Serine/threonine kinase

Overview
NameSerine/threonine kinase
Smed IDSMED30023814
Length (bp)1812
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine kinase (SMED30023814) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30023814) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine kinase (SMED30023814) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine kinase (SMED30023814) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023814

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30023814SMESG000041176.1 dd_Smed_v4_5913_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023814SMESG000041176.1 dd_Smed_v4_5913_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: MAP4K5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:HGNC Symbol;Acc:HGNC:6867])

HSP 1 Score: 367.081 bits (941), Expect = 3.921e-116
Identity = 173/299 (57.86%), Postives = 226/299 (75.59%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            P  D +R+     NP+ +Y+L+  +GSGTYGDVYKA +V +    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYCGG S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGITAIE  ELQPP+FDLHPM+AL ++++  + PPKL+ K  WS+ FH+F++ AL KN KKRP  E +LTH FV Q  LS  L   LL K+NN D
Sbjct:    7 PAADILRR-----NPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIY-HVTGPLSELQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVE-KNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVAQPGLSRALAVELLDKVNNPD 298          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 355.14 bits (910), Expect = 2.209e-111
Identity = 169/300 (56.33%), Postives = 227/300 (75.67%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKDY 1241
            P  D  R+     NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+GL Y+H +G++HRDIKGANILLTD G VK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGITAIE AELQPP+FDLHPM+AL ++ +  + PPKL+ K  WS  FH F++ AL KN KKRP  E +L H FVTQ HL+ +L   LL K+NN D+
Sbjct:    3 PGFDLSRR-----NPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIY-HVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQ-HLTRSLAIELLDKVNNPDH 294          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 355.525 bits (911), Expect = 2.564e-111
Identity = 169/300 (56.33%), Postives = 227/300 (75.67%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKDY 1241
            P  D  R+     NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+GL Y+H +G++HRDIKGANILLTD G VK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGITAIE AELQPP+FDLHPM+AL ++ +  + PPKL+ K  WS  FH F++ AL KN KKRP  E +L H FVTQ HL+ +L   LL K+NN D+
Sbjct:    3 PGFDLSRR-----NPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIY-HVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQ-HLTRSLAIELLDKVNNPDH 294          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: MAP4K2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6864])

HSP 1 Score: 348.977 bits (894), Expect = 1.088e-109
Identity = 162/309 (52.43%), Postives = 223/309 (72.17%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPAT 1298
            V+  +P+D ++L+  +G+GTYGDVYKA    +    A+KI+K+D  DD++++ QEI  LREC+H N+V + GSYL+  +LWICME+CGG S+Q+IY +   P+ E  IA++ RE LKGL ++H +G+IHRDIKGAN+LLT  GDVK+ADFG++ +L+++VAKR + IGTPYWMAPEVAAV  R GGY+E CDVWA+GITAIE  ELQPPLF LHPM+AL ++++ ++ PPKL+ K  W+  FH FL+ AL KN KKRP  E +L H F TQ+     LTQ L K ++     P  +  E++  D+ P T
Sbjct:    7 VSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIY-HATGPLEERQIAYVCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAPEVAAVE-RKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAEKLLQHPFTTQQLPRALLTQLLDKASDPHLGTPSPEDCELETYDMFPDT 313          
BLAST of Serine/threonine kinase vs. Ensembl Human
Match: MAP4K2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:HGNC Symbol;Acc:HGNC:6864])

HSP 1 Score: 349.362 bits (895), Expect = 1.226e-109
Identity = 162/309 (52.43%), Postives = 223/309 (72.17%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPAT 1298
            V+  +P+D ++L+  +G+GTYGDVYKA    +    A+KI+K+D  DD++++ QEI  LREC+H N+V + GSYL+  +LWICME+CGG S+Q+IY +   P+ E  IA++ RE LKGL ++H +G+IHRDIKGAN+LLT  GDVK+ADFG++ +L+++VAKR + IGTPYWMAPEVAAV  R GGY+E CDVWA+GITAIE  ELQPPLF LHPM+AL ++++ ++ PPKL+ K  W+  FH FL+ AL KN KKRP  E +L H F TQ+     LTQ L K ++     P  +  E++  D+ P T
Sbjct:    7 VSLQDPRDRFELLQRVGAGTYGDVYKARDTVTSELAAVKIVKLDPGDDISSLQQEITILRECRHPNVVAYIGSYLRNDRLWICMEFCGGGSLQEIY-HATGPLEERQIAYVCREALKGLHHLHSQGKIHRDIKGANLLLTLQGDVKLADFGVSGELTASVAKRRSFIGTPYWMAPEVAAVE-RKGGYNELCDVWALGITAIELGELQPPLFHLHPMRALMLMSKSSFQPPKLRDKTRWTQNFHHFLKLALTKNPKKRPTAEKLLQHPFTTQQLPRALLTQLLDKASDPHLGTPSPEDCELETYDMFPDT 313          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: gck-2 (Mitogen-activated protein kinase kinase kinase kinase [Source:UniProtKB/TrEMBL;Acc:Q23290])

HSP 1 Score: 335.109 bits (858), Expect = 1.396e-104
Identity = 158/288 (54.86%), Postives = 207/288 (71.88%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLT-HDFVTQEHLSITLTQALLKMNN 1232
            +  SNP D+Y+L+  +GSGTYG+VYKA  ++S +  A+K++K++  D+   I QEI  +REC H NI+ +FGSY++  +LWI MEYCGG S+QDIY +L  P+ E  IAF+ RETL+GL+Y+H  G+IHRDIKGANILL+  GDVK+ADFG+AA++++T+ KR + IGTPYWMAPEVA V  R GGY  +CDVWA GITAIE  E QPPLFDLHPM+ L ++ +  Y PP L+ K  W+  FH F+R  L KN KKRP  E +LT H FV    LS  +T+ LL   N
Sbjct:    6 IKRSNPADDYELLQRVGSGTYGEVYKARDIRSDSLAAVKVVKLEAGDNFAVIQQEIMVIRECSHPNIIAYFGSYIRRDRLWIVMEYCGGGSLQDIY-HLTGPLSELQIAFVCRETLRGLNYLHNMGKIHRDIKGANILLSSSGDVKLADFGVAAQITATIGKRKSFIGTPYWMAPEVACVEKR-GGYGMQCDVWATGITAIELGECQPPLFDLHPMQVLYLMTKSGYKPPHLKDKHRWTPLFHDFVRQCLTKNPKKRPSPEKLLTSHPFVLGS-LSARMTRDLLDKVN 290          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: cst-2 (Caenorhabditis STE20-like kinase [Source:UniProtKB/TrEMBL;Acc:Q304D8])

HSP 1 Score: 246.128 bits (627), Expect = 3.906e-75
Identity = 116/264 (43.94%), Postives = 175/264 (66.29%), Query Frame = 3
Query:  387 PKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFV 1178
            P++ + ++ ++G G+YG V+KA+H +S + +AIK  K+ +  D+  I +EI  +++CK   +V+++GSY + S LWI MEYCG  S+ DI    R+P+ E  I+ + R+TLKGL Y+H   +IHRDIK  NILL   G  K+ADFG+A +L+ T+AKR T+IGTP+WMAPEV        GYD + D+W++GITAIE AE +PP  D+HPM+A+ ++   T  PP  +K E WS++F+ F+R  L K  ++R     +  H F+
Sbjct:   31 PEEVFDIVGKLGEGSYGSVHKAIHRESGHVLAIK--KVPVDTDLQEIIKEISIMQQCKSKYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI----EEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIP--TKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFI 286          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 247.284 bits (630), Expect = 1.279e-74
Identity = 116/264 (43.94%), Postives = 175/264 (66.29%), Query Frame = 3
Query:  387 PKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFV 1178
            P++ + ++ ++G G+YG V+KA+H +S + +AIK + +D   D+  I +EI  +++CK   +V+++GSY + S LWI MEYCG  S+ DI    R+P+ E  I+ + R+TLKGL Y+H   +IHRDIK  NILL   G  K+ADFG+A +L+ T+AKR T+IGTP+WMAPEV        GYD + D+W++GITAIE AE +PP  D+HPM+A+ ++   T  PP  +K E WS++F+ F+R  L K  ++R     +  H F+
Sbjct:   31 PEEVFDIVGKLGEGSYGSVHKAIHRESGHVLAIKKVPVDT--DLQEIIKEISIMQQCKSKYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI----EEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIP--TKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFI 286          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: cst-1 (Serine/threonine-protein kinase cst-1 Serine/threonine-protein kinase cst-1 37kDa subunit Serine/threonine-protein kinase cst-1 18kDa subunit [Source:UniProtKB/Swiss-Prot;Acc:Q9NB31])

HSP 1 Score: 246.899 bits (629), Expect = 1.281e-74
Identity = 116/264 (43.94%), Postives = 175/264 (66.29%), Query Frame = 3
Query:  387 PKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFV 1178
            P++ + ++ ++G G+YG V+KA+H +S + +AIK + +D   D+  I +EI  +++CK   +V+++GSY + S LWI MEYCG  S+ DI    R+P+ E  I+ + R+TLKGL Y+H   +IHRDIK  NILL   G  K+ADFG+A +L+ T+AKR T+IGTP+WMAPEV        GYD + D+W++GITAIE AE +PP  D+HPM+A+ ++   T  PP  +K E WS++F+ F+R  L K  ++R     +  H F+
Sbjct:   31 PEEVFDIVGKLGEGSYGSVHKAIHRESGHVLAIKKVPVDT--DLQEIIKEISIMQQCKSKYVVKYYGSYFKHSDLWIVMEYCGAGSISDIMRARRKPLSEQEISAVLRDTLKGLQYLHDLKKIHRDIKAGNILLNTDGIAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI----EEIGYDTKADIWSLGITAIEMAEGRPPYSDIHPMRAIFMIP--TKPPPTFKKPEEWSSEFNDFIRSCLIKKPEERKTALRLCEHTFI 286          
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Match: mig-15 (Serine/threonine-protein kinase mig-15 [Source:UniProtKB/Swiss-Prot;Acc:Q23356])

HSP 1 Score: 246.128 bits (627), Expect = 2.598e-70
Identity = 126/324 (38.89%), Postives = 198/324 (61.11%), Query Frame = 3
Query:  384 NPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRE-CKHDNIVQFFGSYLQA--------SKLWICMEYCGGQSMQDIYLNLRRPII-EDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNR-TGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQAL---------LKMNNKDYKIPLGKQNEMKPKDVKPA 1295
            +P   ++LI  +G+GTYG VYK  HVK+    AIKIM I+ +D+   I  EI+ L++   H N+  ++G++++          +LW+ ME+CG  S+ D+  N +   + E+ IA+I RE L+GL ++H+   IHRDIKG N+LLTD  +VK+ DFG++A+L  TV +R T IGTPYWMAPEV A +      YD R D+W++GITA+E AE  PPL D+HPM+AL ++ +    PPKL++ + W+ KF +F+   L K+  +RPY   +L H F+ ++    T+  ++         +K ++ DY+    + +E  P +  P+
Sbjct:   16 DPAGIFELIEVVGNGTYGQVYKGRHVKTAQLAAIKIMNIN-EDEEDEIKLEINMLKKHSHHRNVATYYGAFIKKLPSSTGKHDQLWLVMEFCGSGSITDLVKNTKGGSLKEEWIAYICREILRGLYHLHQSKVIHRDIKGQNVLLTDSAEVKLVDFGVSAQLDKTVGRRNTFIGTPYWMAPEVIACDESPEATYDSRSDLWSLGITALEMAEGHPPLCDMHPMRALFLIPRN--PPPKLKRNKKWTKKFETFIETVLVKDYHQRPYTGALLRHPFIKEQPHEQTIRHSIKEHIDRNRRVKKDDADYEYSGSEDDEPSPNNRGPS 336          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: hppy (gene:FBgn0263395 transcript:FBtr0340456)

HSP 1 Score: 348.206 bits (892), Expect = 1.579e-108
Identity = 162/295 (54.92%), Postives = 224/295 (75.93%), Query Frame = 3
Query:  339 THPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLK 1223
            +H N + +   ++  NP+DEY+LI +IGSGTYGDVYKA  ++S    AIK++K++  DD+  I QEI  +R+C+H NI+ ++GSYL+  KLWICME+CGG S+QDIY  +  P+ E  IA++ RETLKGL+Y+H  G++HRDIKGANILLT+ GDVK+ADFG++A++++T+ KR + IGTPYWMAPEVAAV  R GGY++ CD+WA GITAIE AELQPP+FDLHPM+AL ++++  + PP L  K+ WS  FH+F++ AL KN KKRP  E +L H FV Q  +S+ + + LL+
Sbjct:    6 SHHNANMLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIY-QVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAV-ERKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLLQHPFV-QCEMSLRVAKELLQ 297          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: hppy (gene:FBgn0263395 transcript:FBtr0086503)

HSP 1 Score: 348.591 bits (893), Expect = 1.729e-108
Identity = 162/295 (54.92%), Postives = 224/295 (75.93%), Query Frame = 3
Query:  339 THPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLK 1223
            +H N + +   ++  NP+DEY+LI +IGSGTYGDVYKA  ++S    AIK++K++  DD+  I QEI  +R+C+H NI+ ++GSYL+  KLWICME+CGG S+QDIY  +  P+ E  IA++ RETLKGL+Y+H  G++HRDIKGANILLT+ GDVK+ADFG++A++++T+ KR + IGTPYWMAPEVAAV  R GGY++ CD+WA GITAIE AELQPP+FDLHPM+AL ++++  + PP L  K+ WS  FH+F++ AL KN KKRP  E +L H FV Q  +S+ + + LL+
Sbjct:    6 SHHNANMLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIY-QVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAV-ERKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLLQHPFV-QCEMSLRVAKELLQ 297          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: hppy (gene:FBgn0263395 transcript:FBtr0340454)

HSP 1 Score: 348.591 bits (893), Expect = 2.317e-108
Identity = 162/295 (54.92%), Postives = 224/295 (75.93%), Query Frame = 3
Query:  339 THPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLK 1223
            +H N + +   ++  NP+DEY+LI +IGSGTYGDVYKA  ++S    AIK++K++  DD+  I QEI  +R+C+H NI+ ++GSYL+  KLWICME+CGG S+QDIY  +  P+ E  IA++ RETLKGL+Y+H  G++HRDIKGANILLT+ GDVK+ADFG++A++++T+ KR + IGTPYWMAPEVAAV  R GGY++ CD+WA GITAIE AELQPP+FDLHPM+AL ++++  + PP L  K+ WS  FH+F++ AL KN KKRP  E +L H FV Q  +S+ + + LL+
Sbjct:    6 SHHNANMLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIY-QVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAV-ERKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLLQHPFV-QCEMSLRVAKELLQ 297          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: hppy (gene:FBgn0263395 transcript:FBtr0086504)

HSP 1 Score: 349.362 bits (895), Expect = 6.499e-107
Identity = 162/295 (54.92%), Postives = 224/295 (75.93%), Query Frame = 3
Query:  339 THPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLK 1223
            +H N + +   ++  NP+DEY+LI +IGSGTYGDVYKA  ++S    AIK++K++  DD+  I QEI  +R+C+H NI+ ++GSYL+  KLWICME+CGG S+QDIY  +  P+ E  IA++ RETLKGL+Y+H  G++HRDIKGANILLT+ GDVK+ADFG++A++++T+ KR + IGTPYWMAPEVAAV  R GGY++ CD+WA GITAIE AELQPP+FDLHPM+AL ++++  + PP L  K+ WS  FH+F++ AL KN KKRP  E +L H FV Q  +S+ + + LL+
Sbjct:    6 SHHNANMLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIY-QVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAV-ERKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLLQHPFV-QCEMSLRVAKELLQ 297          
BLAST of Serine/threonine kinase vs. Ensembl Fly
Match: hppy (gene:FBgn0263395 transcript:FBtr0340455)

HSP 1 Score: 348.591 bits (893), Expect = 9.296e-107
Identity = 162/295 (54.92%), Postives = 224/295 (75.93%), Query Frame = 3
Query:  339 THPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLK 1223
            +H N + +   ++  NP+DEY+LI +IGSGTYGDVYKA  ++S    AIK++K++  DD+  I QEI  +R+C+H NI+ ++GSYL+  KLWICME+CGG S+QDIY  +  P+ E  IA++ RETLKGL+Y+H  G++HRDIKGANILLT+ GDVK+ADFG++A++++T+ KR + IGTPYWMAPEVAAV  R GGY++ CD+WA GITAIE AELQPP+FDLHPM+AL ++++  + PP L  K+ WS  FH+F++ AL KN KKRP  E +L H FV Q  +S+ + + LL+
Sbjct:    6 SHHNANMLSSDISRRNPQDEYELIQKIGSGTYGDVYKAKRIQSNELAAIKVIKLEPSDDIQIIQQEIIMMRDCRHPNIIAYYGSYLRRDKLWICMEFCGGGSLQDIY-QVTGPLTEVQIAYMCRETLKGLEYLHSMGKMHRDIKGANILLTEYGDVKLADFGVSAQITATINKRKSFIGTPYWMAPEVAAV-ERKGGYNQLCDIWACGITAIELAELQPPMFDLHPMRALFLMSKSGFKPPTLNNKDKWSPTFHNFIKTALTKNPKKRPTAERLLQHPFV-QCEMSLRVAKELLQ 297          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:ZFIN;Acc:ZDB-GENE-030616-163])

HSP 1 Score: 362.844 bits (930), Expect = 1.303e-114
Identity = 169/307 (55.05%), Postives = 227/307 (73.94%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKP 1292
            V+  +P D+Y++I  IGSGTYGDV+KA +++S    AIKI+K+D  DD+T+I QEI  ++ECKH NIV ++G+Y + +KLWICMEYCGG S+QDIY  +  P+ E  IA+I RETL+GL+++H+ G+IHRDIKGANILLTD GDVK+ADFG+AA++S++VAKR + IGTPYWMAPEVAAV  + GGY+  CD+WAVGITAIE AELQPP+FDLHPM+AL ++++ ++  PKL+ K  W A FHSF++  L K+ +KRP  ET+L H FVTQ      + + L   NN D   P   +   +  D  P
Sbjct:    6 VSFLDPLDDYEIIQRIGSGTYGDVFKARNIRSSEMAAIKIVKLDPGDDITSIQQEITMMKECKHKNIVAYYGTYHRNTKLWICMEYCGGGSLQDIY-QVTGPLKEKQIAYICRETLQGLNHLHETGKIHRDIKGANILLTDRGDVKLADFGVAAEISASVAKRKSFIGTPYWMAPEVAAVEKK-GGYNHLCDIWAVGITAIELAELQPPMFDLHPMRALMLMSKSSFQSPKLKDKSKWCAGFHSFVKMCLIKSPRKRPTAETLLQHPFVTQLLTRKLMIELLDMANNPDLHRPTSPEENEEANDTAP 310          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: map4k6 (mitogen-activated protein kinase kinase kinase kinase 6 [Source:ZFIN;Acc:ZDB-GENE-060512-339])

HSP 1 Score: 362.073 bits (928), Expect = 4.505e-114
Identity = 162/291 (55.67%), Postives = 228/291 (78.35%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYK 1244
            V+H++P D+Y+LI  IGSGTYGDV+KA  +K+    AIK++K+D  DD+++I  EI  +++C H NIV +FGSYL+ +KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+GL ++H+ G++HRDIKGANILLT+ GDVK+ADFG+AA+++++VAKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGITAIE AELQPP+FDLHPM+AL ++++ ++ PPKL++K  WS +FHSF++ AL KN +KRP  E +L H FV Q      + + L  +NN D +
Sbjct:    6 VSHTDPLDDYELIHRIGSGTYGDVFKARSIKTSVIAAIKVVKLDPGDDISSIQNEITMMKDCTHKNIVAYFGSYLRNNKLWICMEFCGGGSLQDIY-HVTGPLKERQIAYVSRETLQGLHHLHQTGKMHRDIKGANILLTERGDVKLADFGVAAEINASVAKRKSFIGTPYWMAPEVAAVEKK-GGYNQLCDIWAVGITAIELAELQPPMFDLHPMRALMLMSKSSFQPPKLKEKNKWSTEFHSFIKMALTKNPRKRPTAEKILQHAFVMQLLTRNLVIELLDTVNNPDLQ 294          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-6497])

HSP 1 Score: 358.607 bits (919), Expect = 6.636e-113
Identity = 166/290 (57.24%), Postives = 219/290 (75.52%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            +   NP+ +++LI  +GSGTYGDVYKA  + +    A+KI+K++  DD + I QEI  ++EC H NIV +FGSYL   KLWICMEYCGG S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY+  CD+WAVGIT+IE AELQPP+FDLHPM+AL ++++  + PPKL+ K  WS  FH+F++ +L KN K+RP  E ML+H FV Q  L+  L   LL KMNN D
Sbjct:   11 IQRRNPQHDFELIQRVGSGTYGDVYKARKISTGELAAVKIIKLEPGDDFSIIQQEIFMVKECTHHNIVAYFGSYLCREKLWICMEYCGGGSLQDIY-HVTGPLSELQIAYVCRETLQGLGYLHSKGKMHRDIKGANILLTDNGDVKLADFGVAAKITATMAKRKSFIGTPYWMAPEVAAV-EKNGGYNHLCDIWAVGITSIELAELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSTAFHNFVKLSLTKNPKRRPTAEKMLSHLFVGQTGLTRRLALELLDKMNNPD 298          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: map4k3b (mitogen-activated protein kinase kinase kinase kinase 3b [Source:ZFIN;Acc:ZDB-GENE-090428-1])

HSP 1 Score: 350.517 bits (898), Expect = 1.425e-109
Identity = 168/311 (54.02%), Postives = 230/311 (73.95%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKDYKIPLGKQNEMKPKDVKPATP 1301
            ++  NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWI MEYCGG S+QDIY ++  P+ E  IA++ RETL+G+ Y+H +G+IHRDIKGANILLTD G VK+ADFG++A++S+T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGITAIE AEL+PP+FDLHPM+AL ++ + ++ PPKL+ K  W+  FH F++ AL KN KKRP  + +L H FVTQ  LS TL   LL K NN D+       ++ +  D+ P +P
Sbjct:    7 LSRRNPQEDFELIQRIGSGTYGDVYKARNVSTGELAAIKVIKLEPGEDFDVVQQEIIMMKDCKHSNIVAYFGSYLRRDKLWISMEYCGGGSLQDIY-HVTGPLSESQIAYVCRETLQGVYYLHNKGKIHRDIKGANILLTDNGYVKLADFGVSAQISATLAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDIWAVGITAIELAELEPPMFDLHPMRALFLMTKSSFQPPKLKDKVKWTNNFHHFVKMALTKNPKKRPTADRLLQHPFVTQP-LSRTLAIELLDKANNPDHST----HSDAEEDDIDPESP 310          
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Match: map4k3b (mitogen-activated protein kinase kinase kinase kinase 3b [Source:ZFIN;Acc:ZDB-GENE-090428-1])

HSP 1 Score: 348.977 bits (894), Expect = 6.466e-109
Identity = 167/311 (53.70%), Postives = 230/311 (73.95%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKDYKIPLGKQNEMKPKDVKPATP 1301
            ++  NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWI MEYCGG S+QDIY ++  P+ E  IA++ RETL+G+ Y+H +G+IHRDIKGANILLTD G VK+ADFG++A++S+T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGITAIE AEL+PP+FDLHPM++L ++ + ++ PPKL+ K  W+  FH F++ AL KN KKRP  + +L H FVTQ  LS TL   LL K NN D+       ++ +  D+ P +P
Sbjct:    7 LSRRNPQEDFELIQRIGSGTYGDVYKARNVSTGELAAIKVIKLEPGEDFDVVQQEIIMMKDCKHSNIVAYFGSYLRRDKLWISMEYCGGGSLQDIY-HVTGPLSESQIAYVCRETLQGVYYLHNKGKIHRDIKGANILLTDNGYVKLADFGVSAQISATLAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDIWAVGITAIELAELEPPMFDLHPMRSLFLMTKSSFQPPKLKDKVKWTNNFHHFVKMALTKNPKKRPTADRLLQHPFVTQP-LSRTLAIELLDKANNPDH----STHSDAEEDDIDPESP 310          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: hnrnpm (heterogeneous nuclear ribonucleoprotein M [Source:Xenbase;Acc:XB-GENE-993962])

HSP 1 Score: 350.903 bits (899), Expect = 9.482e-110
Identity = 163/288 (56.60%), Postives = 222/288 (77.08%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNN 1232
            ++  NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+GL Y+H +G++HRDIKGANILLTD G VK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGIT+IE AELQPP+FDLHPM+AL ++ +  + PPKL+ K  WS  FH F++ AL KN KKRP  E +L H F+TQ  L+ TL   LL K+NN
Sbjct:    7 LSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHTNIVAYFGSYLRRDKLWICMEFCGGGSLQDIY-HVTGPLSEQQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFIKMALTKNPKKRPTAEKLLQHPFLTQP-LNRTLAIELLDKVNN 291          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: hnrnpm (heterogeneous nuclear ribonucleoprotein M [Source:Xenbase;Acc:XB-GENE-993962])

HSP 1 Score: 350.903 bits (899), Expect = 1.279e-109
Identity = 163/288 (56.60%), Postives = 222/288 (77.08%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNN 1232
            ++  NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+GL Y+H +G++HRDIKGANILLTD G VK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGIT+IE AELQPP+FDLHPM+AL ++ +  + PPKL+ K  WS  FH F++ AL KN KKRP  E +L H F+TQ  L+ TL   LL K+NN
Sbjct:    7 LSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHTNIVAYFGSYLRRDKLWICMEFCGGGSLQDIY-HVTGPLSEQQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFIKMALTKNPKKRPTAEKLLQHPFLTQP-LNRTLAIELLDKVNN 291          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:NCBI gene;Acc:100216063])

HSP 1 Score: 345.51 bits (885), Expect = 1.389e-109
Identity = 164/299 (54.85%), Postives = 217/299 (72.58%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            P+ D +R+     NP+ +++L+  +GSGTYGDVYKA ++++    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYCGG S+QDIY  +                + GL Y+H RG++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGITAIE AELQPP+FDLHPM+AL ++++  + PPKL++K  WS  FH+F++ +L KN KKRP  E +LTH FV Q  LS  + Q LL K NN D
Sbjct:    8 PSADILRK-----NPQHDFELVQRVGSGTYGDVYKARNLQTGELAAVKIIKLEQGDDFSLIQQEIFMVKECKHANIVAYFGSYLSREKLWICMEYCGGGSLQDIYHGI--------------SIVHGLGYLHSRGKMHRDIKGANILLTDNGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVE-KNGGYNQLCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSNFQPPKLKEKMKWSQSFHNFVKVSLIKNPKKRPPAERLLTHQFVVQPGLSRIVAQELLDKFNNPD 286          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:NCBI gene;Acc:100216063])

HSP 1 Score: 295.819 bits (756), Expect = 2.334e-89
Identity = 147/299 (49.16%), Postives = 202/299 (67.56%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            P+ D +R+     NP+ +++L+  +GSGTYGDVYKA ++++    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYCGG S+QDIY ++ + I    I      +L  L     R  +    KG ++          +DFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGITAIE AELQPP+FDLHPM+AL ++++  + PPKL++K  WS  FH+F++ +L KN KKRP  E +LTH FV Q  LS  + Q LL K NN D
Sbjct:    8 PSADILRK-----NPQHDFELVQRVGSGTYGDVYKARNLQTGELAAVKIIKLEQGDDFSLIQQEIFMVKECKHANIVAYFGSYLSREKLWICMEYCGGGSLQDIY-HVTKVIYSGIIVITAYYSLTVL-----RSVVVEVTKGCHV----------SDFGVAAKITATIAKRKSFIGTPYWMAPEVAAVE-KNGGYNQLCDIWAVGITAIELAELQPPMFDLHPMRALFLMSKSNFQPPKLKEKMKWSQSFHNFVKVSLIKNPKKRPPAERLLTHQFVVQPGLSRIVAQELLDKFNNPD 284          
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Match: hnrnpm (heterogeneous nuclear ribonucleoprotein M [Source:Xenbase;Acc:XB-GENE-993962])

HSP 1 Score: 287.345 bits (734), Expect = 2.929e-88
Identity = 144/288 (50.00%), Postives = 198/288 (68.75%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNN 1232
            ++  NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+                    LL  L      DFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGIT+IE AELQPP+FDLHPM+AL ++ +  + PPKL+ K  WS  FH F++ AL KN KKRP  E +L H F+TQ  L+ TL   LL K+NN
Sbjct:    7 LSRRNPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHTNIVAYFGSYLRRDKLWICMEFCGGGSLQDIY-HVTGPLSEQQIAYVSRETLQ-------------VTSAVTFLLRYL-----TDFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFIKMALTKNPKKRPTAEKLLQHPFLTQP-LNRTLAIELLDKVNN 273          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:MGI Symbol;Acc:MGI:1925503])

HSP 1 Score: 367.851 bits (943), Expect = 1.286e-116
Identity = 175/317 (55.21%), Postives = 235/317 (74.13%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKDYKIPL--GKQNEMKPKDV 1286
            P  D +R+     NP+ +Y+L+  +GSGTYGDVYKA +V +    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYCGG S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGITAIE  ELQPP+FDLHPM+AL ++++  + PPKL+ K  WS+ FH+F++ AL KN KKRP  E +LTH FV Q  LS  L   LL K++N D   P   G +++++P  +
Sbjct:    7 PAADILRR-----NPQHDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIY-HVTGPLSEMQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVE-KNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVGQPGLSRALAVELLDKVSNPDNHAPYSEGDEDDLEPHAI 316          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:MGI Symbol;Acc:MGI:1925503])

HSP 1 Score: 367.851 bits (943), Expect = 1.399e-116
Identity = 175/317 (55.21%), Postives = 235/317 (74.13%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKDYKIPL--GKQNEMKPKDV 1286
            P  D +R+     NP+ +Y+L+  +GSGTYGDVYKA +V +    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYCGG S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGITAIE  ELQPP+FDLHPM+AL ++++  + PPKL+ K  WS+ FH+F++ AL KN KKRP  E +LTH FV Q  LS  L   LL K++N D   P   G +++++P  +
Sbjct:    7 PAADILRR-----NPQHDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIY-HVTGPLSEMQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVE-KNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVGQPGLSRALAVELLDKVSNPDNHAPYSEGDEDDLEPHAI 316          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:MGI Symbol;Acc:MGI:1925503])

HSP 1 Score: 362.844 bits (930), Expect = 6.075e-115
Identity = 169/292 (57.88%), Postives = 221/292 (75.68%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL 1220
            P  D +R+     NP+ +Y+L+  +GSGTYGDVYKA +V +    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYCGG S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGITAIE  ELQPP+FDLHPM+AL ++++  + PPKL+ K  WS+ FH+F++ AL KN KKRP  E +LTH FV Q  LS  L   LL
Sbjct:    7 PAADILRR-----NPQHDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIY-HVTGPLSEMQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVE-KNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVGQPGLSRALAVELL 291          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Map4k3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:2154405])

HSP 1 Score: 352.443 bits (903), Expect = 1.445e-110
Identity = 183/404 (45.30%), Postives = 257/404 (63.61%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQYSTPATEVRYIKNNHXXXXXXXXLKEP------ENHSIFYKKDNGQVNPELYQSPPITNDDDDFMVSLDNELQKRGHRSLL 1538
            P  D  R+     NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+GL Y+H +G++HRDIKGANILLTD G VK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGITAIE AELQPP+FDLHPM+AL ++ +  + PPKL+ K  WS  FH F++ AL KN KKRP  E +L H FVTQ        + L K+NN D+       ++    D +P      +  + +  VR  K              P       +H +  + + GQ     +QS      +   + S++ EL +RGH + L
Sbjct:    3 PGFDLSRR-----NPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIY-HVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKLKWSNSFHHFVKMALTKNPKKRPNAEKLLQHPFVTQPLTRSLAIELLDKVNNPDHST----YHDFDDDDPEPLVAVPHRIPSTSRNVREEKTRSEINFGQVKFDPPLRKETEPHHELDLQLEYGQG----HQSHCFLGGNKSLLKSVEEELHQRGHVAHL 391          
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Match: Map4k3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:MGI Symbol;Acc:MGI:2154405])

HSP 1 Score: 352.058 bits (902), Expect = 3.720e-110
Identity = 165/299 (55.18%), Postives = 222/299 (74.25%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDY 1241
            P  D  R+     NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+GL Y+H +G++HRDIKGANILLTD G VK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGITAIE AELQPP+FDLHPM+AL ++ +  + PPKL+ K  WS  FH F++ AL KN KKRP  E +L H FVTQ        + L K+NN D+
Sbjct:    3 PGFDLSRR-----NPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIY-HVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKLKWSNSFHHFVKMALTKNPKKRPNAEKLLQHPFVTQPLTRSLAIELLDKVNNPDH 294          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q8BPM2|M4K5_MOUSE (Mitogen-activated protein kinase kinase kinase kinase 5 OS=Mus musculus OX=10090 GN=Map4k5 PE=1 SV=2)

HSP 1 Score: 367.851 bits (943), Expect = 9.787e-116
Identity = 175/317 (55.21%), Postives = 235/317 (74.13%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKDYKIPL--GKQNEMKPKDV 1286
            P  D +R+     NP+ +Y+L+  +GSGTYGDVYKA +V +    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYCGG S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGITAIE  ELQPP+FDLHPM+AL ++++  + PPKL+ K  WS+ FH+F++ AL KN KKRP  E +LTH FV Q  LS  L   LL K++N D   P   G +++++P  +
Sbjct:    7 PAADILRR-----NPQHDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIY-HVTGPLSEMQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVE-KNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVGQPGLSRALAVELLDKVSNPDNHAPYSEGDEDDLEPHAI 316          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q9Y4K4|M4K5_HUMAN (Mitogen-activated protein kinase kinase kinase kinase 5 OS=Homo sapiens OX=9606 GN=MAP4K5 PE=1 SV=2)

HSP 1 Score: 367.081 bits (941), Expect = 1.883e-115
Identity = 173/299 (57.86%), Postives = 226/299 (75.59%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            P  D +R+     NP+ +Y+L+  +GSGTYGDVYKA +V +    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYCGG S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGITAIE  ELQPP+FDLHPM+AL ++++  + PPKL+ K  WS+ FH+F++ AL KN KKRP  E +LTH FV Q  LS  L   LL K+NN D
Sbjct:    7 PAADILRR-----NPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVKECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIY-HVTGPLSELQIAYVCRETLQGLAYLHTKGKMHRDIKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVE-KNGGYNQLCDIWAVGITAIELGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVAQPGLSRALAVELLDKVNNPD 298          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q8IVH8|M4K3_HUMAN (Mitogen-activated protein kinase kinase kinase kinase 3 OS=Homo sapiens OX=9606 GN=MAP4K3 PE=1 SV=1)

HSP 1 Score: 355.525 bits (911), Expect = 1.231e-110
Identity = 169/300 (56.33%), Postives = 227/300 (75.67%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKDY 1241
            P  D  R+     NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+GL Y+H +G++HRDIKGANILLTD G VK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGITAIE AELQPP+FDLHPM+AL ++ +  + PPKL+ K  WS  FH F++ AL KN KKRP  E +L H FVTQ HL+ +L   LL K+NN D+
Sbjct:    3 PGFDLSRR-----NPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIY-HVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKMKWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQ-HLTRSLAIELLDKVNNPDH 294          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q924I2|M4K3_RAT (Mitogen-activated protein kinase kinase kinase kinase 3 OS=Rattus norvegicus OX=10116 GN=Map4k3 PE=1 SV=2)

HSP 1 Score: 352.829 bits (904), Expect = 7.935e-110
Identity = 183/404 (45.30%), Postives = 257/404 (63.61%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQYSTPATEVRYIKNNHXXXXXXXXLKEP------ENHSIFYKKDNGQVNPELYQSPPITNDDDDFMVSLDNELQKRGHRSLL 1538
            P  D  R+     NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+GL Y+H +G++HRDIKGANILLTD G VK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGITAIE AELQPP+FDLHPM+AL ++ +  + PPKL+ K  WS  FH F++ AL KN KKRP  E +L H FVTQ        + L K+NN D+       ++    D +P      +  + +  VR  K              P       +H +  + + GQ     +QS      +   + S++ EL +RGH + L
Sbjct:    3 PGFDLSRR-----NPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHANIVAYFGSYLRRDKLWICMEFCGGGSLQDIY-HVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKLKWSNSFHHFVKMALTKNPKKRPTAEKLLQHPFVTQPLTRSLAIELLDKVNNPDHST----YHDFDDDDPEPLVAVPHRIPSTSRNVREEKTRSEINFGQVKFDPPLRKETEPHHELDLQLEYGQG----HQSNYFLGGNKSLLKSVEEELHQRGHVAHL 391          
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Match: sp|Q99JP0|M4K3_MOUSE (Mitogen-activated protein kinase kinase kinase kinase 3 OS=Mus musculus OX=10090 GN=Map4k3 PE=1 SV=4)

HSP 1 Score: 352.058 bits (902), Expect = 2.602e-109
Identity = 165/299 (55.18%), Postives = 222/299 (74.25%), Query Frame = 3
Query:  345 PNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDY 1241
            P  D  R+     NP+++++LI  IGSGTYGDVYKA +V +    AIK++K++  +D   + QEI  +++CKH NIV +FGSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA+++RETL+GL Y+H +G++HRDIKGANILLTD G VK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY++ CD+WAVGITAIE AELQPP+FDLHPM+AL ++ +  + PPKL+ K  WS  FH F++ AL KN KKRP  E +L H FVTQ        + L K+NN D+
Sbjct:    3 PGFDLSRR-----NPQEDFELIQRIGSGTYGDVYKARNVNTGELAAIKVIKLEPGEDFAVVQQEIIMMKDCKHPNIVAYFGSYLRRDKLWICMEFCGGGSLQDIY-HVTGPLSELQIAYVSRETLQGLYYLHSKGKMHRDIKGANILLTDNGHVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNQLCDLWAVGITAIELAELQPPMFDLHPMRALFLMTKSNFQPPKLKDKLKWSNSFHHFVKMALTKNPKKRPNAEKLLQHPFVTQPLTRSLAIELLDKVNNPDH 294          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: G4V603 (Serine/threonine kinase OS=Schistosoma mansoni OX=6183 GN=Smp_005200 PE=4 SV=1)

HSP 1 Score: 461.455 bits (1186), Expect = 3.184e-152
Identity = 203/295 (68.81%), Postives = 248/295 (84.07%), Query Frame = 3
Query:  336 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL 1220
            M HP +DY+RQFV  ++PK+EYK+++ IGSGTYGDV+KA+H + +  VA+K+MKIDLKDD+ +ICQEIHTLREC+H NIVQF+GSYL+ +KLWICMEYCGGQSMQDIYL  RRP+ EDCIAF++RETL+GL++MH RGRIHRDIKGANILLTD G VK+ADFG+AA+LS+++AKRTTLIGTPYWMAPEVA++ +R  GYD +CD+W VGITAIEYAELQPP+FDL P KALQIL  R Y PP LQ +  WS  FHSF++  L K E++RP   TMLTH+F+T  HLS  LTQ LL
Sbjct:    1 MNHPKLDYLRQFVKPNDPKEEYKILAPIGSGTYGDVFKAVHRERRTLVAVKVMKIDLKDDIRSICQEIHTLRECRHPNIVQFYGSYLRNNKLWICMEYCGGQSMQDIYLYTRRPLEEDCIAFVSRETLQGLNFMHNRGRIHRDIKGANILLTDDGHVKVADFGVAAQLSTSIAKRTTLIGTPYWMAPEVASIESRGSGYDGKCDIWGVGITAIEYAELQPPMFDLDPRKALQILGSRNYKPPSLQDRHKWSPLFHSFIKCCLIKAERRRPDAATMLTHNFITNPHLSTLLTQRLL 295          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: Q5BW36 (SJCHGC05877 protein (Fragment) OS=Schistosoma japonicum OX=6182 PE=2 SV=2)

HSP 1 Score: 447.973 bits (1151), Expect = 2.472e-148
Identity = 199/287 (69.34%), Postives = 241/287 (83.97%), Query Frame = 3
Query:  360 IRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL 1220
            +RQFV  ++PK+EYK++S IGSGTYGDV+KA+H + +  VA+K+MKIDLKDD+ +ICQEIHTLREC+H NIVQF+GSYL+ +KLWICMEYCGGQSMQDIYL  RRP+ EDCIAF++RETL+GL++MH RGRIHRDIKGANILLTD G VK+ADFG+AA+LS+++AKRTTLIGTPYWMAPEVA++  R  GYD +CD+W VGITAIEYAELQPP+FDL P KALQIL  R Y PP LQ +  WS  FHSF++  L K E++RP   TMLTH+F+T  HLS  LTQ LL
Sbjct:    1 LRQFVKPNDPKEEYKILSPIGSGTYGDVFKAVHRERRTLVAVKVMKIDLKDDIRSICQEIHTLRECRHPNIVQFYGSYLRNNKLWICMEYCGGQSMQDIYLYTRRPLEEDCIAFVSRETLQGLNFMHNRGRIHRDIKGANILLTDDGHVKVADFGVAAQLSTSIAKRTTLIGTPYWMAPEVASIECRGSGYDGKCDIWGVGITAIEYAELQPPMFDLDPRKALQILGSRNYKPPSLQDRHKWSPLFHSFVKCCLIKAERRRPDAATMLTHNFITNPHLSTLLTQRLL 287          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4Z2CWM1 (Non-specific serine/threonine protein kinase OS=Schistosoma japonicum OX=6182 GN=EWB00_006828 PE=3 SV=1)

HSP 1 Score: 459.529 bits (1181), Expect = 2.114e-147
Identity = 204/295 (69.15%), Postives = 248/295 (84.07%), Query Frame = 3
Query:  336 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL 1220
            M+HP +DY+RQFV  ++PK+EYK++S IGSGTYGDV+KA+H + +  VA+K+MKIDLKDD+ +ICQEIHTLREC+H NIVQF+GSYL+ +KLWICMEYCGGQSMQDIYL  RRP+ EDCIAF++RETL+GL++MH RGRIHRDIKGANILLTD G VK+ADFG+AA+LS+++AKRTTLIGTPYWMAPEVA++  R  GYD +CD+W VGITAIEYAELQPP+FDL P KALQIL  R Y PP LQ +  WS  FHSF++  L K E++RP   TMLTH+F+T  HLS  LTQ LL
Sbjct:    1 MSHPKLDYLRQFVKPNDPKEEYKILSPIGSGTYGDVFKAVHRERRTLVAVKVMKIDLKDDIRSICQEIHTLRECRHPNIVQFYGSYLRNNKLWICMEYCGGQSMQDIYLYTRRPLEEDCIAFVSRETLQGLNFMHNRGRIHRDIKGANILLTDDGHVKVADFGVAAQLSTSIAKRTTLIGTPYWMAPEVASIECRGSGYDGKCDIWGVGITAIEYAELQPPMFDLDPRKALQILGSRNYKPPSLQDRHKWSPLFHSFVKCCLIKAERRRPDAATMLTHNFITNPHLSTLLTQRLL 295          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A4Z2CXG2 (Non-specific serine/threonine protein kinase OS=Schistosoma japonicum OX=6182 GN=EWB00_006828 PE=3 SV=1)

HSP 1 Score: 462.996 bits (1190), Expect = 4.111e-147
Identity = 204/295 (69.15%), Postives = 248/295 (84.07%), Query Frame = 3
Query:  336 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL 1220
            M+HP +DY+RQFV  ++PK+EYK++S IGSGTYGDV+KA+H + +  VA+K+MKIDLKDD+ +ICQEIHTLREC+H NIVQF+GSYL+ +KLWICMEYCGGQSMQDIYL  RRP+ EDCIAF++RETL+GL++MH RGRIHRDIKGANILLTD G VK+ADFG+AA+LS+++AKRTTLIGTPYWMAPEVA++  R  GYD +CD+W VGITAIEYAELQPP+FDL P KALQIL  R Y PP LQ +  WS  FHSF++  L K E++RP   TMLTH+F+T  HLS  LTQ LL
Sbjct:    1 MSHPKLDYLRQFVKPNDPKEEYKILSPIGSGTYGDVFKAVHRERRTLVAVKVMKIDLKDDIRSICQEIHTLRECRHPNIVQFYGSYLRNNKLWICMEYCGGQSMQDIYLYTRRPLEEDCIAFVSRETLQGLNFMHNRGRIHRDIKGANILLTDDGHVKVADFGVAAQLSTSIAKRTTLIGTPYWMAPEVASIECRGSGYDGKCDIWGVGITAIEYAELQPPMFDLDPRKALQILGSRNYKPPSLQDRHKWSPLFHSFVKCCLIKAERRRPDAATMLTHNFITNPHLSTLLTQRLL 295          
BLAST of Serine/threonine kinase vs. TrEMBL
Match: A0A3Q0KBT9 (Non-specific serine/threonine protein kinase OS=Schistosoma mansoni OX=6183 PE=3 SV=1)

HSP 1 Score: 459.914 bits (1182), Expect = 5.660e-147
Identity = 203/295 (68.81%), Postives = 248/295 (84.07%), Query Frame = 3
Query:  336 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL 1220
            M HP +DY+RQFV  ++PK+EYK+++ IGSGTYGDV+KA+H + +  VA+K+MKIDLKDD+ +ICQEIHTLREC+H NIVQF+GSYL+ +KLWICMEYCGGQSMQDIYL  RRP+ EDCIAF++RETL+GL++MH RGRIHRDIKGANILLTD G VK+ADFG+AA+LS+++AKRTTLIGTPYWMAPEVA++ +R  GYD +CD+W VGITAIEYAELQPP+FDL P KALQIL  R Y PP LQ +  WS  FHSF++  L K E++RP   TMLTH+F+T  HLS  LTQ LL
Sbjct:    1 MNHPKLDYLRQFVKPNDPKEEYKILAPIGSGTYGDVFKAVHRERRTLVAVKVMKIDLKDDIRSICQEIHTLRECRHPNIVQFYGSYLRNNKLWICMEYCGGQSMQDIYLYTRRPLEEDCIAFVSRETLQGLNFMHNRGRIHRDIKGANILLTDDGHVKVADFGVAAQLSTSIAKRTTLIGTPYWMAPEVASIESRGSGYDGKCDIWGVGITAIEYAELQPPMFDLDPRKALQILGSRNYKPPSLQDRHKWSPLFHSFIKCCLIKAERRRPDAATMLTHNFITNPHLSTLLTQRLL 295          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:NCBI gene;Acc:103022354])

HSP 1 Score: 362.459 bits (929), Expect = 3.380e-114
Identity = 167/290 (57.59%), Postives = 221/290 (76.21%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            +   NP+ +++LI  +GSGTYGDVYKA ++ +    A+KI+K++  DD + I QEI  ++EC H NIV +FGSYL   KLWICMEYCGG S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGIT+IE AELQPP+FDLHPM+AL ++++ ++ PPKL+ K  WS  FH+FL+ +L KN KKRP  E +L H FV Q  L+  L   LL KMNN D
Sbjct:   11 IQRRNPQHDFELIQRVGSGTYGDVYKARNISTGELAAVKIIKLEPGDDFSIIQQEIFMVKECTHHNIVAYFGSYLCREKLWICMEYCGGGSLQDIY-HVTGPLSEHQIAYVCRETLQGLGYLHSKGKMHRDIKGANILLTDNGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAV-EKNGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMSKSSFQPPKLKDKMKWSTAFHNFLKVSLTKNPKKRPTAEKLLMHMFVAQTGLTRRLAVELLDKMNNPD 298          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:NCBI gene;Acc:103033234])

HSP 1 Score: 360.918 bits (925), Expect = 4.058e-114
Identity = 168/287 (58.54%), Postives = 225/287 (78.40%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNN 1232
            V+  +P D+Y+++  IG+GTYGDV+KA  +K+    AIKI+K+D  DD+++I QEI T++ECKH NIV ++GSY + +KLWICMEYCGG S+QDIY ++  P+ E  IA+I RETL+GL+++H+ G+IHRDIKGANILLT+ GDVK+ADFG+AA++S++VAKR + IGTPYWMAPEVAAV  + GGY+  CD+WAVGITAIE AELQPP+FDLHPMKAL ++++ ++ PPKL+ K  WS  FHSF++  L K+ +KRP  ET+L H FVTQ  L+  L   LL M N
Sbjct:    6 VSFLDPLDDYEILHRIGNGTYGDVFKARSIKTSEIAAIKIVKLDPGDDISSIQQEITTMKECKHKNIVAYYGSYHRNTKLWICMEYCGGGSLQDIY-HVTGPLKEKQIAYICRETLQGLNHLHETGKIHRDIKGANILLTERGDVKLADFGVAAEISASVAKRKSFIGTPYWMAPEVAAVEKK-GGYNHLCDIWAVGITAIELAELQPPMFDLHPMKALMLMSKSSFQPPKLKDKAKWSPGFHSFVKMCLTKSPRKRPTAETLLQHPFVTQ-LLTRNLVIELLDMAN 289          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:NCBI gene;Acc:103022354])

HSP 1 Score: 362.459 bits (929), Expect = 4.473e-114
Identity = 167/290 (57.59%), Postives = 221/290 (76.21%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            +   NP+ +++LI  +GSGTYGDVYKA ++ +    A+KI+K++  DD + I QEI  ++EC H NIV +FGSYL   KLWICMEYCGG S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGIT+IE AELQPP+FDLHPM+AL ++++ ++ PPKL+ K  WS  FH+FL+ +L KN KKRP  E +L H FV Q  L+  L   LL KMNN D
Sbjct:   11 IQRRNPQHDFELIQRVGSGTYGDVYKARNISTGELAAVKIIKLEPGDDFSIIQQEIFMVKECTHHNIVAYFGSYLCREKLWICMEYCGGGSLQDIY-HVTGPLSEHQIAYVCRETLQGLGYLHSKGKMHRDIKGANILLTDNGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAV-EKNGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMSKSSFQPPKLKDKMKWSTAFHNFLKVSLTKNPKKRPTAEKLLMHMFVAQTGLTRRLAVELLDKMNNPD 298          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:NCBI gene;Acc:103033234])

HSP 1 Score: 360.918 bits (925), Expect = 4.870e-114
Identity = 168/287 (58.54%), Postives = 225/287 (78.40%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNN 1232
            V+  +P D+Y+++  IG+GTYGDV+KA  +K+    AIKI+K+D  DD+++I QEI T++ECKH NIV ++GSY + +KLWICMEYCGG S+QDIY ++  P+ E  IA+I RETL+GL+++H+ G+IHRDIKGANILLT+ GDVK+ADFG+AA++S++VAKR + IGTPYWMAPEVAAV  + GGY+  CD+WAVGITAIE AELQPP+FDLHPMKAL ++++ ++ PPKL+ K  WS  FHSF++  L K+ +KRP  ET+L H FVTQ  L+  L   LL M N
Sbjct:    6 VSFLDPLDDYEILHRIGNGTYGDVFKARSIKTSEIAAIKIVKLDPGDDISSIQQEITTMKECKHKNIVAYYGSYHRNTKLWICMEYCGGGSLQDIY-HVTGPLKEKQIAYICRETLQGLNHLHETGKIHRDIKGANILLTERGDVKLADFGVAAEISASVAKRKSFIGTPYWMAPEVAAVEKK-GGYNHLCDIWAVGITAIELAELQPPMFDLHPMKALMLMSKSSFQPPKLKDKAKWSPGFHSFVKMCLTKSPRKRPTAETLLQHPFVTQ-LLTRNLVIELLDMAN 289          
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Match: map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:NCBI gene;Acc:103022354])

HSP 1 Score: 362.459 bits (929), Expect = 5.430e-114
Identity = 167/290 (57.59%), Postives = 221/290 (76.21%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            +   NP+ +++LI  +GSGTYGDVYKA ++ +    A+KI+K++  DD + I QEI  ++EC H NIV +FGSYL   KLWICMEYCGG S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGIT+IE AELQPP+FDLHPM+AL ++++ ++ PPKL+ K  WS  FH+FL+ +L KN KKRP  E +L H FV Q  L+  L   LL KMNN D
Sbjct:   11 IQRRNPQHDFELIQRVGSGTYGDVYKARNISTGELAAVKIIKLEPGDDFSIIQQEIFMVKECTHHNIVAYFGSYLCREKLWICMEYCGGGSLQDIY-HVTGPLSEHQIAYVCRETLQGLGYLHSKGKMHRDIKGANILLTDNGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAV-EKNGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMSKSSFQPPKLKDKMKWSTAFHNFLKVSLTKNPKKRPTAEKLLMHMFVAQTGLTRRLAVELLDKMNNPD 298          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: MAP4K3 (mitogen-activated protein kinase kinase kinase kinase 3 [Source:HGNC Symbol;Acc:HGNC:6865])

HSP 1 Score: 350.903 bits (899), Expect = 1.119e-110
Identity = 159/265 (60.00%), Postives = 213/265 (80.38%), Query Frame = 3
Query:  390 KDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQ 1184
            +++++L   +GSGTYGDV+KA +V++   VAIKI+K++  DD + I QEI  ++ECKH NIV ++GSYL+  KLWICME+CGG S+QDIY ++  P+ E  IA++TRETL+GL Y+H  G++HRDIKGANILLTD GDVK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY+ +CDVWAVGITAIE AELQPP+FDLHPM+AL ++++  + PPKL+ K+ WS  FH+F++ AL KN KKRP  E MLTH +V Q
Sbjct:   11 QEDFELAERLGSGTYGDVHKARNVQTGELVAIKIIKLEPGDDFSVIQQEIVMMKECKHTNIVAYYGSYLRHDKLWICMEHCGGGSLQDIY-HVTGPLTERQIAYVTRETLQGLAYLHSEGKMHRDIKGANILLTDDGDVKLADFGVSAQITATIAKRKSFIGTPYWMAPEVAAVE-RKGGYNHQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSGFQPPKLRDKQKWSPVFHNFIKMALTKNPKKRPTAEKMLTHSYVQQ 273          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010511.1 (pep scaffold:Pmarinus_7.0:GL476756:358747:414819:1 gene:ENSPMAG00000009510.1 transcript:ENSPMAT00000010511.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 313.538 bits (802), Expect = 1.457e-96
Identity = 147/259 (56.76%), Postives = 201/259 (77.61%), Query Frame = 3
Query:  444 YKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL 1220
            ++A +V+S    AIK++K++  DD T I QEI  ++EC+H NIV +FGSYL+  KLWICMEYCGG S+QDIY ++  P+ E  IA+++RETLKGL Y+H + ++HRDIKGANILLTD G+VK+ADFG++A++++T+AKR + IGTPYWMAPEVAAV  R GGY+++CDVWAVGITAIE AELQPP+FDLHPM+AL ++++  + PP+L+ K  WS  FH+F++ +L KN KKRP  + +L   FV Q  L+ +L   LL
Sbjct:    1 FQARNVQSGALSAIKVIKLESGDDFTVIQQEIIMMQECQHINIVAYFGSYLRWDKLWICMEYCGGGSLQDIY-HVTGPLSERQIAYVSRETLKGLAYLHSKCKMHRDIKGANILLTDHGEVKLADFGVSAQITATIAKRMSFIGTPYWMAPEVAAV-ERKGGYNQQCDVWAVGITAIELAELQPPMFDLHPMRALFLMSKSNFQPPRLKDKVKWSGIFHNFIKQSLIKNPKKRPTADKLLQDPFVIQP-LNRSLATELL 256          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: stk25a (serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-GENE-041010-92])

HSP 1 Score: 214.157 bits (544), Expect = 1.893e-63
Identity = 113/269 (42.01%), Postives = 168/269 (62.45%), Query Frame = 3
Query:  381 SNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQ-EIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKG--ANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFV 1178
            ++P++ +     IG G++G+V+K +  +++  VAIKI+ ++  +D     Q EI  L +C    +  +FGSYL+ +KLWI MEY GG S  D+      P+ E  IA I RE LKGLDY+H   +IHRDIKG  AN+LL++ GDVK+ADFG+A +L+ T  KR T +GTP+WMAPEV     +   YD + D+W++GITAIE A+ +PP  +LHPM+ L ++ +    PP L+    +S  F  F+   L K+ + RP  + +L H F+
Sbjct:   20 ADPEELFTKQERIGKGSFGEVFKGIDNRTKEVVAIKIIDLEEAEDEIEDIQQEITVLSQCDSPYVTHYFGSYLKGTKLWIIMEYLGGGSALDLIKP--GPLEEHQIATILREILKGLDYLHSERKIHRDIKGPAANVLLSEQGDVKLADFGVAGQLTDTQIKRNTFVGTPFWMAPEVI----KQSAYDFKADIWSLGITAIELAKGEPPNSELHPMRVLFLIPKN--NPPTLEGN--YSKAFKEFVDSCLNKDPQFRPTAKELLKHKFI 278          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000169.1 (pep scaffold:Pmarinus_7.0:GL478331:850:46844:1 gene:ENSPMAG00000000147.1 transcript:ENSPMAT00000000169.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 209.534 bits (532), Expect = 9.446e-59
Identity = 110/256 (42.97%), Postives = 163/256 (63.67%), Query Frame = 3
Query:  447 KAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRE-CKHDNIVQFFGSYLQAS------KLWICMEYCGGQSMQDIYLNLR-RPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVN-NRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQE 1187
            +  HVK+    AIK+M +  +D+   I  EI+ L++   H NI  ++G++++ S      +LW+ ME+CG  S+ D+  N +   + ED IA+I RE L+GL ++H    IHRDIKG N+LLT+  +VK+ DFG++A+L  TV +R T IGTPYWMAPEV A + N    YD R D+W++G+TAIE AE  PPL D+HPM+AL ++ +    PP+L+ K+ WS +F SF    L KN  +R   E +L H F+ ++
Sbjct:    1 QGRHVKTGQLAAIKVMDV-TEDEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSVTDLVKNTKGNSLKEDWIAYICREILRGLSHLHAHRVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDRTVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSLGVTAIEMAEGAPPLCDMHPMRALFLIPR--NPPPRLKSKK-WSKRFLSFAESCLVKNYLQRLPTEQLLKHPFIREQ 252          
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Match: slka (STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-050411-66])

HSP 1 Score: 210.69 bits (535), Expect = 2.307e-58
Identity = 106/277 (38.27%), Postives = 166/277 (59.93%), Query Frame = 3
Query:  354 DYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNN-RTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVT 1181
            D++R+ V+   P + + +I E+G G +G VYKA + +S    A K+++   ++++     EI  L  C H NIV    ++   +KLWI +E+C G ++  I L L R + E  I  + ++ L+ L+Y+H    IHRD+K  NILLT  GDVK+ADFG++AK + T+ +R + IGTPYWMAPEV      +   YD + D+W++GIT IE A+++PP  +L+PM+ +  +A+    PP L     WSA+F  FL+  L KN + R     +L H F++
Sbjct:   21 DHVRRDVD---PAELWSVIGELGDGAFGKVYKAQNKESGVLAAAKVIETKSEEELEDYMVEIEILALCDHPNIVGLLNAFYYENKLWIFIEFCPGGAVDAIMLELERGLAEPQIRVVCKQMLEALNYLHTHRIIHRDLKAGNILLTFEGDVKLADFGVSAKNTRTLQRRDSFIGTPYWMAPEVVMCETMKDAPYDYKADIWSLGITLIELAQMEPPNHELNPMRVMLKIAKN--DPPSLSFPSKWSAEFTDFLKKCLDKNPETRWNALQLLQHSFIS 292          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: SPS1 (Putative protein serine/threonine kinase; localizes to the nucleus and cytoplasm; required for efficient spore packaging, prospore membrane development and closure and localization of enzymes involved in spore wall synthesis; interacts with and required for Ssp1p phosphorylation and turnover; member of the GCKIII subfamily of STE20 kinases; multiply phosphorylated on S/T residues; interacts with 14-3-3 proteins, Bmh1p and Bmh2p; expressed at the end of meiosis [Source:SGD;Acc:S000002931])

HSP 1 Score: 197.978 bits (502), Expect = 4.484e-57
Identity = 112/277 (40.43%), Postives = 160/277 (57.76%), Query Frame = 3
Query:  387 PKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKD-DVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPII----EDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSIT 1202
            P   Y + S IG G +GDVYKA+   +Q  VAIK++ ++  D D+  + QEI  L E K   I  +  + L+   +WI MEYCGG S  D+   L+R  +    E+ ++FI  E   GL Y+H++ +IHRDIK ANILL + G VK+ DFG++  + ST+ KR T +GTPYWMAPEV        GY+E+ D+W++GIT  E  +  PPL    PMK +  L +R   PPKLQ    +S     F+   L K    RP    +L+ +FV  ++++IT
Sbjct:   14 PSKLYSIQSCIGRGNFGDVYKAVDRVTQEIVAIKVVNLEHSDEDIELLAQEIFFLAELKSPLITNYIATMLEDVSMWIVMEYCGGGSCSDL---LKRSYVNGLPEEKVSFIIHEVTLGLKYLHEQRKIHRDIKAANILLNEEGMVKLGDFGVSGHIRSTL-KRDTFVGTPYWMAPEVVCC--EVDGYNEKADIWSLGITTYELLKGLPPLSKYDPMKVMTNLPKR--KPPKLQGP--FSDAAKDFVAGCLVKTPADRPSAYNLLSFEFV--KNITIT 278          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 195.282 bits (495), Expect = 1.094e-53
Identity = 99/275 (36.00%), Postives = 154/275 (56.00%), Query Frame = 3
Query:  360 IRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQ 1184
            + +  +  +P  +Y  + +IG G  G VY A  + +   VAIK M ++ +     I  EI  ++  KH NIV F  SY+    LW+ MEY  G S+ D+  +    + E  I  + RETL GL+++H +G +HRDIK  NILL+  GD+K+ DFG  A+++    KRTT++GTPYWMAPEV +       Y  + D+W++GI  IE  E +PP  +  P++AL ++A  T   PKL++ E  S+    FL + L    + R     +L  +++T+
Sbjct:  607 LNEICSDGDPSTKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVMKGSKHPNIVNFIDSYVLKGDLWVIMEYMEGGSLTDVVTHCI--LTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGDIKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKE----YGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIA--TNGTPKLKEPENLSSSLKKFLDWCLCVEPEDRASATELLHDEYITE 873          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: KIC1 (Protein kinase of the PAK/Ste20 family, required for cell integrity; physically interacts with Cdc31p (centrin), which is a component of the spindle pole body; part of the RAM network that regulates cellular polarity and morphogenesis [Source:SGD;Acc:S000001144])

HSP 1 Score: 190.66 bits (483), Expect = 6.609e-52
Identity = 102/264 (38.64%), Postives = 155/264 (58.71%), Query Frame = 3
Query:  399 YKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDL-KDDVTAICQEIHTLRECKH-DNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRP--IIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFV 1178
            +K    IG G +G VYK  +VK+    AIK++ +D   D+V  + +EI  L   K   NI +++GSYL+ + LWI ME+C G S++    +L RP  I E  I  I RE L  L  +HK   IHRDIK AN+L+T+ G+VK+ DFG+AA+++ T  +R T+ GTPYWMAPEV         YD + D+W++GIT  E A   PP  D+  ++A+Q++ +    PP+L+ +  +S     F+   L ++ K+R   + +L   F+
Sbjct:   23 FKRTEVIGRGKFGVVYKGYNVKTGRVYAIKVLNLDSDSDEVEDVQREIQFLASLKQISNITRYYGSYLKDTSLWIIMEHCAGGSLR----SLLRPGKIDEKYIGVIMRELLVALKCIHKDNVIHRDIKAANVLITNEGNVKLCDFGVAAQVNQTSLRRQTMAGTPYWMAPEVIMEGVY---YDTKVDIWSLGITTYEIATGNPPYCDVEALRAMQLIIKS--KPPRLEDRS-YSTSLKEFIALCLDEDPKERLSADDLLKSKFI 276          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: CLA4 (Cdc42p-activated signal transducing kinase; member of the PAK (p21-activated kinase) family, along with Ste20p and Skm1p; involved in septin ring assembly, vacuole inheritance, cytokinesis, sterol uptake regulation; phosphorylates Cdc3p and Cdc10p; CLA4 has a paralog, SKM1, that arose from the whole genome duplication [Source:SGD;Acc:S000005242])

HSP 1 Score: 183.726 bits (465), Expect = 6.500e-50
Identity = 107/298 (35.91%), Postives = 157/298 (52.68%), Query Frame = 3
Query:  360 IRQFVNHSNPKDEYKLISEIGSGTYGDVYKA--MHVKSQ-----------------NYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASK-LWICMEYCGGQSMQDIYLNL------RRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDF 1175
            +++   +++P   +K+I + G G  G VY A   H+ ++                 + VAIK M +  +     I  EI  +++ +H NIV F  +YL+    LW+ ME+  G S+ DI  N         P+ E  IA+I RET +GL ++H +  IHRDIK  N+LL     VKI DFG  A+L+   +KR T++GTPYWMAPEV     +   YDE+ DVW++GI  IE  E +PP  +  P+KAL ++A  T   PKL+  E  S +   FL   L  + + R   E +L H F
Sbjct:  533 LKKVTVNADPSQCFKVIEKAGQGASGSVYLAERTHIPTESNMIELINNDIDEPHVGDKVAIKQMVLSKQPRKELIVNEILVMKDSRHKNIVNFLEAYLRTDDDLWVVMEFMEGGSLTDIIENSPTNDNSHSPLTEPQIAYIVRETCQGLKFLHDKHIIHRDIKSDNVLLDTRARVKITDFGFCARLTDKRSKRATMVGTPYWMAPEVV----KQREYDEKIDVWSLGIMTIEMLEGEPPYLNEDPLKALYLIA--TNGTPKLKHPESLSLEIKRFLSVCLCVDVRYRASTEELLHHGF 824          
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Match: SKM1 (Member of the PAK family of serine/threonine protein kinases; similar to Ste20p; involved in down-regulation of sterol uptake; proposed to be a downstream effector of Cdc42p during polarized growth; SKM1 has a paralog, CLA4, that arose from the whole genome duplication [Source:SGD;Acc:S000005473])

HSP 1 Score: 175.637 bits (444), Expect = 8.492e-48
Identity = 105/304 (34.54%), Postives = 160/304 (52.63%), Query Frame = 3
Query:  384 NPKDEYKLISEIGSGTYGDVYKAMHVK-----------------SQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYL-QASKLWICMEYCGGQSMQDIYLNLRR--------PIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQ----EHLSITL 1205
            NP+  ++L+ + G G  G VY +  +K                     VAIK +++  +     I  E+  + + + +NIV F  +Y+    +LW+ MEY  G  + DI   + R        P+ E+ +A+I +ET +GL ++H +  IHRDIK  NILL   G VKI DFG   +L+   +KR T++GTPYWMAPE+  VN +  GYDE+ DVW++GI  IE  E +PP  +  P+KAL ++A      PKL+  E  S +   FL   L  N + R     +LT +F++     E L ++L
Sbjct:  355 NPRPYFQLVEKAGQGASGAVYLSKRIKLPQENDPRFLKSHCHRVVGERVAIKQIRLSEQPKKQLIMNELLVMNDSRQENIVNFLEAYIIDDEELWVIMEYMEGGCLTDILDAVARSNTGEHSSPLNENQMAYIVKETCQGLKFLHNKKIIHRDIKSDNILLNSQGLVKITDFGFCVELTEKRSKRATMVGTPYWMAPEI--VNQK--GYDEKVDVWSLGIMLIEMIEGEPPYLNEDPLKALYLIANN--GSPKLRHPESVSKQTKQFLDACLQVNVESRASVRKLLTFEFLSMACSPEQLKVSL 652          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO49047 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW1])

HSP 1 Score: 329.331 bits (843), Expect = 4.879e-109
Identity = 151/287 (52.61%), Postives = 213/287 (74.22%), Query Frame = 3
Query:  360 IRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL 1220
            +R  ++  NP   + LI ++G GTYGDV+KA  + + +  A+K++K++  DD   I QEI  +++C+H+NI+ + G+Y++  KLWI MEYCGG S+QD+Y  +  P  E  I+F+T ETLKGL Y+H++  +HRDIKGANILLT  G+VK+ADFGI+A+++ T+ KR + IGTPYWMAPE+AAV  RTGGYD +CD+WAVGITAIE AELQPP+FDLHPM+AL I+ ++++ PP L++K+ WS + H F++ AL KN KKRP  + MLTH F  + HL+  + Q LL
Sbjct:    5 LRAQISRGNPDKVFDLIEKVGGGTYGDVFKARVIATGDLAAVKVVKVEPGDDFELIQQEIAMMQQCRHNNIINYIGAYMRRDKLWIGMEYCGGGSIQDVYC-VTGPCSETQISFVTVETLKGLAYLHEKSLMHRDIKGANILLTTNGEVKLADFGISARITETMKKRKSFIGTPYWMAPEMAAVE-RTGGYDLKCDIWAVGITAIEMAELQPPMFDLHPMRALYIIGKKSFIPPTLKEKDKWSNEMHHFIKVALIKNPKKRPSADKMLTHPFCCR-HLTKAVLQDLL 288          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO42845 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0A9])

HSP 1 Score: 229.95 bits (585), Expect = 1.809e-70
Identity = 116/290 (40.00%), Postives = 178/290 (61.38%), Query Frame = 3
Query:  387 PKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEH----LSITLTQALLKMNNKDYK 1244
            P++ + ++ ++G G+YG V+KAMH +S   VAIK + +D   D+  I +EI  +++C    +V+++GSY + + LWI MEYCG  S+ D+     + + E+ I  + + TLKGL+Y+H R +IHRDIK  NILL   G  K+ADFG+A +L+ T+AKR T+IGTP+WMAPEV     +  GYD   D+W++GITA+E AE +PP  D+HPM+A+ ++   T  PP  +    WS  F  F+   L KN ++R     +L H F+        LS  + +AL  M  ++ +
Sbjct:   20 PEEVFDVLEKLGEGSYGSVFKAMHKESGQVVAIKQVPVD--TDLQEIIKEISMMQQCDSPYVVKYYGSYFKNTDLWIVMEYCGAGSVSDLMKIRNKTLTEEEIKCVLKYTLKGLEYLHLRRKIHRDIKAGNILLNSEGHAKLADFGVAGQLTDTMAKRNTVIGTPFWMAPEVI----QEVGYDCLADIWSLGITAMEMAEGKPPYADIHPMRAIFMIP--TKPPPTFRDPGQWSEDFKDFVSKCLVKNPEERATATELLQHSFIQGAKQISILSSMIQEALTIMEEENAR 301          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO40961 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5T6])

HSP 1 Score: 223.016 bits (567), Expect = 5.603e-68
Identity = 116/274 (42.34%), Postives = 176/274 (64.23%), Query Frame = 3
Query:  384 NPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRE-CKHDNIVQFFGSYLQAS------KLWICMEYCGGQSMQDIYLNLR-RPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNR-TGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFV 1178
            +P   + L+  +G+GTYG V+K  H ++    AIKIM +   +    I  EI+ LR+   H NI  ++G++++ S      +LW+ ME+CG  S+ D+    R + + E+ I++I RE L G+ ++H    IHRDIKG N+LLT+  +VK+ DFG++A+L  T+ +R T IGTPYWMAPEV A + +    YD RCD+W++GITAIE AE QPPL D+HPM+AL ++ +    PPKL+ K+ WS +FH F+   L K+ + RP  + +L H+F+
Sbjct:   15 DPAGIFDLVEVVGNGTYGQVHKGRHKRTGQLTAIKIMDVTEDE-EEEIKLEINVLRKFSNHRNIATYYGAFIKKSLQGQDDQLWLVMEFCGAGSVTDLVKTARNKALKEEWISYICREVLNGVSHLHMNHVIHRDIKGQNVLLTESAEVKLVDFGVSAQLDRTIGRRNTFIGTPYWMAPEVIACDEQPDATYDNRCDMWSIGITAIEMAESQPPLCDMHPMRALFLIPRS--DPPKLKSKKSWSKRFHHFVNTCLIKDYQHRPTADQLLQHEFI 285          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO31934 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SWI4])

HSP 1 Score: 216.083 bits (549), Expect = 2.324e-64
Identity = 113/270 (41.85%), Postives = 169/270 (62.59%), Query Frame = 3
Query:  381 SNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAIC---QEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDC-IAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFV 1178
            ++P+  +  +  IG G++G+V+K +  ++   VAIKI  IDL++    I    QEI  L +C    + ++ GSYL+ +KLWI MEY GG S  D+   ++   IE+  IA I RE LKGLDY+H   ++HRDIK AN+L+++ GDVK+ADFG+A +L+ T+ KR T +GTP+WMAPEV     +   YD + D+W++GITAIE A+ +PP  DLHPM+ L ++ +    PP+L     +S  F  F+   L K+   RP  + +L H F+
Sbjct:    5 ADPEKLFSKLERIGKGSFGEVFKGIDNRTNEVVAIKI--IDLEEAEDEIEDIQQEITVLSQCDSLYVTKYHGSYLKGTKLWIIMEYLGGGSALDL---MKAGNIEEFYIATILREVLKGLDYLHTEKKLHRDIKAANVLMSETGDVKLADFGVAGQLTDTLNKRNTFVGTPFWMAPEVI----KQSAYDSKADIWSLGITAIELAKGEPPNSDLHPMRVLFLIPKN--NPPELTGN--FSKAFKEFVSLCLNKDPNDRPTAKELLKHRFI 261          
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Match: EDO48741 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RIM4])

HSP 1 Score: 219.164 bits (557), Expect = 1.417e-61
Identity = 102/267 (38.20%), Postives = 155/267 (58.05%), Query Frame = 3
Query:  384 NPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNN-RTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVT 1181
            +P   ++L+ E+G G++G VYKA H    +  A KI+ ++ ++++     EI  L ECKH N+V  F ++L   KLW+ +E+C G ++ D+ L L R + E  I  +TR+  +GL ++H    IHRD+K  N+LL   G+VK+ADFG++AK   T+ KR+T IGTPYWMAPEV      +   YD + D+W+ GIT IE A++ PP  ++HPM+ L  + +    PP       WS   + FL   + KN   R     M+ H F+ 
Sbjct:   17 DPNSNWELVGELGDGSFGKVYKAQHKTESSLSAAKIIIVNDENELEDFMVEIDILSECKHKNLVGLFETFLHDGKLWMMLEFCSGGALDDLMLELERGLNEPEIRAVTRQLFEGLQFLHNHKVIHRDLKAGNLLLASDGNVKMADFGVSAKNKKTLQKRSTFIGTPYWMAPEVVVTETYKDDPYDYKADIWSAGITLIELAQMVPPNHNMHPMRVLFKIPK--SDPPTFDNPNKWSNDLNDFLASCVVKNPDMRASATEMIKHPFIA 281          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:NCBI gene;Acc:101155229])

HSP 1 Score: 366.311 bits (939), Expect = 4.709e-116
Identity = 175/311 (56.27%), Postives = 235/311 (75.56%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKM-NNKDYKIPLGKQ---NEMKPKDVKP 1292
            V+  +P ++Y+LI  +GSGTYGDV+KA ++++    AIKI+K+D  DD+T+I QEI  ++ECKH NIV +FGSY + +KLWICMEYCGG S+QDIY  +  P+ E  IAF+ RETL+GL ++H+ G++HRDIKGANILLT+ GDVK+ADFG+A ++S++VAKR + IGTPYWMAPEVAAV  + GGY+  CD+WAVGITAIE AELQPP+FDLHPM+AL ++++ ++ PPKL+ K  WSA FHSF++ AL KN +KRP  ET+L H FVTQ  L+  L   LL M NN +   PL      N+++  +V P
Sbjct:    6 VSFLDPLEDYELIHRLGSGTYGDVFKARNIRTSELAAIKIVKLDPGDDITSIQQEITMMKECKHKNIVAYFGSYHRNTKLWICMEYCGGGSLQDIY-QVTGPLKEKQIAFMCRETLQGLYHLHETGKMHRDIKGANILLTERGDVKLADFGVAVEISASVAKRKSFIGTPYWMAPEVAAVEKK-GGYNHLCDIWAVGITAIELAELQPPMFDLHPMRALMLMSKSSFQPPKLKDKSKWSAGFHSFVKMALIKNPRKRPSAETLLQHPFVTQ-LLTRNLVIELLDMANNPELHCPLAHTIDDNDLESGEVSP 313          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: map4k2 (mitogen-activated protein kinase kinase kinase kinase 2 [Source:NCBI gene;Acc:101155229])

HSP 1 Score: 366.311 bits (939), Expect = 5.295e-116
Identity = 175/311 (56.27%), Postives = 235/311 (75.56%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKM-NNKDYKIPLGKQ---NEMKPKDVKP 1292
            V+  +P ++Y+LI  +GSGTYGDV+KA ++++    AIKI+K+D  DD+T+I QEI  ++ECKH NIV +FGSY + +KLWICMEYCGG S+QDIY  +  P+ E  IAF+ RETL+GL ++H+ G++HRDIKGANILLT+ GDVK+ADFG+A ++S++VAKR + IGTPYWMAPEVAAV  + GGY+  CD+WAVGITAIE AELQPP+FDLHPM+AL ++++ ++ PPKL+ K  WSA FHSF++ AL KN +KRP  ET+L H FVTQ  L+  L   LL M NN +   PL      N+++  +V P
Sbjct:    6 VSFLDPLEDYELIHRLGSGTYGDVFKARNIRTSELAAIKIVKLDPGDDITSIQQEITMMKECKHKNIVAYFGSYHRNTKLWICMEYCGGGSLQDIY-QVTGPLKEKQIAFMCRETLQGLYHLHETGKMHRDIKGANILLTERGDVKLADFGVAVEISASVAKRKSFIGTPYWMAPEVAAVEKK-GGYNHLCDIWAVGITAIELAELQPPMFDLHPMRALMLMSKSSFQPPKLKDKSKWSAGFHSFVKMALIKNPRKRPSAETLLQHPFVTQ-LLTRNLVIELLDMANNPELHCPLAHTIDDNDLESGEVSP 313          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:NCBI gene;Acc:101162973])

HSP 1 Score: 357.066 bits (915), Expect = 2.734e-112
Identity = 164/290 (56.55%), Postives = 220/290 (75.86%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            +   NP+ +++LI  +GSGTYGDV KA ++++    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYC G S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGIT+IE AELQPP+FDLHPM+AL ++++  + PPKL+ K  WS  FH+F++ +L K+ K+RP  E +LTH FV Q  LS  L   LL  MNN D
Sbjct:   11 IQRRNPQQDFELIQRVGSGTYGDVCKARNIQTGELAAVKIIKLEAGDDFSIIEQEIFMVKECKHHNIVAYFGSYLSRDKLWICMEYCSGGSLQDIY-HVTGPLSEPQIAYVCRETLQGLAYLHSKGKMHRDIKGANILLTDNGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAV-EKNGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMSKSGFQPPKLKDKNSWSTAFHNFVKMSLTKSPKRRPTAEKLLTHVFVAQTGLSRRLAVDLLDSMNNPD 298          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:NCBI gene;Acc:101162973])

HSP 1 Score: 357.066 bits (915), Expect = 2.996e-112
Identity = 164/290 (56.55%), Postives = 220/290 (75.86%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            +   NP+ +++LI  +GSGTYGDV KA ++++    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYC G S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGIT+IE AELQPP+FDLHPM+AL ++++  + PPKL+ K  WS  FH+F++ +L K+ K+RP  E +LTH FV Q  LS  L   LL  MNN D
Sbjct:   11 IQRRNPQQDFELIQRVGSGTYGDVCKARNIQTGELAAVKIIKLEAGDDFSIIEQEIFMVKECKHHNIVAYFGSYLSRDKLWICMEYCSGGSLQDIY-HVTGPLSEPQIAYVCRETLQGLAYLHSKGKMHRDIKGANILLTDNGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAV-EKNGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMSKSGFQPPKLKDKNSWSTAFHNFVKMSLTKSPKRRPTAEKLLTHVFVAQTGLSRRLAVDLLDSMNNPD 298          
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Match: map4k5 (mitogen-activated protein kinase kinase kinase kinase 5 [Source:NCBI gene;Acc:101162973])

HSP 1 Score: 357.066 bits (915), Expect = 4.097e-112
Identity = 164/290 (56.55%), Postives = 220/290 (75.86%), Query Frame = 3
Query:  372 VNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALL-KMNNKD 1238
            +   NP+ +++LI  +GSGTYGDV KA ++++    A+KI+K++  DD + I QEI  ++ECKH NIV +FGSYL   KLWICMEYC G S+QDIY ++  P+ E  IA++ RETL+GL Y+H +G++HRDIKGANILLTD GDVK+ADFG+AAK+++T+AKR + IGTPYWMAPEVAAV  + GGY++ CD+WAVGIT+IE AELQPP+FDLHPM+AL ++++  + PPKL+ K  WS  FH+F++ +L K+ K+RP  E +LTH FV Q  LS  L   LL  MNN D
Sbjct:   11 IQRRNPQQDFELIQRVGSGTYGDVCKARNIQTGELAAVKIIKLEAGDDFSIIEQEIFMVKECKHHNIVAYFGSYLSRDKLWICMEYCSGGSLQDIY-HVTGPLSEPQIAYVCRETLQGLAYLHSKGKMHRDIKGANILLTDNGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAV-EKNGGYNQLCDIWAVGITSIELAELQPPMFDLHPMRALFLMSKSGFQPPKLKDKNSWSTAFHNFVKMSLTKSPKRRPTAEKLLTHVFVAQTGLSRRLAVDLLDSMNNPD 298          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000041176.1 (SMESG000041176.1)

HSP 1 Score: 974.926 bits (2519), Expect = 0.000e+0
Identity = 491/492 (99.80%), Postives = 491/492 (99.80%), Query Frame = 3
Query:  336 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQYSTPATEVRYIKNNHXXXXXXXXLKEPENHSIFYKKDNGQVNPELYQSPPITNDDDDFMVSLDNELQKRGHRSLLKNEGERNSFYDNCPEPSKIIRSSVKDNAVSNLSYHDKNRASMNDLSISTSNDKPSDIPMRPKXXXXXXXXXXXXXKPSRPEKPPQYLAELQ 1811
            MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQ STPATEVRYIKNNHPRPAAPPPLKEPENHSIFYKKDNGQVNPELYQSPPITNDDDDFMVSLDNELQKRGHRSLLKNEGERNSFYDNCPEPSKIIRSSVKDNAVSNLSYHDKNRASMNDLSISTSNDKPSDIPMRPKSVYNLVSNSNSLSKPSRPEKPPQYLAELQ
Sbjct:    1 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQNSTPATEVRYIKNNHPRPAAPPPLKEPENHSIFYKKDNGQVNPELYQSPPITNDDDDFMVSLDNELQKRGHRSLLKNEGERNSFYDNCPEPSKIIRSSVKDNAVSNLSYHDKNRASMNDLSISTSNDKPSDIPMRPKSVYNLVSNSNSLSKPSRPEKPPQYLAELQ 492          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000041176.1 (SMESG000041176.1)

HSP 1 Score: 974.541 bits (2518), Expect = 0.000e+0
Identity = 491/492 (99.80%), Postives = 491/492 (99.80%), Query Frame = 3
Query:  336 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQYSTPATEVRYIKNNHXXXXXXXXLKEPENHSIFYKKDNGQVNPELYQSPPITNDDDDFMVSLDNELQKRGHRSLLKNEGERNSFYDNCPEPSKIIRSSVKDNAVSNLSYHDKNRASMNDLSISTSNDKPSDIPMRPKXXXXXXXXXXXXXKPSRPEKPPQYLAELQ 1811
            MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQ STPATEVRYIKNNHPRPAAPPPLKEPENHSIFYKKDNGQVNPELYQSPPITNDDDDFMVSLDNELQKRGHRSLLKNEGERNSFYDNCPEPSKIIRSSVKDNAVSNLSYHDKNRASMNDLSISTSNDKPSDIPMRPKSVYNLVSNSNSLSKPSRPEKPPQYLAELQ
Sbjct:    1 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQNSTPATEVRYIKNNHPRPAAPPPLKEPENHSIFYKKDNGQVNPELYQSPPITNDDDDFMVSLDNELQKRGHRSLLKNEGERNSFYDNCPEPSKIIRSSVKDNAVSNLSYHDKNRASMNDLSISTSNDKPSDIPMRPKSVYNLVSNSNSLSKPSRPEKPPQYLAELQ 492          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000041176.1 (SMESG000041176.1)

HSP 1 Score: 937.947 bits (2423), Expect = 0.000e+0
Identity = 477/492 (96.95%), Postives = 478/492 (97.15%), Query Frame = 3
Query:  336 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQYSTPATEVRYIKNNHXXXXXXXXLKEPENHSIFYKKDNGQVNPELYQSPPITNDDDDFMVSLDNELQKRGHRSLLKNEGERNSFYDNCPEPSKIIRSSVKDNAVSNLSYHDKNRASMNDLSISTSNDKPSDIPMRPKXXXXXXXXXXXXXKPSRPEKPPQYLAELQ 1811
            MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQ STPATEVRYIKNNHPRPAAPPPLKEPENHSIFYKKDNGQVNPELYQSPPITNDD+             GHRSLLKNEGERNSFYDNCPEPSKIIRSSVKDNAVSNLSYHDKNRASMNDLSISTSNDKPSDIPMRPKSVYNLVSNSNSLSKPSRPEKPPQYLAELQ
Sbjct:    1 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPLGKQNEMKPKDVKPATPEVPQNSTPATEVRYIKNNHPRPAAPPPLKEPENHSIFYKKDNGQVNPELYQSPPITNDDE-------------GHRSLLKNEGERNSFYDNCPEPSKIIRSSVKDNAVSNLSYHDKNRASMNDLSISTSNDKPSDIPMRPKSVYNLVSNSNSLSKPSRPEKPPQYLAELQ 479          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000029685.1 (SMESG000029685.1)

HSP 1 Score: 441.425 bits (1134), Expect = 5.734e-144
Identity = 196/306 (64.05%), Postives = 251/306 (82.03%), Query Frame = 3
Query:  336 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPL 1253
            + HP I Y+ +F+   +PK++YKLI  IGSGTYG+VYKA+H ++    A+KI+K+D+KDD+ AI QEIHTLR+C H NIV++FGSYL+ +KLWICME+CGG S+QDIY N+RRP+ E+CIA++TR+TL GL YMHK+G+IHRDIKGANILLT+ G VKIADFG+AA+++ T+ KR + IGTPYWMAPEVAAV  R GGYDE+CD+WAVGITAIEYAELQPP+FDLHPMKAL +L+ R Y  P LQ K  WS KFHSFL+  L KNEK+RP   T+L HDFVTQ++L+I+LT+ LL++N    ++PL
Sbjct:    4 LNHPKIKYLEEFIIKKDPKEDYKLIKNIGSGTYGEVYKAIHRRNNTVSAVKIVKVDIKDDIKAIAQEIHTLRDCNHKNIVKYFGSYLRKNKLWICMEFCGGFSIQDIYTNIRRPLEENCIAYVTRDTLDGLAYMHKQGKIHRDIKGANILLTEDGQVKIADFGVAAQITQTIQKRCSFIGTPYWMAPEVAAV-ERKGGYDEKCDIWAVGITAIEYAELQPPMFDLHPMKALHLLSMRNYKAPVLQNKTKWSQKFHSFLKICLNKNEKRRPDAMTLLQHDFVTQKNLTISLTKHLLQVNRNPGRVPL 308          
BLAST of Serine/threonine kinase vs. Planmine SMEST
Match: SMESG000029685.1 (SMESG000029685.1)

HSP 1 Score: 441.425 bits (1134), Expect = 5.770e-144
Identity = 196/306 (64.05%), Postives = 251/306 (82.03%), Query Frame = 3
Query:  336 MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAIKIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCGGQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANILLTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYDERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIWSAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNKDYKIPL 1253
            + HP I Y+ +F+   +PK++YKLI  IGSGTYG+VYKA+H ++    A+KI+K+D+KDD+ AI QEIHTLR+C H NIV++FGSYL+ +KLWICME+CGG S+QDIY N+RRP+ E+CIA++TR+TL GL YMHK+G+IHRDIKGANILLT+ G VKIADFG+AA+++ T+ KR + IGTPYWMAPEVAAV  R GGYDE+CD+WAVGITAIEYAELQPP+FDLHPMKAL +L+ R Y  P LQ K  WS KFHSFL+  L KNEK+RP   T+L HDFVTQ++L+I+LT+ LL++N    ++PL
Sbjct:    6 LNHPKIKYLEEFIIKKDPKEDYKLIKNIGSGTYGEVYKAIHRRNNTVSAVKIVKVDIKDDIKAIAQEIHTLRDCNHKNIVKYFGSYLRKNKLWICMEFCGGFSIQDIYTNIRRPLEENCIAYVTRDTLDGLAYMHKQGKIHRDIKGANILLTEDGQVKIADFGVAAQITQTIQKRCSFIGTPYWMAPEVAAV-ERKGGYDEKCDIWAVGITAIEYAELQPPMFDLHPMKALHLLSMRNYKAPVLQNKTKWSQKFHSFLKICLNKNEKRRPDAMTLLQHDFVTQKNLTISLTKHLLQVNRNPGRVPL 310          
The following BLAST results are available for this feature:
BLAST of Serine/threonine kinase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP4K53.921e-11657.86mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K32.209e-11156.33mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K32.564e-11156.33mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K21.088e-10952.43mitogen-activated protein kinase kinase kinase kin... [more]
MAP4K21.226e-10952.43mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gck-21.396e-10454.86Mitogen-activated protein kinase kinase kinase kin... [more]
cst-23.906e-7543.94Caenorhabditis STE20-like kinase [Source:UniProtK... [more]
cst-11.279e-7443.94Serine/threonine-protein kinase cst-1 Serine/threo... [more]
cst-11.281e-7443.94Serine/threonine-protein kinase cst-1 Serine/threo... [more]
mig-152.598e-7038.89Serine/threonine-protein kinase mig-15 [Source:Un... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hppy1.579e-10854.92gene:FBgn0263395 transcript:FBtr0340456[more]
hppy1.729e-10854.92gene:FBgn0263395 transcript:FBtr0086503[more]
hppy2.317e-10854.92gene:FBgn0263395 transcript:FBtr0340454[more]
hppy6.499e-10754.92gene:FBgn0263395 transcript:FBtr0086504[more]
hppy9.296e-10754.92gene:FBgn0263395 transcript:FBtr0340455[more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map4k21.303e-11455.05mitogen-activated protein kinase kinase kinase kin... [more]
map4k64.505e-11455.67mitogen-activated protein kinase kinase kinase kin... [more]
map4k56.636e-11357.24mitogen-activated protein kinase kinase kinase kin... [more]
map4k3b1.425e-10954.02mitogen-activated protein kinase kinase kinase kin... [more]
map4k3b6.466e-10953.70mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hnrnpm9.482e-11056.60heterogeneous nuclear ribonucleoprotein M [Source:... [more]
hnrnpm1.279e-10956.60heterogeneous nuclear ribonucleoprotein M [Source:... [more]
map4k51.389e-10954.85mitogen-activated protein kinase kinase kinase kin... [more]
map4k52.334e-8949.16mitogen-activated protein kinase kinase kinase kin... [more]
hnrnpm2.929e-8850.00heterogeneous nuclear ribonucleoprotein M [Source:... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Map4k51.286e-11655.21mitogen-activated protein kinase kinase kinase kin... [more]
Map4k51.399e-11655.21mitogen-activated protein kinase kinase kinase kin... [more]
Map4k56.075e-11557.88mitogen-activated protein kinase kinase kinase kin... [more]
Map4k31.445e-11045.30mitogen-activated protein kinase kinase kinase kin... [more]
Map4k33.720e-11055.18mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Serine/threonine kinase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8BPM2|M4K5_MOUSE9.787e-11655.21Mitogen-activated protein kinase kinase kinase kin... [more]
sp|Q9Y4K4|M4K5_HUMAN1.883e-11557.86Mitogen-activated protein kinase kinase kinase kin... [more]
sp|Q8IVH8|M4K3_HUMAN1.231e-11056.33Mitogen-activated protein kinase kinase kinase kin... [more]
sp|Q924I2|M4K3_RAT7.935e-11045.30Mitogen-activated protein kinase kinase kinase kin... [more]
sp|Q99JP0|M4K3_MOUSE2.602e-10955.18Mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Serine/threonine kinase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4V6033.184e-15268.81Serine/threonine kinase OS=Schistosoma mansoni OX=... [more]
Q5BW362.472e-14869.34SJCHGC05877 protein (Fragment) OS=Schistosoma japo... [more]
A0A4Z2CWM12.114e-14769.15Non-specific serine/threonine protein kinase OS=Sc... [more]
A0A4Z2CXG24.111e-14769.15Non-specific serine/threonine protein kinase OS=Sc... [more]
A0A3Q0KBT95.660e-14768.81Non-specific serine/threonine protein kinase OS=Sc... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map4k53.380e-11457.59mitogen-activated protein kinase kinase kinase kin... [more]
map4k24.058e-11458.54mitogen-activated protein kinase kinase kinase kin... [more]
map4k54.473e-11457.59mitogen-activated protein kinase kinase kinase kin... [more]
map4k24.870e-11458.54mitogen-activated protein kinase kinase kinase kin... [more]
map4k55.430e-11457.59mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAP4K31.119e-11060.00mitogen-activated protein kinase kinase kinase kin... [more]
ENSPMAT00000010511.11.457e-9656.76pep scaffold:Pmarinus_7.0:GL476756:358747:414819:1... [more]
stk25a1.893e-6342.01serine/threonine kinase 25a [Source:ZFIN;Acc:ZDB-G... [more]
ENSPMAT00000000169.19.446e-5942.97pep scaffold:Pmarinus_7.0:GL478331:850:46844:1 gen... [more]
slka2.307e-5838.27STE20-like kinase a [Source:ZFIN;Acc:ZDB-GENE-0504... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
SPS14.484e-5740.43Putative protein serine/threonine kinase; localize... [more]
STE201.094e-5336.00Cdc42p-activated signal transducing kinase; involv... [more]
KIC16.609e-5238.64Protein kinase of the PAK/Ste20 family, required f... [more]
CLA46.500e-5035.91Cdc42p-activated signal transducing kinase; member... [more]
SKM18.492e-4834.54Member of the PAK family of serine/threonine prote... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO490474.879e-10952.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428451.809e-7040.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409615.603e-6842.34Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO319342.324e-6441.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO487411.417e-6138.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Serine/threonine kinase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
map4k24.709e-11656.27mitogen-activated protein kinase kinase kinase kin... [more]
map4k25.295e-11656.27mitogen-activated protein kinase kinase kinase kin... [more]
map4k52.734e-11256.55mitogen-activated protein kinase kinase kinase kin... [more]
map4k52.996e-11256.55mitogen-activated protein kinase kinase kinase kin... [more]
map4k54.097e-11256.55mitogen-activated protein kinase kinase kinase kin... [more]
back to top
BLAST of Serine/threonine kinase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000041176.10.000e+099.80SMESG000041176.1[more]
SMESG000041176.10.000e+099.80SMESG000041176.1[more]
SMESG000041176.10.000e+096.95SMESG000041176.1[more]
SMESG000029685.15.734e-14464.05SMESG000029685.1[more]
SMESG000029685.15.770e-14464.05SMESG000029685.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023814 ID=SMED30023814|Name=Serine/threonine kinase|organism=Schmidtea mediterranea sexual|type=transcript|length=1812bp
TTTAAACAATTAAAGATGTTTGTAAAGGTGTCTGAAAAGAAATCCAAGTT
TTGATGAAAACTGACTTGAAAATACATATTGCGCACATCTTTAAACGCGC
AAAGAAATAAAGGTTCATTGCACTTAATAGACATGATGTAAGATATATGT
GTTCATAAATATCTAATAAATATGGAACCCAAGTAGATGTAAAAATTGTA
TCGAGCATTTGAAACGCCACCAGAACAGATCTTATACAATTGGAGTTTTC
TTTTCCTCCTGATGATGATAGTGAACCTGTCAAAATGAATAAATTATATA
ACTGATGTACGNGTGNTGTNANTTTTTATATTTTAATGACTCATCCTAAT
ATTGATTATATTCGTCAATTCGTAAATCATAGTAATCCGAAAGATGAGTA
TAAATTAATTTCAGAAATCGGAAGTGGAACATACGGCGATGTTTATAAAG
CAATGCATGTAAAATCACAAAATTATGTAGCAATAAAAATTATGAAAATT
GATTTGAAAGATGATGTTACTGCTATTTGTCAAGAAATTCATACTTTAAG
AGAATGCAAACATGATAATATTGTTCAATTTTTCGGAAGCTATTTACAGG
CATCTAAATTGTGGATTTGCATGGAATATTGCGGTGGACAGTCAATGCAA
GATATTTATTTGAATCTTAGACGACCGATCATTGAAGATTGCATTGCATT
TATCACGAGAGAAACATTAAAAGGATTGGATTATATGCACAAAAGAGGCA
GGATACATCGTGATATCAAAGGCGCCAATATCCTGCTGACCGATCTGGGA
GATGTAAAAATAGCGGATTTCGGCATCGCGGCTAAATTATCATCAACAGT
CGCCAAAAGAACTACACTAATCGGAACTCCTTATTGGATGGCTCCAGAAG
TAGCTGCTGTAAACAATCGCACAGGGGGTTATGATGAAAGGTGTGACGTA
TGGGCTGTTGGTATAACCGCTATTGAATATGCCGAATTACAACCCCCCCT
TTTTGATCTGCATCCCATGAAAGCTCTCCAAATTCTTGCCCAAAGAACAT
ATACACCACCAAAATTGCAGAAAAAAGAAATATGGTCTGCTAAATTTCAC
TCATTTCTAAGATTTGCCTTGGCGAAGAATGAAAAGAAAAGACCTTATTG
TGAAACGATGCTTACACATGATTTTGTTACCCAAGAGCATTTATCAATAA
CTTTGACACAAGCATTATTGAAAATGAACAATAAAGACTATAAAATTCCA
TTGGGCAAACAGAATGAAATGAAACCGAAGGATGTGAAACCTGCAACGCC
CGAGGTTCCCCAATATTCTACCCCAGCTACTGAAGTGAGATACATAAAAA
ATAATCACCCAAGGCCAGCTGCACCTCCCCCACTTAAAGAACCAGAAAAC
CATTCGATTTTTTACAAGAAAGACAATGGGCAAGTCAATCCTGAGTTGTA
TCAATCGCCTCCCATTACAAACGATGACGACGATTTTATGGTTAGTCTTG
ATAATGAGTTACAAAAACGAGGTCATAGATCATTACTGAAAAATGAAGGT
GAAAGAAACAGCTTTTATGATAATTGTCCCGAGCCATCTAAAATTATTAG
ATCCAGCGTTAAAGATAATGCGGTTTCTAATTTATCATATCATGATAAAA
ATAGAGCATCCATGAATGATTTGAGTATTTCTACTAGCAACGATAAACCA
TCAGACATTCCAATGAGACCAAAATCAGTTTACAATCTTGTGTCCAATTC
AAATAGTTTATCAAAGCCTTCTCGTCCAGAAAAACCTCCACAATATCTTG
CTGAACTTCAGA
back to top

protein sequence of SMED30023814-orf-1

>SMED30023814-orf-1 ID=SMED30023814-orf-1|Name=SMED30023814-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=492bp
MTHPNIDYIRQFVNHSNPKDEYKLISEIGSGTYGDVYKAMHVKSQNYVAI
KIMKIDLKDDVTAICQEIHTLRECKHDNIVQFFGSYLQASKLWICMEYCG
GQSMQDIYLNLRRPIIEDCIAFITRETLKGLDYMHKRGRIHRDIKGANIL
LTDLGDVKIADFGIAAKLSSTVAKRTTLIGTPYWMAPEVAAVNNRTGGYD
ERCDVWAVGITAIEYAELQPPLFDLHPMKALQILAQRTYTPPKLQKKEIW
SAKFHSFLRFALAKNEKKRPYCETMLTHDFVTQEHLSITLTQALLKMNNK
DYKIPLGKQNEMKPKDVKPATPEVPQYSTPATEVRYIKNNHPRPAAPPPL
KEPENHSIFYKKDNGQVNPELYQSPPITNDDDDFMVSLDNELQKRGHRSL
LKNEGERNSFYDNCPEPSKIIRSSVKDNAVSNLSYHDKNRASMNDLSIST
SNDKPSDIPMRPKSVYNLVSNSNSLSKPSRPEKPPQYLAELQ
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0000165MAPK cascade
GO:0000185activation of MAPKKK activity
GO:0006468protein phosphorylation
GO:0016310phosphorylation
Vocabulary: molecular function
TermDefinition
GO:0000166nucleotide binding
GO:0008349MAP kinase kinase kinase kinase activity
GO:0016740transferase activity
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0016301kinase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR017441Protein_kinase_ATP_BS
IPR011009Kinase-like_dom_sf
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 22..281
e-value: 3.7E-83
score: 292.2
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 22..281
e-value: 1.3E-59
score: 201.7
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 22..281
score: 44.4
NoneNo IPR availablePIRSFPIRSF000654ILKcoord: 6..287
e-value: 4.4E-25
score: 85.9
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 18..320
e-value: 1.1E-97
score: 328.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 465..480
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 444..492
NoneNo IPR availablePANTHERPTHR24361:SF205MITOGEN-ACTIVATED PROTEIN KINASE KINASE KINASE KINASE 3coord: 13..344
NoneNo IPR availablePANTHERPTHR24361MITOGEN-ACTIVATED KINASE KINASE KINASEcoord: 13..344
NoneNo IPR availableCDDcd06613STKc_MAP4K3_likecoord: 21..281
e-value: 1.92861E-165
score: 465.627
IPR017441Protein kinase, ATP binding sitePROSITEPS00107PROTEIN_KINASE_ATPcoord: 28..51
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 12..288