVTGIYKN-NYDGNLNAKNGFPVFATIIEANSIKRREGNTANEGEEGLDVFSWTEEEEREFRKISRDRGIIDKIISSMAPSIYGHRDIKTAVACSLFGGV---PKNVNGKHSIRGDINVLLLGDPGTAKSQILKYVEKTAHRAVFATGQGASAVGLTASVRKDPITKEWTLEGGALVLADKGVCLIDEFDKMNDQDRTSIHEAMEQQSISISKAGIVTTLQARCSIIAAANPNGGRYNSTLPLAQNVSLTEPILSRFDILCVVRDLVDEEADERLATFVVDSHVRSHPENDEDREGEELKNNGESAIEQGEDEINEQLNARQRRLQRQRKKEEEISPIPQELLMKYIHYART----------------KIYPKLHQMDMDKVSRVYADLRR-ESISTGSFPITVRHLESILRIAESFAKMRLSEFVSSYDLDRA 837          
BLAST of DNA helicase vs. Ensembl Yeast
Match: MCM6 (Protein involved in DNA replication; component of the Mcm2-7 hexameric helicase complex that binds chromatin as a part of the pre-replicative complex; forms a subcomplex with Mcm4p and Mcm7p [Source:SGD;Acc:S000003169])

HSP 1 Score: 279.641 bits (714), Expect = 3.320e-81
Identity = 151/356 (42.42%), Postives = 223/356 (62.64%), Query Frame = 2
Query: 1055 LSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYP---RQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAID 2113
            LS + + E++ + +   +Y++L  +IAP ++G+E +KKG+L+ + GG  K T +   G  +R +I++ + GDP TSKSQ L+YV    PR  YTSGK SS  GLTA + +D E G  T+++GAL L+DNGICCIDEFDKM  + +  +HE MEQQ++SIAKAGI   L+ARTS+LAAANP+G  ++ K ++  N+ +   ++SRFDL F+ILD  +E+ D +LA HIV L+   ++  EP       LR YI YA+                    PIL++EA +Y+ E+Y E+RK    G  + S+Y    RQLES+IRL+EA AR    D++T +   EA  L R+++ +  +D
Sbjct:  508 LSSDEINELKEMVKDEHIYDKLVRSIAPAVFGHEAVKKGILLQMLGGVHKSTVE---GIKLRGDINICVVGDPSTSKSQFLKYVVGFAPRSVYTSGKASSAAGLTAAVVRDEEGGDYTIEAGALMLADNGICCIDEFDKMDISDQVAIHEAMEQQTISIAKAGIHATLNARTSILAAANPVGGRYNRKLSLRGNLNMTAPIMSRFDLFFVILDDCNEKIDTELASHIVDLHMKRDEAIEP-PFSAEQLRRYIKYART-----------------FKPILTKEARSYLVEKYKELRKDDAQGFSR-SSYRITVRQLESMIRLSEAIARANCVDEITPSFIAEAYDLLRQSIIRVDVD 841          

HSP 2 Score: 78.1814 bits (191), Expect = 3.295e-15
Identity = 37/133 (27.82%), Postives = 68/133 (51.13%), Query Frame = 2
Query:  536 YNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFC--NQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGI 928
            +N      +R++  E +  L++++G V R SE+ PE+ KA F C +C  +     +  +  +P FC    C+ +    +      F+D Q +++QE+  ++P G  P T+ +    D V+  +PGDR   TG+
Sbjct:  268 FNLPTVHRIRDIRSEKIGSLLSISGTVTRTSEVRPELYKASFTCDMCRAIVDNVEQSFKYTEPTFCPNPSCENRAFWTLNVTRSRFLDWQKVRIQENANEIPTGSMPRTLDVILRGDSVERAKPGDRCKFTGV 400          
BLAST of DNA helicase vs. Ensembl Nematostella
Match: EDO35060 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMI2])

HSP 1 Score: 327.02 bits (837), Expect = 1.641e-99
Identity = 211/614 (34.36%), Postives = 322/614 (52.44%), Query Frame = 2
Query:  329 LYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKS---NYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERG--RIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYR----AASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAM----------------LRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREAL 2095
            +Y +K+++M    +  + ID + LA   + L   L   P E++   D  A  +  +   NY      I  R     +   LR+L    ++QL+   G+V   + I+P++    + C  C+ +   P  +G  + + P  C +CQ++   +I      + + Q IK+QESP  + AG  P    +    DLVD+ +PGD + +TGIY+    ++  R N        VF T ++     K  +++       L+ E +  I ALS+   + ER+  +I P+IYG+E IK+ L + LFGG  K+    G    +R +I+VLLCGDPGT+KSQ L+YV    PR  +T+G+G+S VGLTAY+ + P T   TL++GAL L+D G+C IDEFDKM D  R+ +HE MEQQS+SI+KAGI+  L AR S+LAAANPIG  +D   T  EN+ L   +LSRFD++ ++ D  D   D  LAR +V  +  H+  T P   D  M                L+ Y+ YA+                E +HP L+   ++ V + + ++RK   A  G I    R +ES+IR+AE+HA+M L + V   D   A R+  E+ 
Sbjct:  138 VYREKIRQMCEANKQSLVIDYNILANEQQVLAYFLPEAPTEMLQIFDEAAKEVVLAMFPNYDRITTEIHVRIAELPLMEELRSLRQLHVNQLIRTGGVVTSSTGIMPQLSVIKYDCPKCSFILG-PFFQGSDQEVKPGSCPECQSRGPFEINMEQTLYQNYQKIKIQESPSKVAAGRLPRYKDVILMADLVDSCKPGDEIELTGIYKINYDSSLNRSNGF-----PVFATIIEANFITKQDDKM---AVTSLTDEDIKAINALSKDERIGERIIASIGPSIYGHEDIKRALALSLFGGVAKDP---GGKHKIRGDINVLLCGDPGTAKSQFLKYVEKTAPRAVFTTGQGASAVGLTAYVQRHPVTKEWTLEAGALVLADKGMCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCSILAAANPIGGRYDPSLTFAENVDLTEPILSRFDILCVVRDTVDAIQDELLARFVVNSHVRHHPNT-PENEDEDMEVHMFTLRRNAIPQDLLKKYMIYAR----------------ERVHPRLNNMDQDKVAKMFADLRKESMA-TGSIPITVRHIESMIRMAESHAKMHLREYVMEDDVNMAIRVMLESF 721          
BLAST of DNA helicase vs. Ensembl Nematostella
Match: EDO48453 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIT1])

HSP 1 Score: 311.997 bits (798), Expect = 9.164e-95
Identity = 215/633 (33.97%), Postives = 331/633 (52.29%), Query Frame = 2
Query:  332 YIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPY-NCEISR-------NLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNN-VTKVPCERGRIIDPEFCNQCQAKHTQQ---------IVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIY--RAASQRENSKQRVIK-AVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEP--GTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGN------AGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRL-QREALKQAAIDPLTGLIDIN 2140
            Y  ++K+   L + ++ +D   L+ +D +L + L   P E +P  +  A  +  ++ V    PI      + +I+         +R L  E +  LV + G++I  S I  +      +C  C N ++ +P + G +       +C    T +         I+ + C+ +D Q++KLQESP+ +P GE P  + LYC + L + + PG+RVTV GIY  +  +Q+ N ++  I   + K YL V+              A ++     E R L+ +PD+ + ++ +IAP+IYG+  IKK +  +LFGG     K+L  G   R +I+VLL GDPGT+KSQLL++V  ++P G YTSGKGSS  GLTA + +DP + +  ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R +VLAAAN +   WD+ K   +NI   PT+LSRFD IF++ D  ++  D  LA+H++ ++    +TT+   G +  + L+ YI+Y K                    P LSE A   +   YV MR            K  I    RQLE++IR++E+ A+M LS   T     EA RL Q   L  A    L G  D  
Sbjct:   51 YRDQLKQHYNLGQYYLEVDLEDLSSFDENLADKLRKNPSEYLPLFETAAKEV--ADEVTRPRPIGEEEVQDVQITLRSGANPFQIRELRSEHMAALVKIPGIIISASSIRSKATNITIQCRSCQNTISSIPLKPG-LEGYAMPRKCPTDQTGRPPCPLDPFFIMPDKCKCVDFQVLKLQESPDAVPNGEMPRHMQLYCDRYLTERVVPGNRVTVIGIYSIKKVAQKANKERDAIGVGIRKPYLRVVGIYVDTEGPGRSTGAPMNPADEEEFRRLATRPDVADVIARSIAPSIYGSVDIKKCIACLLFGG---SRKRLPDGLTRRGDINVLLLGDPGTAKSQLLKFVEKVSPIGVYTSGKGSSAAGLTASVMRDPVSRNFVMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCAVLAAANSVFGRWDDTKG-DQNIDFMPTILSRFDTIFIVKDEHNQAKDIHLAKHVMQVHLNAAQTTQANEGELSLSFLKKYISYCK----------------SKCGPRLSESAAEKLKNRYVLMRSGAKEHERDTEKKISIPITVRQLEAIIRISESLAKMSLSPFATETHVDEALRLFQVSTLDAAMSGSLAGASDFT 660          
BLAST of DNA helicase vs. Ensembl Nematostella
Match: EDO37946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SEF9])

HSP 1 Score: 309.301 bits (791), Expect = 7.268e-94
Identity = 197/519 (37.96%), Postives = 286/519 (55.11%), Query Frame = 2
Query:  557 NLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIID-----PEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEA--KLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGT----VDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRL 2080
            ++RN+  + + +L  V G+V+R +E+ P +  A + C  C   +    +    +       E C   +A     +     +F+  Q +K+QE  + +P G  P ++ +    +      PGD V+VTGI+     +   +Q     +  T+L+  H     N+  D+E     LS E   EIRALS + D Y++L+ ++AP IYG+E IKK LL++L    V        G  +R NI++LL GDPG +KSQ+L Y+  L PR QYT+G+GS+ VGLTA + KDP TG   L+ GAL L+D G+CCIDEFDKM D  R+ +HEVMEQQ++SIAKAGI+  L+AR S+LAAANP    ++ KK+  +NIQLP  LLSRFDL++LI D  D++ D +LA+HI  +   H  +  P +    +D  ++R YIA  K                    PI+  E  +Y+   YVEMRK             R L +++RLA A AR+RL+D V   D  EA RL
Sbjct:  147 SVRNVKADCIGKLTVVRGIVMRCTEVKPVVEVATYTCDQCGAESYQTIQSQTFMPLLMCPSEECKTNRAGGRLYLQTRGSKFVKFQELKIQEHSDQVPVGHIPRSMTIIAKGENTRLATPGDHVSVTGIF-LPMMKTGFRQMTQGLLSDTFLEA-HRIVRMNKTEDDEMPTDDLSDE---EIRALSTEADFYDKLASSLAPEIYGHEDIKKALLLLL----VGGVDCTPHGMKIRGNINILLMGDPGVAKSQMLSYIDRLAPRSQYTTGRGSTGVGLTAAVMKDPLTGEMILEGGALVLADKGVCCIDEFDKMMDGDRTAIHEVMEQQTVSIAKAGIMTTLNARVSILAAANPAYGRYNPKKSAEQNIQLPAALLSRFDLLWLIQDKPDKENDLRLAQHITYV---HQHSAHPPSHYDPLDMNLMRRYIAACK-----------------EKQPIVPGELSDYIVSAYVEMRKDARNNHDTTFTSARTLLAVLRLATALARLRLADVVEKEDVNEAMRL 636          
BLAST of DNA helicase vs. Ensembl Nematostella
Match: EDO34425 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPE9])

HSP 1 Score: 284.263 bits (726), Expect = 5.716e-84
Identity = 180/557 (32.32%), Postives = 282/557 (50.63%), Query Frame = 2
Query:  563 RNLNPEDLDQLVTVNGLVIRLSEIIPEMIKA-HF----KCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLY----------------------------------------------CGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYP---RQLESLIRLAEAHARMRLSDQVTVADCLEA 2071
            R+L+   +  +V V G+V + S + P+++++ H+    K ++    T +           +  + +  +  +  +  C + D Q   +QE PE  PAG+ P +V +    DLVD  +PGDRV V G YR    + +         F+T L V + Q     +     A    +     +    K D++E L+ ++AP+I+G+E IKK +L +L GG     K L  G  +R +I++LL GDP T+KSQ+L+YV +  PR   T+G+GSS VGLTA +T DPETG   L++GA+ L+D G+ CIDEFDKM+D  R+ +HEVMEQ  ++I+KAGI  +L+AR SVLAAANP+   +D  K  ++NI +  +LLSRFDL+F++LD  D   D +++ H++ ++                                               G  K  +   V  A ++ YI  AK                  I P L++ A + +++ Y E+R   N G  +    P   R LE++IRL+ AHA+ R+S  +T  D   A
Sbjct:  111 RSLSSRYIGSMVCVEGIVTKCSLVRPKVVRSVHYCPKTKKTLIRKYTDMTSLEAVPTSSVYPTKDEDGNPLETEYGLCTYKDHQTFTIQEMPERAPAGQLPRSVDIIADNDLVDKCKPGDRVQVIGTYRCLPSKRSG---FTSGTFRTVLIVNNVQVMSKEVAPNFSA---SDISKIKKFSKSKQDVFEVLAKSLAPSIHGHEFIKKAVLCLLLGG---TEKVLENGTRLRGDINILLIGDPSTAKSQMLRYVLHSAPRAIPTTGRGSSGVGLTAAVTTDPETGDRRLEAGAMVLADRGVVCIDEFDKMSDIDRTAIHEVMEQGRVTISKAGIHAKLNARCSVLAAANPVFGRYDEFKNPMDNIGMQDSLLSRFDLLFIVLDQMDPDNDRRISEHVLRIHRYRKPGEQEGEALPFGEESDVLATRDPDQEEEDEDTPVYEKHDPMLFGKQKDKKDKFVSMAFMKKYIHVAKA-----------------IKPALTKPAADLISKAYSELRDQENIGNDKAKTTPVTARTLETMIRLSTAHAKARMSKTITEGDAQAA 641          
BLAST of DNA helicase vs. Ensembl Nematostella
Match: EDO33971 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQR1])

HSP 1 Score: 284.648 bits (727), Expect = 6.033e-84
Identity = 180/550 (32.73%), Postives = 295/550 (53.64%), Query Frame = 2
Query:  560 LRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQ--CQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTG-------IYRAAS--------QRENSKQ-------RVIKAV------FKTYLDVLHFQKSKNRLIDEE-----------EAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAG--KGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRL 2080
            +R L  + +  L+ ++G V+R   + PE++ A F C  C  V K   ++ +   P  C    CQ +    +  N   ++D Q +++QE+  ++P G  P +V +    + V+  Q GD+   TG       I + A+        QR+ S +       R +KA+      ++        Q +  R   ++           + +++ +   +I  +S+  +LY+ +  +I PTI+GN+ +K+G+L+MLFGG  K+T +     ++R +I++ + GDP T+KSQ L++V   + R  YTSGK SS  GLTA + KD E+    +++GA+ L+DNG+CCIDEFDKM    +  +HE MEQQ++S+ KAG+   L+ARTSVLAAANPIG  +D  K++ +N+ +   ++SRFDL F+++D  +E  D  +AR IV L+    ++ E         R Y A  +V R  L F R          P +++EA++Y+ E+Y  +R+   +   K       RQLES+IRL+EA AR+   D+V      EA RL
Sbjct:  117 IRELTSQKIGSLLRISGQVVRTHPVHPELVTATFTCLDCQTVIKDVEQQFKYTQPTVCRNPICQNRARFALDINKSRYVDFQKVRIQETQAELPRGCIPRSVEVILRAEAVEQAQAGDKCDFTGTLIVVPDIAQLATPGTRSETGQRQTSGEGYEAEGVRGLKALGVRDLTYRLSFLACSVQATNPRFGGKDLDGDDMTAEAIKKQMTPQEWQKIYEMSRDKNLYQNIINSIFPTIHGNDEVKRGVLLMLFGGVPKKTLE---KTSLRGDINICVVGDPSTAKSQFLKHVEEFSARAVYTSGKASSAAGLTAAVVKDEESSEFVIEAGAMMLADNGVCCIDEFDKMDPRDQVAIHEAMEQQTISLTKAGVKASLNARTSVLAAANPIGGRYDRTKSLKQNLNMSAPIMSRFDLFFILVDECNEVVDYAIARRIVDLHSRREQSVE---------RVY-AVDEVQRY-LTFAR-------QFKPTITKEAQDYMVEQYKHLRERDGSSTTKSAWRITVRQLESMIRLSEAMARLYCQDKVEPKHVKEAYRL 645          
BLAST of DNA helicase vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 800.431 bits (2066), Expect = 0.000e+0
Identity = 397/736 (53.94%), Postives = 526/736 (71.47%), Query Frame = 2
Query:  194 QNL-IYGTNINITNIMESFRSFLLQF--KTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIR 2368
            QNL I+GT++N+    E F+ FL +F   T   DEN   D+    ++PLY+QK++E+S++    +N++C H+  +D  L   LI YP+EVIP  D   + LF   + D      I  RPYN   ++N+RNLNPED+DQL+T+ G+VIR S++IPEM +A F+C VC    +V  +RGRI +P  C  C   H+  +VHN   F DKQMIK+QESPEDMPAG+TPHT +LY + DLVD +QPGDRV +TGIYRA   R + +Q  +++V+KT++D +HF+K+  + +     D E+   +++RV  ++ L+ KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+  + G G N R+ +++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM+D TRSVLHEVMEQQ+LSIAKAGIICQL+ART+VLAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIAYA+                  I P LSEEA   + E YV+MRK+G +G+G +SAYPRQLESLIRLAEAHA++R S++V   D  EA+RL REALKQ+A DP TG +DI+ILTTG+S   RKR EE+A+A+ KL++ + +T    YQ++L++LR QS+  IT+++F++ L  L  E+ +  T KT+R
Sbjct:  107 QNLVIWGTDVNVGTCKEKFQRFLQRFIDPTSTEDENAGLDL----NEPLYMQKLEEISVVGDPVLNVNCRHVQSFDAELYRQLICYPQEVIPTFDMAVNELFFERFPDSVLEYQIQVRPYNALKTKNMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCAFSARVEVDRGRIAEPAVCRNCNNTHSMTLVHNRSVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQSNVRSVYKTHIDAIHFRKTDEKRLHGLDQDGEQKLFTEDRVQTLKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRG-NFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQMEEEFLDMAVLKDYIAYART----------------YISPRLSEEASQALIEAYVDMRKIG-SGRGMVSAYPRQLESLIRLAEAHAKVRFSEKVETIDVEEAKRLHREALKQSATDPRTGFVDISILTTGMSATARKRKEEVAQALKKLIQAKGKTPAMKYQQLLEDLRGQSETAITKELFDEALRALADEDYLTVTGKTVR 820          
BLAST of DNA helicase vs. Ensembl Medaka
Match: mcm4 (minichromosome maintenance complex component 4 [Source:NCBI gene;Acc:101173977])

HSP 1 Score: 780.015 bits (2013), Expect = 0.000e+0
Identity = 388/711 (54.57%), Postives = 510/711 (71.73%), Query Frame = 2
Query:  194 QNL-IYGTNINITNIMESFRSFLLQF--KTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVD--FHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLI-----DEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER-RTLTFSYQRVLDELRNQSDRMIT 2293
            QNL I+GT++N+    E F+ FL +F   T   DEN   D+    ++PLY+QK++E+S++    +N++C H+  +D  L   LI YP+EVIP  D   + LF   + D      I  RPYN   ++N+RNLNPED+DQL+T+ G+VIR S++IPEM +A F+C VC    +V  +RGRI +P  C  C   H+  +VHN   F DKQMIK+QESPEDMPAG+TPHT +LY + DLVD +QPGDRV +TGIYRA   R + +Q  +++V+KT++D +HF+K+  + +     D E+   +++RV  ++ L+ KPD+YERL+ A+AP+IY +E IKKG+L+ LFGG  K+  + G G N R+ +++LLCGDPGTSKSQLLQYVYNL PRGQYTSGKGSS VGLTAY+ KDPET    LQ+GAL LSDNGICCIDEFDKM+D TRSVLHEVMEQQ+LSIAKAGIICQL+ART+VLAAANP+ S W+ KKT IENIQLP TLLSRFDLIFL+LDPQDE YD +LA H+V LY    +  E   +D A+L+DYIAYA+                  I P LSEEA   + E YV+MRK+G +G+G +SAYPRQLESLIRLAEAHA++R S++V   D  EA+RL REALKQ+A DP TG +DI+ILTTG+S   RKR EE+A+A+ KL++ + +T    YQ++L++LR QS+ + T
Sbjct:  143 QNLVIWGTDVNVGTCKEKFQRFLQRFIDPTSTEDENAGLDL----NEPLYMQKLEEISVVGDPVLNVNCRHVQSFDAELYRQLICYPQEVIPTFDMAVNELFFERFPDSVLEYQIQVRPYNALKTKNMRNLNPEDIDQLITLGGMVIRTSQLIPEMQEAFFQCQVCAFSARVEVDRGRIAEPAVCRNCNNTHSMTLVHNRSVFSDKQMIKIQESPEDMPAGQTPHTTILYAHNDLVDKVQPGDRVNITGIYRAVPMRVHPRQSNVRSVYKTHIDAIHFRKTDEKRLHGLDQDGEQKLFTEDRVQTLKELAAKPDVYERLASALAPSIYEHEDIKKGILLQLFGGTRKDFSQTGRG-NFRAEVNILLCGDPGTSKSQLLQYVYNLVPRGQYTSGKGSSAVGLTAYVMKDPETRQLVLQTGALVLSDNGICCIDEFDKMSDNTRSVLHEVMEQQTLSIAKAGIICQLNARTAVLAAANPVESQWNPKKTTIENIQLPHTLLSRFDLIFLMLDPQDEAYDRRLAHHLVSLYYQSEEQMEEEFLDMAVLKDYIAYART----------------YISPRLSEEASQALIEAYVDMRKIG-SGRGMVSAYPRQLESLIRLAEAHAKVRFSEKVETIDVEEAKRLHREALKQSATDPRTGFVDISILTTGMSATARKRKEEVAQALKKLIQAKGKTPAMKYQQLLEDLRGQSETVRT 831          
BLAST of DNA helicase vs. Ensembl Medaka
Match: mcm5 (minichromosome maintenance complex component 5 [Source:NCBI gene;Acc:101167880])

HSP 1 Score: 349.747 bits (896), Expect = 1.996e-108
Identity = 237/697 (34.00%), Postives = 356/697 (51.08%), Query Frame = 2
Query:  230 NIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIP----AMDCVADSLFKSNYV------DFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCN----NVTKVPCERGRIIDPEFCNQCQAKHTQ------QIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIY---RAASQRENSKQRVIK-AVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTE--PGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYP------RQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEER 2224
             I + FR FL QF+       F            Y  ++K    L   W+ ++   LA +D  L + L   P E +P    A   VAD + +   V      D    + +  ++  I    RNL  E + +LV V+G++I  + +  +  K   +C  C     N+   P  +G  + P  CN   A   +       I+ + C  +D Q ++LQESP+ +P GE P  + LYC + L D + PG+RVT+ GIY   + A+ +   K++ I   +  +YL V+  Q             +S +   E+RALS  P++Y  L+ ++AP+IYG++ +KK +  +LFGG     K+L  G   R +I++L+ GDPGT+KSQLL++V   +P G YTSGKGSS  GLTA + +DP T    ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD+ K   +NI   PT+LSRFD+IF+I D  D+Q D  LARH++ ++      TE   G +  A  + YIAYA+                    P LS  A   +   YV MR      + +    P      RQLE++IR+AE+ A+M+L       +  EA RL + +   AA   L+G +      +GV G   + ++E+   I K L+ R
Sbjct:   46 QIKKRFREFLRQFREGTDQTGFTYK---------YRDELKRHYTLGEFWLEVEVEDLASFDEDLSDCLYKLPTENLPLLEEAAKEVADEVTRPRPVGEEAVQDIQVMLKSDAHHTSI----RNLKSEQVSRLVKVHGIIISATAVKAKATKVCLQCRGCRSVIPNIPLPPGLQGYAL-PRKCNSENAGRVKCPMDPYFIIPDRCVCVDFQTLRLQESPDAVPHGEMPRHLQLYCDRYLCDRVVPGNRVTIMGIYSIKKMAAVKAKGKEKGIGVGIRSSYLRVVGIQVDTEGAGRGATGPVSAQEEEELRALSTSPNIYSSLAQSLAPSIYGSDDLKKAITCLLFGG---SRKRLPDGLTRRGDINLLMLGDPGTAKSQLLKFVERCSPIGVYTSGKGSSAAGLTASVLRDPSTRGFIMEGGAMVLADGGVVCIDEFDKMREDDRVAIHEAMEQQTISIAKAGITTTLNSRCSVLAAANSVYGRWDDTKG-EDNIDFMPTILSRFDMIFIIKDHHDQQRDMTLARHVMNVHLSAQTQTEGVEGEIPLATFKKYIAYARA----------------KCGPRLSAAAAEKLKNRYVVMRSGAREHERESDKRPSIPITVRQLEAVIRIAESLAKMKLQAVAGEEEVDEALRLFQVSTLDAA---LSGSL------SGVEGFTSQEDQEMVSRIEKQLKRR 699          
BLAST of DNA helicase vs. Ensembl Medaka
Match: mcm7 (minichromosome maintenance complex component 7 [Source:NCBI gene;Acc:101165815])

HSP 1 Score: 331.257 bits (848), Expect = 1.041e-101
Identity = 205/528 (38.83%), Postives = 300/528 (56.82%), Query Frame = 2
Query:  530 RPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFC--NQCQAKHTQQIVH---NCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEA--KLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGT----VDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRL 2080
            +P +   S+ +R++  + + QLVTV G+V R +E+ P M  A + C  C   T  P +    +    C   +C    +   ++      +F+  Q +++QE  + +P G  P ++ +Y   +     QPGD V +TG++     R    Q +   + +TYL+  H     N+  D+E A  +LS E   E+R+++++   YE+L+G+IAP IYG+E +KK LL++L GG  +  K    G  +R +I++ L GDPG +KSQLL Y+  L PR QYT+G+GSS VGLTA + +DP TG  TL+ GAL L+D G+CCIDEFDKM D  R+ +HEVMEQQ++SIAKAGI+  L+AR S+LAAANP    ++ +K+I  NIQLP  LLSRFDL++LI D  D   D +LA+HI  +   H    +P T    +D  ++R YIA  K                    P++ E   +Y+T  YVEMRK     K       R L S++RL+ A AR+R+ D V   D  EA RL
Sbjct:  139 KPASTSKSKVVRDIRADSIGQLVTVRGIVTRATEVKPMMAVATYTCDQCGAETYQPIQSPSFMPLIMCPSQECVTNKSGGRLYLQTRGSKFVKFQELRIQEHSDQVPVGNIPRSMTVYARGENTRLAQPGDHVAITGVFLPL-LRSGYSQAIQGLLSETYLEA-HNITLMNKTEDDELATEELSDE---ELRSITEE-GFYEKLAGSIAPEIYGHEDVKKALLLLLVGGVEQAPK----GMKIRGSINICLMGDPGVAKSQLLSYIDRLAPRSQYTTGRGSSGVGLTAAVMRDPLTGEMTLEGGALVLADLGVCCIDEFDKMADADRTAIHEVMEQQTISIAKAGIMTSLNARCSILAAANPAYGRYNPRKSIEANIQLPAALLSRFDLLWLIQDKPDADADLRLAQHITYV---HQHCRQPPTHFTPIDMKLMRRYIALCK-----------------KRQPVVPEALADYITAAYVEMRKEARVSKDTTFTSARTLLSILRLSTALARLRMMDTVEKEDVNEAMRL 636          
BLAST of DNA helicase vs. Ensembl Medaka
Match: mcm2 (minichromosome maintenance complex component 2 [Source:NCBI gene;Acc:101173930])

HSP 1 Score: 330.102 bits (845), Expect = 1.006e-99
Identity = 211/610 (34.59%), Postives = 324/610 (53.11%), Query Frame = 2
Query:  329 LYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDF----HEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCE-RGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTE-----------PGTVDTA-----MLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREAL 2095
            ++ +K+ +M    +  + ++   LA  +  L   L   P E++   D  A  +  + Y  +    HE I  R  N  +   +R L    L+QL+  +G+V   + ++P++    + CS C+ V     + + + + P  C +CQ++   ++      + + Q I +QESP  + AG  P +       DLVD+ +PGD + +TGIY        +       VF T +   H  +    +     A+L+ E V  I ALS+   + ER+  ++AP+IYG+E IK+ L + LFGG   E K  G    +R +I+VLLCGDPGT+KSQ L+YV  +  R  +T+G+G+S VGLTAY+ + P +   TL++GAL L+D G+C IDEFDKM D  R+ +HE MEQQS+SI+KAGI+  L AR +V+AAANPIG  +D   T  EN+ L   ++SRFD++ ++ D  D   D  LAR +VG +  H+ +T+           P T D +     +LR YI YAK                E +HP L++  ++ V   Y ++RK   A  G I    R +ES+IR+AEAHA+M L D V   D   A R+  E+ 
Sbjct:  202 VFKEKISDMCKENKESLVVNYEDLAAREHVLAYFLPEAPAEMLKVFDEAAKEVVLAMYPKYDRIAHE-IHVRVSNLPLVEEIRALRQLHLNQLIRTSGVVSCCTGVLPQLSMVKYNCSKCSFVLGPFFQSQNQEVKPGSCPECQSQGPFEVNMEETVYQNYQRITIQESPGKVAAGRLPRSKDAILLADLVDSCKPGDEIELTGIYHNNYDGSLNMANGF-PVFATVILANHISRRDEGVA---VAELTDEDVKAIVALSKDECIGERIFASVAPSIYGHEDIKRALALSLFGG---EPKNPGGKHKVRGDINVLLCGDPGTAKSQFLKYVEKVASRAVFTTGQGASAVGLTAYVQRHPVSREWTLEAGALVLADRGVCLIDEFDKMNDADRTSIHEAMEQQSISISKAGIVTSLQARCTVMAAANPIGGRYDPSLTFAENVDLTEPIVSRFDVLCVVRDTVDPVQDEMLARFVVGSHIKHHPSTKEGGVALEEMVLPNTTDVSPIPQDLLRKYIIYAK----------------ERVHPKLNQMDQDKVARIYSDLRKESMA-TGSIPITVRHIESMIRMAEAHAKMHLRDYVLEDDVNMAIRVMLESF 786          
BLAST of DNA helicase vs. Planmine SMEST
Match: SMESG000060238.1 (SMESG000060238.1)

HSP 1 Score: 1558.5 bits (4034), Expect = 0.000e+0
Identity = 770/788 (97.72%), Postives = 772/788 (97.97%), Query Frame = 2
Query:   11 MSNLNEASDVLIAGLRSSDIXXXXXXXXXXXXXXVNSTTLRPGVNDDYGTTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIRKR 2374
            MSNLNEASDVLIAGLRSSDIDGDSLSYTDLSSLDVNSTTLRPGVNDDYGTTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAW+NIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQM+KLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAK                ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIRKR
Sbjct:    1 MSNLNEASDVLIAGLRSSDIDGDSLSYTDLSSLDVNSTTLRPGVNDDYGTTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFVTDIRFNPDDPLYIQKMKEMSLLRRAWMNIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAKHTQQIVHNCCEFIDKQMVKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAK----------------ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTLTFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIRKR 772          
BLAST of DNA helicase vs. Planmine SMEST
Match: SMESG000038798.1 (SMESG000038798.1)

HSP 1 Score: 325.865 bits (834), Expect = 3.315e-99
Identity = 206/642 (32.09%), Postives = 328/642 (51.09%), Query Frame = 2
Query:  320 DDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEIS-----RNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCN--QCQAKHTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTG---IYRAASQRENSKQRVIKA------------------------VFKTYLDVLHFQKSKNRLIDEEE-------------AKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAM-----LRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAY---PRQLESLIRLAEAHARMRLSDQVTVADCLEARRL 2080
            D+  Y++  K+M+ L + ++ +    L  YD  L  ++++    + P + C A  +F +   D  E    R Y C         NLRNL   +L +LV   G VIR   + PE++   FKC  C  V K   ++     P  C   QC  +   +++    +++D Q +++QE+  ++P G  P  + +    + V+  QPGD+   TG   I    SQ      R ++                          ++      H     N+ +  E+              KL+++ V ++  ++Q P+L + +   + PT YGN+ +K+GLL+MLFGG  K T++   G  +R +I++ + GDP T+KSQ L+ +   +PR  YTSGK SS  GLTA + +D E+G   +++GAL L++NG+CCIDEFDKM    +  +HE MEQQ++S+ KAGI   L+A+TSVLAAANP+G  +D  +++ +NI L   ++SRFDL F+++D   EQ D ++A+ I        +  +P   DT +     ++ YI +A+                    P ++EEA   +  EY +MR+  +A  G  SA+    RQLESL+RL+EA ARMR SD V   D +EA RL
Sbjct:   36 DEFKYVENAKKMTSLEKMFLGVSFKDLMTYDSGLSQDIMLNFYRLYPFL-CQATQIFINKQFDETENN-DRTYTCHFIDFPTLTNLRNLRMGNLGKLVKFRGQVIRSHGVHPELVLGTFKCQDCGTVVKNIEQQFIFTKPTICGNPQCMNRLKFELIPEQSKYVDFQKVRVQETQNELPRGCIPRCMDVILRNETVENAQPGDQSEFTGSLIIIPDISQLTTPGSRTLETKQIKLSEGYDSGVTGLKELGVRDLTYRMAFLANHVATVNNKYLQTEDMNEEGELTYDSLMKKLTEQEVNKVLTMNQDPNLVKNMCDCLFPTTYGNDEVKRGLLLMLFGGVPKVTEE---GTKLRGDINICIVGDPSTAKSQFLKRIAGFSPRAVYTSGKASSAAGLTAAVVRDQESGEFVIEAGALMLANNGVCCIDEFDKMEVRDQVAIHEAMEQQTISLTKAGIKATLNAKTSVLAAANPVGGRYDRSRSLRQNISLSAPIMSRFDLFFVLIDECTEQVDHEIAKRIT----ESQRPVDPEKSDTRIYNEDDIQRYITFARC-----------------FEPRVTEEAFKLMVTEYAKMRE-RDAASGSRSAWRITVRQLESLVRLSEATARMRFSDFVEECDVVEANRL 650          
BLAST of DNA helicase vs. Planmine SMEST
Match: SMESG000005389.1 (SMESG000005389.1)

HSP 1 Score: 311.227 bits (796), Expect = 3.976e-94
Identity = 226/716 (31.56%), Postives = 362/716 (50.56%), Query Frame = 2
Query:  329 LYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKEVIPAMDCVADSLFKSNYVDFHEPILTRPYNCEIS---------RNLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCN----NVTKVPCERGRIIDPEFCNQCQAKH---TQQIVHNC-----------CEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQK----------SKNRLIDEEEAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNK-------------TTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGK---GQISAYP---RQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTL--TFSYQRVLDELRNQS--DRMITR 2296
            +Y   +KE    ++ ++ ++  HL+ +D +L + L+  P E +P  + V + +  +N V +  P L       I          ++LR +    + +L+ ++G+V+  S I  +      +C  C     +V+  P   G ++ P  C    +       Q   +C           C+  D Q++KLQE+PE++P GE P    L+  + L +   PG+RVTV GI     Q  +S       V  +Y+ VL+ +           S   + D+EE         E R  S KP ++E ++ +IAP IYGN  IKK +  +LFGG     KK+  G  +R +I++++ GDPGT+KSQLL++V    P   YTSGKGSS  GLTA + +D  T S  ++ GA+ L+D G+ CIDEFDKM +  R  +HE MEQQ++SIAKAGI   L++R SVLAAAN +   WD  K   ENI   PT++SRFD+IF++ D  DE+ D ++  H++ ++ G  +             T E G +    L+ YIA+ +                +   P L+ EA   +T  YV MR   +  +   G+ ++ P   RQLE+++R+AE+ A+MRL+     AD  EA RL + +   +A   LTG ++      GV G   ++  ++   + KL+++R  +    S Q V+ +   Q   DR+I++
Sbjct:   47 VYRDILKENCNTKKYYLPVEWKHLSFFDPNLADKLMEKPNEFLPIFESVVNEV--ANDVTY--PRLENENLPSIQIMLKLDSHPKSLREIKSNQISKLIKISGVVVSASGIKSKAATLTLRCKGCQQYLPSVSVKPGLNGYVL-PRKCIASASSARFGVGQTAQSCPVDPYYIEPDKCKCNDFQILKLQEAPENVPHGEMPRHSQLFVDRYLCEKAVPGNRVTVVGISSIIQQ--DSMNMPKDGVKHSYIRVLNVEIENTGSTRSGISSLGVTDKEEK--------EFREFSLKPGVHEIIARSIAPGIYGNPDIKKAIACLLFGG---SRKKMPEGVFLRGDINMMMLGDPGTAKSQLLKFVEQCAPIAVYTSGKGSSAAGLTASVIRDSATRSFVMEGGAMVLADGGVVCIDEFDKMKEDDRVAIHEAMEQQTISIAKAGITTMLNSRCSVLAAANSVFGHWDETKG-DENIDFMPTIMSRFDMIFVVKDVYDEKRDKQIVEHVMSVHMGDGQAADVNENISLDSLTAETGIMPVLKLKKYIAFCR----------------DQCGPRLTPEALKIITNHYVSMRSGASEYEKETGKNTSIPITIRQLEAIVRIAESLAKMRLAPFGVEADAREAIRLFQVSTLSSA---LTGNLE------GVEGFTDRQEHDVIVKVEKLMKKRFVIGSQVSEQTVIQDFVKQGFPDRIISK 718          
BLAST of DNA helicase vs. Planmine SMEST
Match: SMESG000004906.1 (SMESG000004906.1)

HSP 1 Score: 299.286 bits (765), Expect = 1.384e-89
Identity = 200/596 (33.56%), Postives = 304/596 (51.01%), Query Frame = 2
Query:  566 NLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNN--VTKVPCERGRIIDPEFCNQ-CQAKHTQQIVH-NCCEFIDKQMIKLQESPEDMP----------------AGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRV---IKAVFKTYLDVLHFQKSKNRL---IDEE---EAKLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGEN---MRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCG------------------HNKTTEPGT----------------VDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQREALKQAAIDPLTGLIDINILTTG 2155
            NL    +   ++V G V++++++ P  I+  F+C  C N  +  +P +    +     N+ C++K  + +   +    ID Q+I+LQE+  D P                 G  P T+     +DLVD   PGD V VTGI    S   N  Q        +F   L V +  + K  +   +D E   +A+ S + +  I A+  +P+L++ L  ++ P+IYG+E +K  LL+ LFGG      K G  +N   +R N H+L+ GDPG  KSQ+LQ    + PR  Y  G   +  GLT   +KD ++G++ L++GAL +SDNG CCIDEFDKM+    + L E MEQQS+SIAKAG++C L ARTSVLAAANP    ++  KT+ EN+++   LLSRFDL++++LD  +E  D+KL+RH++ L+                    H+ T EPG+                +   +LR YIAYAK                + +HP LS EA N + E Y+ +RK  +   G      RQLES++RL EA AR  L +     D  + + L  E++     D L G+++ +   +G
Sbjct:  109 NLQANQIGSFISVKGNVVKVNQVKPVCIRVKFRCLTCKNEQIVVLPDDYKFAVPTRCVNRVCKSKSFEPLKESDETVTIDYQVIRLQETGSDCPLPFSSNSESIHHDKTNEGRIPKTLNCILIRDLVDNCVPGDEVIVTGIVMTESASTNFHQSSGSGSNCLFNLVLHVNNICRLKGDVKMDVDSENSYDAEFSVKDLYAIEAIHSEPNLFKLLVASLCPSIYGHELVKASLLLALFGG----VTKFGNDKNRVAIRGNSHILIVGDPGLGKSQMLQSACAIAPRSVYICGGSVTTAGLTVSFSKDSDSGTA-LEAGALVISDNGCCCIDEFDKMSAQQHASLLEAMEQQSISIAKAGMVCNLSARTSVLAAANPNTGHYNKAKTVAENLKMSAPLLSRFDLVYIMLDRPNEVLDSKLSRHVLSLHTEQSLNRSSSSIRQMDTMSFHSMTKEPGSTLHERLSYGHKESCDNIPPQLLRKYIAYAK----------------KYVHPKLSSEAANILQEFYLSLRKRRHFMDGT-PITTRQLESMVRLTEAKARSELREIANEQDAKDVKELMLESMMGVYSDEL-GILNFSRSQSG 681          
BLAST of DNA helicase vs. Planmine SMEST
Match: SMESG000057772.1 (SMESG000057772.1)

HSP 1 Score: 285.034 bits (728), Expect = 1.964e-84
Identity = 186/518 (35.91%), Postives = 283/518 (54.63%), Query Frame = 2
Query:  557 NLRNLNPEDLDQLVTVNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFC-NQCQAKHTQQIVH---NCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQPGDRVTVTGIYRAASQRENSKQRVIK--AVFKTYLDVLHFQKSKNRLIDEEEAKLSQ---ERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRVKETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGSSKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLHEVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPPTLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLRDYIAYAKVGRN*LNFHRITNRI*ENIHPILSEEAENYVTEEYVEMRKVGNAG-KGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRL 2080
            ++RN+  +++  ++ +  +VIR + + P M  A + C  C + T        ++    C N+     T   +H      +++  Q I++QE  + +P G  P ++ ++C       +QPGD V +TG++       N+  R +    V + +LD  HF    NR+  +E   L +       E+  L + P++Y  ++ +IAP I+G+E +KKGLL+M+            AG  +R ++++ L GDPG +KSQLL +V  L PR QYT+G+GSS  GLTA + +D  TG  TL++G+L L+D GICCIDEFDKMTD+ R+ +HEVMEQQ++SIAKAGI+  L+AR S+LAAANP    ++ ++TI +NI LP  LLSRFDL++LI D  D   D +LA+HI  +   H     P +V T    D      +        R    I     P + E   NY+   Y+ MRK   AG K  I    R L +LIR++ A +R++   +V   D  EA RL
Sbjct:  151 SIRNVLSKEMGSVIKLKAVVIRATMVKPLMKIATYTCDRCGSETFQEILNKTLLPLLTCTNEVCKIGTAGRLHLQTKGSKYVKLQEIRIQEVSDQVPIGNIPRSMNVHCVGANTRLVQPGDHVFITGVFLPLL---NTGMRTLNRGLVTELFLDA-HF---INRITKDESDDLGETIPATEAELEKL-KDPEMYSLMARSIAPEIFGHEDVKKGLLIMM----AGGAGIDAAGTKIRGSLNICLMGDPGVAKSQLLGFVDRLCPRSQYTNGRGSSGAGLTASVVRDQLTGEMTLEAGSLVLADGGICCIDEFDKMTDSDRTAIHEVMEQQTISIAKAGIMTTLNARASILAAANPAYGRYNPRRTIEQNIDLPAALLSRFDLLWLIQDKPDRDGDLRLAQHISYV---HTNNEAPPSVLTTAAGDSAGLLPLSMA--ELRRYLAIIRSQPDPAVPETLLNYLVGCYISMRKESKAGSKESIFTSARSLLALIRISTALSRIKCQTEVDRIDVDEAIRL 651          
The following BLAST results are available for this feature:
BLAST of DNA helicase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MCM40.000e+054.84minichromosome maintenance complex component 4 [So... [more]
MCM40.000e+054.84minichromosome maintenance complex component 4 [So... [more]
MCM40.000e+054.84minichromosome maintenance complex component 4 [So... [more]
MCM40.000e+051.94minichromosome maintenance complex component 4 [So... [more]
MCM40.000e+054.83minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of DNA helicase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm-40.000e+047.56DNA replication licensing factor mcm-4 [Source:Un... [more]
mcm-40.000e+047.56DNA replication licensing factor mcm-4 [Source:Un... [more]
mcm-52.743e-10032.46DNA replication licensing factor mcm-5 [Source:Un... [more]
mcm-52.743e-10032.46DNA replication licensing factor mcm-5 [Source:Un... [more]
mcm-21.309e-9933.55DNA helicase [Source:UniProtKB/TrEMBL;Acc:Q7K7J6][more]
back to top
BLAST of DNA helicase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dpa0.000e+052.31gene:FBgn0015929 transcript:FBtr0345797[more]
dpa0.000e+052.31gene:FBgn0015929 transcript:FBtr0088982[more]
Mcm58.317e-9932.63gene:FBgn0017577 transcript:FBtr0082279[more]
Mcm27.653e-9733.75gene:FBgn0014861 transcript:FBtr0081827[more]
Mcm71.208e-9337.00gene:FBgn0020633 transcript:FBtr0076585[more]
back to top
BLAST of DNA helicase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm40.000e+054.86minichromosome maintenance complex component 4 [So... [more]
mcm53.119e-10333.00minichromosome maintenance complex component 5 [So... [more]
mcm27.510e-9834.37minichromosome maintenance complex component 2 [So... [more]
mcm82.784e-9232.01minichromosome maintenance 8 homologous recombinat... [more]
mcm6l3.707e-8930.95MCM6 minichromosome maintenance deficient 6, like ... [more]
back to top
BLAST of DNA helicase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm40.000e+053.49minichromosome maintenance complex component 4 [So... [more]
mcm40.000e+053.49minichromosome maintenance complex component 4 [So... [more]
mcm40.000e+053.05minichromosome maintenance complex component 4 [So... [more]
mcm40.000e+054.32minichromosome maintenance complex component 4 [So... [more]
mcm40.000e+055.66minichromosome maintenance complex component 4 [So... [more]
back to top
BLAST of DNA helicase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mcm40.000e+054.43minichromosome maintenance complex component 4 [So... [more]
Mcm23.302e-10134.85minichromosome maintenance complex component 2 [So... [more]
Mcm56.126e-10132.00minichromosome maintenance complex component 5 [So... [more]
Mcm56.126e-10132.00minichromosome maintenance complex component 5 [So... [more]
Mcm56.126e-10132.00minichromosome maintenance complex component 5 [So... [more]
back to top
BLAST of DNA helicase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5XK83|MCM4A_XENLA0.000e+053.76DNA replication licensing factor mcm4-A OS=Xenopus... [more]
sp|Q6GL41|MCM4_XENTR0.000e+053.49DNA replication licensing factor mcm4 OS=Xenopus t... [more]
sp|P33991|MCM4_HUMAN0.000e+054.84DNA replication licensing factor MCM4 OS=Homo sapi... [more]
sp|P30664|MCM4B_XENLA0.000e+053.63DNA replication licensing factor mcm4-B OS=Xenopus... [more]
sp|P49717|MCM4_MOUSE0.000e+054.43DNA replication licensing factor MCM4 OS=Mus muscu... [more]
back to top
BLAST of DNA helicase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H2KVN70.000e+057.09DNA helicase OS=Clonorchis sinensis OX=79923 GN=CL... [more]
A0A4S2MKT60.000e+056.93DNA helicase OS=Opisthorchis felineus OX=147828 GN... [more]
A0A074ZC040.000e+057.21DNA helicase OS=Opisthorchis viverrini OX=6198 GN=... [more]
A0A3R7H8Y20.000e+056.97DNA helicase OS=Clonorchis sinensis OX=79923 GN=mc... [more]
G4VM720.000e+058.81DNA helicase OS=Schistosoma mansoni OX=6183 GN=Smp... [more]
back to top
BLAST of DNA helicase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm40.000e+055.39minichromosome maintenance complex component 4 [So... [more]
mcm59.147e-10633.52minichromosome maintenance complex component 5 [So... [more]
mcm51.370e-10132.66minichromosome maintenance complex component 5 [So... [more]
mcm23.068e-9934.37minichromosome maintenance complex component 2 [So... [more]
mcm23.595e-9934.37minichromosome maintenance complex component 2 [So... [more]
back to top
BLAST of DNA helicase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm52.148e-8735.85minichromosome maintenance complex component 5 [So... [more]
mcm82.007e-8631.72minichromosome maintenance 8 homologous recombinat... [more]
ENSPMAT00000006035.16.051e-8435.14pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
ENSPMAT00000008164.19.511e-8037.58pep scaffold:Pmarinus_7.0:GL490771:48:5221:1 gene:... [more]
ENSPMAT00000006014.15.358e-7834.47pep scaffold:Pmarinus_7.0:GL477570:19772:33072:1 g... [more]
back to top
BLAST of DNA helicase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
MCM40.000e+042.23Essential helicase component of heterohexameric MC... [more]
MCM71.034e-9636.49Component of the Mcm2-7 hexameric helicase complex... [more]
MCM58.030e-9630.60Component of the Mcm2-7 hexameric helicase complex... [more]
MCM21.097e-8329.79Protein involved in DNA replication; component of ... [more]
MCM63.320e-8142.42Protein involved in DNA replication; component of ... [more]
back to top
BLAST of DNA helicase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO350601.641e-9934.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484539.164e-9533.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO379467.268e-9437.96Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO344255.716e-8432.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339716.033e-8432.73Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DNA helicase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm40.000e+053.94minichromosome maintenance complex component 4 [So... [more]
mcm40.000e+054.57minichromosome maintenance complex component 4 [So... [more]
mcm51.996e-10834.00minichromosome maintenance complex component 5 [So... [more]
mcm71.041e-10138.83minichromosome maintenance complex component 7 [So... [more]
mcm21.006e-9934.59minichromosome maintenance complex component 2 [So... [more]
back to top
BLAST of DNA helicase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000060238.10.000e+097.72SMESG000060238.1[more]
SMESG000038798.13.315e-9932.09SMESG000038798.1[more]
SMESG000005389.13.976e-9431.56SMESG000005389.1[more]
SMESG000004906.11.384e-8933.56SMESG000004906.1[more]
SMESG000057772.11.964e-8435.91SMESG000057772.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023821 ID=SMED30023821|Name=DNA helicase|organism=Schmidtea mediterranea sexual|type=transcript|length=2437bp
GTTTAATAAAATGTCTAACCTCAATGAAGCTAGCGATGTGCTAATAGCTG
GTCTACGTTCGTCAGATATTGATGGTGATAGCTTAAGTTACACTGATTTA
TCAAGCTTAGATGTCAACAGTACTACACTACGACCAGGAGTAAATGATGA
TTATGGTACAACAGAAAGATCAGGAATAAGTCATGATTTACCACAAAACC
TTATTTATGGAACTAATATTAATATAACCAATATAATGGAAAGCTTTCGA
AGCTTTCTTCTTCAATTTAAAACAGAGATTCCAGATGAAAATTTTGTAAC
AGATATCAGATTCAATCCAGATGATCCCTTATATATTCAGAAAATGAAAG
AAATGTCATTGTTACGACGAGCATGGATAAACATAGATTGCTCTCATTTG
GCTCAGTATGATAGGAGCTTATGCAACAATTTAATTATATATCCCAAAGA
AGTTATTCCAGCTATGGATTGTGTTGCAGACAGTTTATTTAAAAGCAATT
ATGTAGATTTTCACGAACCTATTCTAACTAGACCTTATAACTGTGAAATT
TCAAGAAATCTAAGAAATTTGAATCCAGAAGATCTTGACCAGTTAGTAAC
TGTCAACGGTTTGGTTATCAGATTATCAGAAATTATTCCGGAAATGATTA
AAGCCCATTTTAAATGTTCGGTCTGCAACAATGTTACAAAAGTTCCTTGT
GAACGAGGTAGAATTATCGATCCTGAATTTTGTAACCAATGCCAAGCTAA
ACATACTCAACAAATAGTACACAATTGCTGTGAATTTATAGACAAGCAAA
TGATAAAACTGCAAGAGTCACCAGAAGACATGCCAGCTGGAGAGACCCCT
CATACTGTTGTTCTTTATTGCTATCAGGATTTAGTTGATACAATACAGCC
AGGTGACAGAGTCACCGTAACCGGAATTTATAGAGCTGCATCACAACGAG
AAAATTCTAAACAACGCGTTATTAAGGCTGTTTTCAAAACTTATTTAGAT
GTTTTGCATTTCCAGAAATCTAAGAACCGTCTAATCGATGAAGAAGAAGC
AAAATTATCACAGGAAAGGGTTGTGGAAATAAGAGCACTGAGCCAAAAGC
CAGATTTATATGAGCGATTAAGTGGGGCTATTGCTCCCACTATTTACGGC
AACGAAACGATTAAGAAAGGTCTTTTAATGATGTTGTTTGGAGGACGGGT
TAAAGAAACGAAAAAATTGGGTGCCGGAGAAAATATGCGATCGAACATCC
ACGTGCTGCTGTGTGGAGATCCAGGAACATCGAAATCGCAATTATTGCAG
TATGTGTACAATCTGACCCCTCGAGGTCAATATACTTCTGGCAAGGGCAG
CTCCAAGGTTGGACTGACTGCCTATATTACCAAGGACCCAGAAACTGGCT
CTTCGACGTTGCAGAGTGGAGCTCTAGCACTTTCTGACAATGGAATTTGT
TGCATCGATGAATTCGACAAAATGACTGACACGACCCGTTCGGTGCTTCA
TGAAGTTATGGAGCAACAATCGCTCAGTATTGCTAAGGCTGGAATTATCT
GCCAATTGCACGCGAGAACCAGTGTATTAGCGGCTGCAAATCCCATCGGT
AGCTGCTGGGACAATAAGAAGACTATAATTGAAAACATTCAGCTTCCTCC
AACACTGTTGTCTCGTTTTGACTTGATTTTTCTCATTCTCGATCCACAAG
ACGAGCAATACGATGCCAAATTGGCACGGCACATTGTAGGCCTGTATTGC
GGTCATAATAAAACAACCGAGCCCGGCACCGTTGACACTGCCATGTTACG
TGATTATATCGCTTATGCGAAGGTAGGCAGAAATTGATTGAATTTCCACC
GAATAACCAACCGCATCTAGGAGAACATTCACCCAATATTGTCTGAGGAA
GCGGAAAATTACGTAACTGAGGAGTATGTAGAAATGAGAAAAGTTGGAAA
TGCTGGCAAAGGTCAGATATCTGCTTATCCTAGGCAATTGGAGTCATTAA
TACGATTGGCTGAAGCTCATGCAAGGATGCGTTTATCTGATCAAGTAACG
GTAGCAGATTGCCTAGAAGCACGAAGACTACAGAGAGAAGCACTGAAACA
AGCCGCAATCGATCCATTGACAGGATTGATAGACATAAATATCCTTACAA
CTGGTGTCAGTGGAGGCATCAGGAAACGAAACGAGGAATTAGCACGTGCC
ATCTATAAGCTATTGGAAGAAAGAAGAACACTGACATTTAGTTACCAGAG
AGTTCTCGACGAGCTCAGAAATCAATCTGACCGCATGATCACTCGAGATA
TGTTTGAAGATGGACTCAATTTGCTGAAATTTGAAAACAAAATCGACTGG
ACTGATAAAACTATTAGGAAACGCTAGATAACTTATTATGCTGTATGCTA
GATGTTATTTTCATACTAATAAATGTTGTTGATTTAG
back to top

protein sequence of SMED30023821-orf-1

>SMED30023821-orf-1 ID=SMED30023821-orf-1|Name=SMED30023821-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=148bp
MRKVGNAGKGQISAYPRQLESLIRLAEAHARMRLSDQVTVADCLEARRLQ
REALKQAAIDPLTGLIDINILTTGVSGGIRKRNEELARAIYKLLEERRTL
TFSYQRVLDELRNQSDRMITRDMFEDGLNLLKFENKIDWTDKTIRKR*
back to top

protein sequence of SMED30023821-orf-2

>SMED30023821-orf-2 ID=SMED30023821-orf-2|Name=SMED30023821-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=612bp
FNKMSNLNEASDVLIAGLRSSDIDGDSLSYTDLSSLDVNSTTLRPGVNDD
YGTTERSGISHDLPQNLIYGTNINITNIMESFRSFLLQFKTEIPDENFVT
DIRFNPDDPLYIQKMKEMSLLRRAWINIDCSHLAQYDRSLCNNLIIYPKE
VIPAMDCVADSLFKSNYVDFHEPILTRPYNCEISRNLRNLNPEDLDQLVT
VNGLVIRLSEIIPEMIKAHFKCSVCNNVTKVPCERGRIIDPEFCNQCQAK
HTQQIVHNCCEFIDKQMIKLQESPEDMPAGETPHTVVLYCYQDLVDTIQP
GDRVTVTGIYRAASQRENSKQRVIKAVFKTYLDVLHFQKSKNRLIDEEEA
KLSQERVVEIRALSQKPDLYERLSGAIAPTIYGNETIKKGLLMMLFGGRV
KETKKLGAGENMRSNIHVLLCGDPGTSKSQLLQYVYNLTPRGQYTSGKGS
SKVGLTAYITKDPETGSSTLQSGALALSDNGICCIDEFDKMTDTTRSVLH
EVMEQQSLSIAKAGIICQLHARTSVLAAANPIGSCWDNKKTIIENIQLPP
TLLSRFDLIFLILDPQDEQYDAKLARHIVGLYCGHNKTTEPGTVDTAMLR
DYIAYAKVGRN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000420parapharyngeal region
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR033762MCM_OB
IPR031327MCM
IPR004039Rubredoxin-type_fold
IPR027417P-loop_NTPase
IPR012340NA-bd_OB-fold
IPR027925MCM_N
IPR018525MCM_CS
IPR007527Znf_SWIM
IPR008047MCM_4
IPR001208MCM_dom
IPR003593AAA+_ATPase
Vocabulary: molecular function
TermDefinition
GO:0003678DNA helicase activity
GO:0003677DNA binding
GO:0005524ATP binding
GO:0008270zinc ion binding
GO:0000166nucleotide binding
GO:0004386helicase activity
GO:0016787hydrolase activity
Vocabulary: cellular component
TermDefinition
GO:0042555MCM complex
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006270DNA replication initiation
GO:0006260DNA replication
GO:0032508DNA duplex unwinding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR008047Mini-chromosome maintenance complex protein 4PRINTSPR01660MCMPROTEIN4coord: 385..396
score: 61.11
coord: 257..269
score: 60.9
coord: 534..551
score: 57.41
coord: 209..222
score: 57.74
IPR008047Mini-chromosome maintenance complex protein 4PANTHERPTHR11630:SF66DNA REPLICATION LICENSING FACTOR MCM4coord: 55..607
IPR001208MCM domainPRINTSPR01657MCMFAMILYcoord: 525..537
score: 57.49
coord: 473..487
score: 69.82
coord: 552..560
score: 78.85
coord: 413..428
score: 60.42
coord: 501..514
score: 77.04
IPR001208MCM domainPFAMPF00493MCMcoord: 359..581
e-value: 6.5E-95
score: 316.5
IPR001208MCM domainPROSITEPS50051MCM_2coord: 369..578
score: 89.105
IPR003593AAA+ ATPase domainSMARTSM00382AAA_5coord: 414..566
e-value: 3.8E-4
score: 29.8
IPR031327Mini-chromosome maintenance proteinSMARTSM00350mcmcoord: 183..611
e-value: 3.2E-183
score: 624.7
IPR031327Mini-chromosome maintenance proteinPANTHERPTHR11630DNA REPLICATION LICENSING FACTORcoord: 55..607
NoneNo IPR availableGENE3DG3DSA:2.20.28.10coord: 214..263
e-value: 5.3E-50
score: 170.7
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 353..609
e-value: 1.9E-103
score: 348.1
NoneNo IPR availableGENE3DG3DSA:2.40.50.140coord: 187..322
e-value: 5.3E-50
score: 170.7
NoneNo IPR availableGENE3DG3DSA:3.30.1640.10coord: 74..182
e-value: 2.9E-13
score: 51.7
NoneNo IPR availableCDDcd17755MCM4coord: 372..607
e-value: 3.12674E-138
score: 402.97
IPR033762MCM OB domainPFAMPF17207MCM_OBcoord: 187..312
e-value: 2.0E-38
score: 131.1
IPR027925MCM N-terminal domainPFAMPF14551MCM_Ncoord: 79..182
e-value: 1.0E-14
score: 55.0
IPR018525Mini-chromosome maintenance, conserved sitePROSITEPS00847MCM_1coord: 481..489
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 379..606
IPR012340Nucleic acid-binding, OB-foldSUPERFAMILYSSF50249Nucleic acid-binding proteinscoord: 98..334