Protein canopy-like protein 3

Overview
NameProtein canopy-like protein 3
Smed IDSMED30023812
Length (bp)835
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein canopy-like protein 3 (SMED30023812) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein canopy-like protein 3 (SMED30023812) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein canopy-like protein 3 (SMED30023812) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein canopy-like protein 3 (SMED30023812) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023812

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
muscle cellSMED30023812h1SMcG0016225 dd_Smed_v4_4234_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein canopy-like protein 3 vs. Ensembl Human
Match: CNPY3 (canopy FGF signaling regulator 3 [Source:HGNC Symbol;Acc:HGNC:11968])

HSP 1 Score: 176.407 bits (446), Expect = 2.030e-53
Identity = 96/184 (52.17%), Postives = 126/184 (68.48%), Query Frame = 2
Query:  137 AEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNK-NIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKET 679
            AE+   V+L +KCEVCK +A+EL S F+ET K KEV  TGY  LD K + +KY KS+LRL EV E   IC+R+  Y LHKER  S RFAKG+ +TFETL  L  +GV++ MD+P  LW++ +AE + L KQC  +V + EEVIEDWY NHQ++DL +FLC  HVL  +   CL E+ S +  +T
Sbjct:   37 AEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTET--ICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDT 218          
BLAST of Protein canopy-like protein 3 vs. Ensembl Human
Match: CNPY4 (canopy FGF signaling regulator 4 [Source:HGNC Symbol;Acc:HGNC:28631])

HSP 1 Score: 146.362 bits (368), Expect = 3.703e-42
Identity = 76/175 (43.43%), Postives = 107/175 (61.14%), Query Frame = 2
Query:  140 EDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYKLDN---KNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNE 652
            ED    +L +KCEVCK+L+ EL +    T + +EV E G  LD    K  + Y  SE RL E +E+  +CER+  Y +H ERK S R+AKG  QT  TLK L  +GV++ + +P  LWD+P+ E + L KQC  M+ + E+++ DWYF+HQ++ L +FLC  HVL      CL E
Sbjct:   27 EDDDTERLPSKCEVCKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALEN--LCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQCETMLEEFEDIVGDWYFHHQEQPLQNFLCEGHVLPAAETACLQE 199          
BLAST of Protein canopy-like protein 3 vs. Ensembl Human
Match: CNPY4 (canopy FGF signaling regulator 4 [Source:HGNC Symbol;Acc:HGNC:28631])

HSP 1 Score: 90.8929 bits (224), Expect = 2.148e-22
Identity = 50/117 (42.74%), Postives = 70/117 (59.83%), Query Frame = 2
Query:  182 CKILAIELISRFKETDK-KEVYETGYKLDN---KNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQ 520
            CK+L+ EL +    T + +EV E G  LD    K  + Y  SE RL E +E+  +CER+  Y +H ERK S R+AKG  QT  TLK L  +GV++ + +P  LWD+P+ E + L KQ
Sbjct:    2 CKLLSTELQAELSRTGRSREVLELGQVLDTGKRKRHVPYSVSETRLEEALEN--LCERILDYSVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTYLKKQ 116          
BLAST of Protein canopy-like protein 3 vs. Ensembl Human
Match: CNPY3 (canopy FGF signaling regulator 3 [Source:HGNC Symbol;Acc:HGNC:11968])

HSP 1 Score: 61.6178 bits (148), Expect = 2.626e-11
Identity = 40/73 (54.79%), Postives = 51/73 (69.86%), Query Frame = 2
Query:  137 AEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNK-NIIKYEKSELRLTEVIEDPHICERM 346
            AE+   V+L +KCEVCK +A+EL S F+ET K KEV  TGY  LD K + +KY KS+LRL EV E   IC+R+
Sbjct:   37 AEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTET--ICKRL 107          
BLAST of Protein canopy-like protein 3 vs. Ensembl Celegans
Match: C11H1.7 (pep chromosome:WBcel235:X:14327409:14330195:1 gene:WBGene00007531.1 transcript:C11H1.7a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C11H1.7)

HSP 1 Score: 88.1965 bits (217), Expect = 3.712e-21
Identity = 43/164 (26.22%), Postives = 89/164 (54.27%), Query Frame = 2
Query:  161 LATKCEVCKILAIELISRFKETDKKEVYETGYKLDNKNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQD-KDLMDFLCVKHVLNNEYNGCLN 649
            + TKCE+C + ++E                    + K++  +++      ++ E+  IC    ++++HKE+    RF++   +T ETLK++  +GV++++ +P  +WDQP+AE  +L + C  ++  +E++IE+W+ N    +DL   LC ++ L N+   C +
Sbjct:   26 MPTKCEICALTSMEF-------------------EAKSVKVHKRLSSEFADITEN--ICNGFNEFKIHKEKTGLERFSRAQSKTIETLKQMREKGVKVELGMPFEMWDQPSAEIFALRQGCESLLEDYEDLIEEWFINKASLEDLFKQLCARNALKNQETSCFD 168          
BLAST of Protein canopy-like protein 3 vs. Ensembl Celegans
Match: C11H1.7 (pep chromosome:WBcel235:X:14327569:14330193:1 gene:WBGene00007531.1 transcript:C11H1.7a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C11H1.7)

HSP 1 Score: 88.1965 bits (217), Expect = 3.712e-21
Identity = 43/164 (26.22%), Postives = 89/164 (54.27%), Query Frame = 2
Query:  161 LATKCEVCKILAIELISRFKETDKKEVYETGYKLDNKNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQD-KDLMDFLCVKHVLNNEYNGCLN 649
            + TKCE+C + ++E                    + K++  +++      ++ E+  IC    ++++HKE+    RF++   +T ETLK++  +GV++++ +P  +WDQP+AE  +L + C  ++  +E++IE+W+ N    +DL   LC ++ L N+   C +
Sbjct:   26 MPTKCEICALTSMEF-------------------EAKSVKVHKRLSSEFADITEN--ICNGFNEFKIHKEKTGLERFSRAQSKTIETLKQMREKGVKVELGMPFEMWDQPSAEIFALRQGCESLLEDYEDLIEEWFINKASLEDLFKQLCARNALKNQETSCFD 168          
BLAST of Protein canopy-like protein 3 vs. Ensembl Celegans
Match: C11H1.7 (pep chromosome:WBcel235:X:14329920:14330135:1 gene:WBGene00007531.1 transcript:C11H1.7b.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:C11H1.7)

HSP 1 Score: 50.447 bits (119), Expect = 2.091e-8
Identity = 21/63 (33.33%), Postives = 38/63 (60.32%), Query Frame = 2
Query:  464 VPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQD-KDLMDFLCVKHVLNNEYNGCLN 649
            +P  +WDQP+AE  +L + C  ++  +E++IE+W+ N    +DL   LC ++ L N+   C +
Sbjct:    1 MPFEMWDQPSAEIFALRQGCESLLEDYEDLIEEWFINKASLEDLFKQLCARNALKNQETSCFD 63          
BLAST of Protein canopy-like protein 3 vs. Ensembl Fly
Match: CNPYb (gene:FBgn0036847 transcript:FBtr0075034)

HSP 1 Score: 166.007 bits (419), Expect = 2.020e-50
Identity = 88/200 (44.00%), Postives = 126/200 (63.00%), Query Frame = 2
Query:   83 LFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDKK-EVYETGYKLDN---KNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQD-KDLMDFLCVKHVLNNEY-NGCLNEKLSP 664
            L  F + +V ++ +  +  E+  GV+ A +CE CKILA EL +R  ET K  +V E GY +D+   K   +Y +SELRL E +E+  +CER+ +Y LHKER DSTRFAKG+ QTF+TL  L  +GV++ + +P  LWD+P  E + +  QC  ++ ++EE I +WYF HQD K L   LC  HVL  +    CL E+L+P
Sbjct:    6 LPGFVTLWVVLQLAGADSPEEEQGVRYANRCEACKILATELEARLGETGKSHDVIEIGYSVDDVKPKKRTEYRRSELRLLESLEN--VCERVLEYNLHKERSDSTRFAKGMSQTFQTLHGLVDKGVKVDLGIPYELWDKPPVEVTQMKTQCENLLEEYEETISEWYFKHQDEKSLKKHLCEDHVLKKKAERECLKEQLAP 203          
BLAST of Protein canopy-like protein 3 vs. Ensembl Zebrafish
Match: cnpy3 (canopy FGF signaling regulator 3 [Source:NCBI gene;Acc:550136])

HSP 1 Score: 166.392 bits (420), Expect = 8.108e-50
Identity = 92/186 (49.46%), Postives = 121/186 (65.05%), Query Frame = 2
Query:  143 DRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNKNI--IKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKETDFA 688
            D   V L  KCEVCK ++IE+ S F ET K KEV +T Y+ LD+K    IKY KS++R  EV E  ++C R+ QY LHKER  S RFAKG+ +TF TL  L  +GV++ MD+P  LW++ +AE + L KQC  MV Q+E+VIEDWY   Q++DL  +LC KHVL  +  GCL E  +   K+ D A
Sbjct:   22 DDEWVHLPNKCEVCKFVSIEMKSAFDETGKTKEVIDTNYRFLDDKGAPPIKYVKSDIRFIEVTE--NVCSRIMQYNLHKERDGSNRFAKGMSETFSTLHNLVNKGVKVVMDIPYELWNETSAEVADLKKQCDVMVEQYEDVIEDWYKGSQEEDLTTYLCEKHVLKGQDTGCLKETWA--GKKGDMA 203          
BLAST of Protein canopy-like protein 3 vs. Ensembl Zebrafish
Match: cnpy3 (canopy FGF signaling regulator 3 [Source:NCBI gene;Acc:550136])

HSP 1 Score: 166.392 bits (420), Expect = 8.108e-50
Identity = 92/186 (49.46%), Postives = 121/186 (65.05%), Query Frame = 2
Query:  143 DRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNKNI--IKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKETDFA 688
            D   V L  KCEVCK ++IE+ S F ET K KEV +T Y+ LD+K    IKY KS++R  EV E  ++C R+ QY LHKER  S RFAKG+ +TF TL  L  +GV++ MD+P  LW++ +AE + L KQC  MV Q+E+VIEDWY   Q++DL  +LC KHVL  +  GCL E  +   K+ D A
Sbjct:   22 DDEWVHLPNKCEVCKFVSIEMKSAFDETGKTKEVIDTNYRFLDDKGAPPIKYVKSDIRFIEVTE--NVCSRIMQYNLHKERDGSNRFAKGMSETFSTLHNLVNKGVKVVMDIPYELWNETSAEVADLKKQCDVMVEQYEDVIEDWYKGSQEEDLTTYLCEKHVLKGQDTGCLKETWA--GKKGDMA 203          
BLAST of Protein canopy-like protein 3 vs. Ensembl Zebrafish
Match: cnpy4 (canopy FGF signaling regulator 4 [Source:NCBI gene;Acc:568776])

HSP 1 Score: 163.696 bits (413), Expect = 2.063e-49
Identity = 89/194 (45.88%), Postives = 121/194 (62.37%), Query Frame = 2
Query:   83 LFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYKLDN---KNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNE 652
            +F+   +Y+F     N+  E+R    L  KCEVCK+L +EL     +T + KEV E G  LD    +  IKY  SE+RLTE +++  ICER+ QY++H ER  S R+AKG  QT  TLK L  +GV++++ VP  LWD+PT E + L +QC  M+ +HEEV+EDWYF+HQDK L  F C  HVL +    CL E
Sbjct:    3 MFTVFLFYMFSLVLANQ--EER----LPNKCEVCKLLTVELQDALDKTGRSKEVVELGEVLDTGKRRRKIKYNTSEMRLTEAMDN--ICERILQYKVHAERPGSLRYAKGTSQTMNTLKNLVEKGVKVELGVPYELWDEPTVEVAELKRQCETMLEEHEEVVEDWYFHHQDKGLERFFCEAHVLKDSDQECLTE 188          
BLAST of Protein canopy-like protein 3 vs. Ensembl Zebrafish
Match: cnpy4 (canopy FGF signaling regulator 4 [Source:NCBI gene;Acc:568776])

HSP 1 Score: 163.696 bits (413), Expect = 2.063e-49
Identity = 89/194 (45.88%), Postives = 121/194 (62.37%), Query Frame = 2
Query:   83 LFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYKLDN---KNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNE 652
            +F+   +Y+F     N+  E+R    L  KCEVCK+L +EL     +T + KEV E G  LD    +  IKY  SE+RLTE +++  ICER+ QY++H ER  S R+AKG  QT  TLK L  +GV++++ VP  LWD+PT E + L +QC  M+ +HEEV+EDWYF+HQDK L  F C  HVL +    CL E
Sbjct:    3 MFTVFLFYMFSLVLANQ--EER----LPNKCEVCKLLTVELQDALDKTGRSKEVVELGEVLDTGKRRRKIKYNTSEMRLTEAMDN--ICERILQYKVHAERPGSLRYAKGTSQTMNTLKNLVEKGVKVELGVPYELWDEPTVEVAELKRQCETMLEEHEEVVEDWYFHHQDKGLERFFCEAHVLKDSDQECLTE 188          
BLAST of Protein canopy-like protein 3 vs. Ensembl Zebrafish
Match: cnpy4 (canopy FGF signaling regulator 4 [Source:NCBI gene;Acc:568776])

HSP 1 Score: 125.946 bits (315), Expect = 4.118e-36
Identity = 57/110 (51.82%), Postives = 78/110 (70.91%), Query Frame = 2
Query:  299 LRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNN 628
            +RLTE +++  ICER+ QY++H ER  S R+AKG  QT  TLK L  +GV++++ VP  LWD+PT E + L +QC  M+ +HEEV+EDWYF+HQDK L  F C  HVL +
Sbjct:    1 MRLTEAMDN--ICERILQYKVHAERPGSLRYAKGTSQTMNTLKNLVEKGVKVELGVPYELWDEPTVEVAELKRQCETMLEEHEEVVEDWYFHHQDKGLERFFCEAHVLKD 108          
BLAST of Protein canopy-like protein 3 vs. Ensembl Mouse
Match: Cnpy3 (canopy FGF signaling regulator 3 [Source:MGI Symbol;Acc:MGI:1919279])

HSP 1 Score: 177.563 bits (449), Expect = 4.115e-54
Identity = 98/187 (52.41%), Postives = 127/187 (67.91%), Query Frame = 2
Query:  137 AEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNKNI-IKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKETDFA 688
            AE+   V+L +KCEVCK +A+EL S F+ET K KEV +TGY  LD K   +KY KS+LRL EV E   IC+R+  Y LHKER  S RFAKG+ +TFETL  L  +GV++ MD+P  LW++ +AE + L KQC  +V + EEVIEDWY NHQ++DL +FLC  HVL  +   CL E+ S   K+ D A
Sbjct:   37 AEETDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIDTGYGILDGKGSGVKYTKSDLRLIEVTET--ICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAERWS--GKKGDIA 219          
BLAST of Protein canopy-like protein 3 vs. Ensembl Mouse
Match: Cnpy4 (canopy FGF signaling regulator 4 [Source:MGI Symbol;Acc:MGI:1913705])

HSP 1 Score: 151.369 bits (381), Expect = 2.600e-44
Identity = 82/209 (39.23%), Postives = 122/209 (58.37%), Query Frame = 2
Query:   68 KFVLILFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYKLDN---KNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKETD 682
            +  ++LF   +Y  + E +  E  +     +L +KCEVCK+L++EL      T + +EV E G  LD    K  + Y  SE RL E +E+  +CER+  Y +H ERK S R+AKG  QT  TLK L  +GV++ + +P  LWD+P+ E + L KQC  M+ + E+V+ DWYF+HQ++ L  FLC +HVL      CL E  + + K +D
Sbjct:   12 RLEILLFILAAYGAWAEATKEEEDDTE---RLPSKCEVCKLLSMELQEALSRTGRSREVLELGQVLDTGKRKRHVPYSLSETRLEEALEN--LCERILDYNVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTFLKKQCETMLEEFEDVVGDWYFHHQEQPLQHFLCERHVLPASETACLREAWTGKEKISD 215          
BLAST of Protein canopy-like protein 3 vs. Ensembl Mouse
Match: Cnpy4 (canopy FGF signaling regulator 4 [Source:MGI Symbol;Acc:MGI:1913705])

HSP 1 Score: 100.908 bits (250), Expect = 7.845e-26
Identity = 55/130 (42.31%), Postives = 79/130 (60.77%), Query Frame = 2
Query:  179 VCKILAIELISRFKETDK-KEVYETGYKLDN---KNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVI 556
            VCK+L++EL      T + +EV E G  LD    K  + Y  SE RL E +E+  +CER+  Y +H ERK S R+AKG  QT  TLK L  +GV++ + +P  LWD+P+ E + L KQC  M+ + E+V+
Sbjct:   33 VCKLLSMELQEALSRTGRSREVLELGQVLDTGKRKRHVPYSLSETRLEEALEN--LCERILDYNVHAERKGSLRYAKGQSQTMATLKGLVQKGVKVDLGIPLELWDEPSVEVTFLKKQCETMLEEFEDVV 160          
BLAST of Protein canopy-like protein 3 vs. Ensembl Mouse
Match: Cnpy3 (canopy FGF signaling regulator 3 [Source:MGI Symbol;Acc:MGI:1919279])

HSP 1 Score: 59.3066 bits (142), Expect = 7.274e-11
Identity = 36/67 (53.73%), Postives = 47/67 (70.15%), Query Frame = 2
Query:  137 AEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNKNI-IKYEKSELRLTEVIEDP 328
            AE+   V+L +KCEVCK +A+EL S F+ET K KEV +TGY  LD K   +KY KS++R T V+ DP
Sbjct:   37 AEETDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIDTGYGILDGKGSGVKYTKSKVRPTGVLMDP 103          
BLAST of Protein canopy-like protein 3 vs. UniProt/SwissProt
Match: sp|Q9DAU1|CNPY3_MOUSE (Protein canopy homolog 3 OS=Mus musculus OX=10090 GN=Cnpy3 PE=1 SV=1)

HSP 1 Score: 177.563 bits (449), Expect = 2.878e-53
Identity = 98/187 (52.41%), Postives = 127/187 (67.91%), Query Frame = 2
Query:  137 AEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNKNI-IKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKETDFA 688
            AE+   V+L +KCEVCK +A+EL S F+ET K KEV +TGY  LD K   +KY KS+LRL EV E   IC+R+  Y LHKER  S RFAKG+ +TFETL  L  +GV++ MD+P  LW++ +AE + L KQC  +V + EEVIEDWY NHQ++DL +FLC  HVL  +   CL E+ S   K+ D A
Sbjct:   37 AEETDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIDTGYGILDGKGSGVKYTKSDLRLIEVTET--ICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAERWS--GKKGDIA 219          
BLAST of Protein canopy-like protein 3 vs. UniProt/SwissProt
Match: sp|Q0P5N1|CNPY3_BOVIN (Protein canopy homolog 3 OS=Bos taurus OX=9913 GN=CNPY3 PE=2 SV=1)

HSP 1 Score: 177.178 bits (448), Expect = 5.023e-53
Identity = 97/184 (52.72%), Postives = 126/184 (68.48%), Query Frame = 2
Query:  137 AEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNK-NIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKET 679
            AED   V+L +KCEVCK +A+EL S F+ET K KEV +TGY  LD K + +KY KS+LRL EV E   IC+R+  Y LHKER  S RFAKG+ +TFETL  L  +GV++ MD+P  LW++ +AE + L KQC  +V + EEVIEDWY NHQ++DL  FLC  HVL  +   CL E+ S +  +T
Sbjct:   43 AEDTDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIDTGYGILDRKASGVKYTKSDLRLIEVTET--ICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTQFLCANHVLKGKDASCLAEQWSGKKGDT 224          
BLAST of Protein canopy-like protein 3 vs. UniProt/SwissProt
Match: sp|Q9BT09|CNPY3_HUMAN (Protein canopy homolog 3 OS=Homo sapiens OX=9606 GN=CNPY3 PE=1 SV=1)

HSP 1 Score: 176.407 bits (446), Expect = 9.748e-53
Identity = 96/184 (52.17%), Postives = 126/184 (68.48%), Query Frame = 2
Query:  137 AEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNK-NIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKET 679
            AE+   V+L +KCEVCK +A+EL S F+ET K KEV  TGY  LD K + +KY KS+LRL EV E   IC+R+  Y LHKER  S RFAKG+ +TFETL  L  +GV++ MD+P  LW++ +AE + L KQC  +V + EEVIEDWY NHQ++DL +FLC  HVL  +   CL E+ S +  +T
Sbjct:   37 AEENDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIGTGYGILDQKASGVKYTKSDLRLIEVTET--ICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTEFLCANHVLKGKDTSCLAEQWSGKKGDT 218          
BLAST of Protein canopy-like protein 3 vs. UniProt/SwissProt
Match: sp|A5GFQ5|CNPY3_PIG (Protein canopy homolog 3 OS=Sus scrofa OX=9823 GN=CNPY3 PE=3 SV=1)

HSP 1 Score: 176.022 bits (445), Expect = 1.516e-52
Identity = 96/184 (52.17%), Postives = 126/184 (68.48%), Query Frame = 2
Query:  137 AEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNK-NIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKET 679
            AE+   V+L +KCEVCK +A+EL S F+ET K KEV +TGY  LD K + +KY KS+LRL EV E   IC+R+  Y LHKER  S RFAKG+ +TFETL  L  +GV++ MD+P  LW++ +AE + L KQC  +V + EEVIEDWY NHQ++DL  FLC  HVL  +   CL E+ S +  +T
Sbjct:   45 AEETDWVRLPSKCEVCKYVAVELKSAFEETGKTKEVIDTGYGILDRKASGVKYTKSDLRLIEVTET--ICKRLLDYSLHKERTGSNRFAKGMSETFETLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVLVEEFEEVIEDWYRNHQEEDLTQFLCANHVLKGKDTSCLAEQWSGKKGDT 226          
BLAST of Protein canopy-like protein 3 vs. UniProt/SwissProt
Match: sp|A3KNS2|CNPY3_DANRE (Protein canopy homolog 3 OS=Danio rerio OX=7955 GN=cnpy3 PE=2 SV=1)

HSP 1 Score: 166.392 bits (420), Expect = 5.926e-49
Identity = 92/186 (49.46%), Postives = 121/186 (65.05%), Query Frame = 2
Query:  143 DRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNKNI--IKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKETDFA 688
            D   V L  KCEVCK ++IE+ S F ET K KEV +T Y+ LD+K    IKY KS++R  EV E  ++C R+ QY LHKER  S RFAKG+ +TF TL  L  +GV++ MD+P  LW++ +AE + L KQC  MV Q+E+VIEDWY   Q++DL  +LC KHVL  +  GCL E  +   K+ D A
Sbjct:   22 DDEWVHLPNKCEVCKFVSIEMKSAFDETGKTKEVIDTNYRFLDDKGAPPIKYVKSDIRFIEVTE--NVCSRIMQYNLHKERDGSNRFAKGMSETFSTLHNLVNKGVKVVMDIPYELWNETSAEVADLKKQCDVMVEQYEDVIEDWYKGSQEEDLTTYLCEKHVLKGQDTGCLKETWA--GKKGDMA 203          
BLAST of Protein canopy-like protein 3 vs. TrEMBL
Match: G4VQL9 (Ctg4a-related OS=Schistosoma mansoni OX=6183 GN=Smp_060190.3 PE=4 SV=1)

HSP 1 Score: 192.971 bits (489), Expect = 1.079e-57
Identity = 89/195 (45.64%), Postives = 136/195 (69.74%), Query Frame = 2
Query:   71 FVLILFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDKKEVYETGYKLDNKNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEK 655
             +L LFS   +  F+     EI  D   V L +KCEVCK+L  E++SR +ET   +         +   +KYE SELRL EV+EDP IC R+ QY++HKER+DS+RF KG PQT ++L +L  RGV++K+DVP  LWD+P+ E ++L+K+C+P+V++++++IE+W++++QD +L D+LC ++VL+    GCLNEK
Sbjct:    1 MILHLFSLLVFLTFVR---GEIVND---VILPSKCEVCKLLVTEILSRLQETKSSDALNVRSVQGDSKKVKYETSELRLYEVLEDPPICSRLLQYKVHKERQDSSRFDKGTPQTMKSLTELVNRGVDVKLDVPFELWDKPSVEVTTLFKECIPLVNEYQDIIEEWFYSNQDINLYDYLCRENVLDKSSQGCLNEK 189          
BLAST of Protein canopy-like protein 3 vs. TrEMBL
Match: A0A4Z2DCJ7 (Protein canopy 4 isoform 1 OS=Schistosoma japonicum OX=6182 GN=EWB00_002446 PE=4 SV=1)

HSP 1 Score: 190.66 bits (483), Expect = 8.573e-57
Identity = 86/192 (44.79%), Postives = 137/192 (71.35%), Query Frame = 2
Query:   80 ILFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDKKEVYETGYKLDNKNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEK 655
            +L    S  +F+    +++  D   V L +KCEVCK+L  E++SR +ET   +         +   +KY+ SELRL EV+EDP IC R+ QY++HKER+DSTRF K +PQT ++L +L  RGV++K+DVP  LWD+P+AE ++L+KQC+P+V++++E+IE+W++N+Q+++L D+LC ++VL+    GCL+EK
Sbjct:    1 MLLGSISILIFLLLVKSDMMTD---VVLPSKCEVCKLLVTEILSRLQETKSSDALNLHSFQGDPMKLKYDTSELRLYEVLEDPPICNRLLQYKVHKERQDSTRFDKSMPQTMKSLSELVNRGVDVKLDVPFELWDKPSAEVTTLFKQCIPLVNEYQEIIEEWFYNNQNRNLYDYLCRENVLDESSQGCLDEK 189          
BLAST of Protein canopy-like protein 3 vs. TrEMBL
Match: K1QUP8 (Canopy-like protein 3 OS=Crassostrea gigas OX=29159 GN=CGI_10025608 PE=4 SV=1)

HSP 1 Score: 188.734 bits (478), Expect = 1.263e-55
Identity = 95/206 (46.12%), Postives = 126/206 (61.17%), Query Frame = 2
Query:   59 FIFKFVLILFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYKLDNKNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESK 673
            F F  VL+L       V I C+D     D  GV L + CEVCK    EL SR  ET K KE  + G+ LD K  I Y KSELRLTE + DPH+C+++ +Y +HKER  S RFAKG  +T ETL  L  +GV++++ +P  LWD P+AE + + ++C  M  ++E+ IEDWYFNHQ+KDLM +LC    L  +   CL EK  P+ K
Sbjct:    6 FGFTLVLLL-----NVVGINCND-----DDSGVILPSMCEVCKFFVTELQSRLDETGKTKETLQVGHGLDKKKKIVYHKSELRLTEALTDPHVCDKILEYNVHKERSGSNRFAKGRSETMETLHGLVNKGVKVELGIPHELWDAPSAEVTDMQRKCFKMAEEYEDEIEDWYFNHQEKDLMTYLCANRALRKDDKKCLTEKYEPKGK 201          
BLAST of Protein canopy-like protein 3 vs. TrEMBL
Match: A0A5E4PUU8 (DUF3456 domain-containing protein OS=Leptidea sinapis OX=189913 GN=LSINAPIS_LOCUS1973 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 2.074e-55
Identity = 97/206 (47.09%), Postives = 138/206 (66.99%), Query Frame = 2
Query:   71 FVLILFSFHSYYVFIECSDNEI-AEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYKLDN---KNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDK-DLMDFLCVKHVLNNEYNGCLNEKLSPES 670
             +L +F F  Y VF+  +D E+  E+  GVK A +CEVCKILA EL +R +ET K  ++ E GY LD+   K   KYEKSELRL E ++   +CE++ +Y +HKER+DSTRFAKG+ QTF+TL  L  +GV++ + +P  LWD+P+AE + +  QC  ++ ++EE IEDWY+ HQ   DL ++LCVKH L N  + CL E+L  + 
Sbjct:    1 MILKIFMFVMYLVFVASNDVEVKTEEDLGVKYANRCEVCKILATELQTRLEETGKVHDILEIGYSLDDVQPKKRTKYEKSELRLIESLDG--VCEKILEYNIHKERQDSTRFAKGMSQTFQTLHGLVDKGVKVDLGIPYELWDKPSAEITQMKSQCESLLEENEEAIEDWYWKHQGSIDLKNYLCVKHALRNTDDSCLYEELQSKG 204          
BLAST of Protein canopy-like protein 3 vs. TrEMBL
Match: A0A0V0J325 (DUF3456 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR88674 PE=4 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 5.789e-55
Identity = 90/178 (50.56%), Postives = 122/178 (68.54%), Query Frame = 2
Query:  140 EDRHGVKLATKCEVCKILAIELISRFKETDKKEVYETGYKLDNKNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMD-FLCVKHVLNNEYNGCLNEKLSPES 670
            ED +GVK  T CEVCKI A E + RFKET    +    Y  ++   + Y  SELRLTE++++P +C+RM QY++HKER DSTRF K +PQTFE LK+L  RGV++K DVP  LWD P+AE + L K C+ ++ ++EEVIEDW+++HQ ++  D FLC KH+L    + CL E L P S
Sbjct:   32 EDDYGVKPPTACEVCKIFANEFMDRFKETSSFGLINIDYGAEDGRQLPYATSELRLTEILQEPSLCDRMLQYRVHKERTDSTRFEKRVPQTFEVLKELLDRGVDVKTDVPYQLWDSPSAEITLLQKSCLIILEEYEEVIEDWFYHHQLEEPFDIFLCSKHMLKGLPSDCLKETLPPPS 209          
BLAST of Protein canopy-like protein 3 vs. Ensembl Cavefish
Match: cnpy3 (canopy FGF signaling regulator 3 [Source:NCBI gene;Acc:103043697])

HSP 1 Score: 163.31 bits (412), Expect = 9.702e-49
Identity = 92/186 (49.46%), Postives = 121/186 (65.05%), Query Frame = 2
Query:  107 VFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNKNI--IKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNE 652
            VF+  S+ E  E  H   L  KCEVCK ++IE+ S  +ET K KEV ET Y+ LD+K    IKY KS++R  EVIE   +C R+  Y LHKER  S RFAKG+ +TF TL  L  +GV++ MD+P  LW++ +AE + L KQC  M+ Q+EEVIEDWY  +Q++DL  +LC KHVL  +   CL E
Sbjct:   10 VFVGVSEGEEDEWVH---LPNKCEVCKFVSIEMKSALEETGKTKEVIETNYRFLDDKGAPPIKYVKSDIRFIEVIE--SVCSRILSYNLHKERDGSNRFAKGMSETFSTLHNLVHKGVKVVMDIPYELWNETSAEVADLKKQCDVMIEQYEEVIEDWYKGNQEEDLTTYLCGKHVLKGQDQECLKE 190          
BLAST of Protein canopy-like protein 3 vs. Ensembl Cavefish
Match: cnpy4 (canopy FGF signaling regulator 4 [Source:NCBI gene;Acc:103047252])

HSP 1 Score: 155.606 bits (392), Expect = 5.468e-46
Identity = 80/169 (47.34%), Postives = 108/169 (63.91%), Query Frame = 2
Query:  158 KLATKCEVCKILAIELISRFKETDK-KEVYETGYKLDN---KNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNE 652
            +L  KCEVCK L +EL +  ++T + KEV E G  LD    +  IKY  SE RLTE +++  IC  + QY +H ER  S R+AKG  QT  TLK L  +GV++++ +P  LWD+PT E + L +QC  M+ ++EEV+EDWYFNHQ++ L  FLC  HVL N    CL E
Sbjct:   49 RLPKKCEVCKFLTVELQAALEKTGRSKEVMELGEVLDTGKRRRKIKYNTSETRLTEAVDN--ICAGILQYNVHAERPGSLRYAKGASQTMSTLKNLVDKGVKVELGIPYELWDEPTVEVADLKRQCETMLEEYEEVVEDWYFNHQEQRLEKFLCETHVLKNSDMECLKE 215          
BLAST of Protein canopy-like protein 3 vs. Ensembl Nematostella
Match: EDO37294 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG92])

HSP 1 Score: 107.071 bits (266), Expect = 6.351e-28
Identity = 67/168 (39.88%), Postives = 97/168 (57.74%), Query Frame = 2
Query:  167 TKCEVCKILAIELISRFKETDKKEVYETGYKLD----NKNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDST-RFAKGIPQTF-ETLKKLSARG-VEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLN 649
            TKC+VC+++  EL+ R K T+ KE    GY LD     +  I Y  SELRL +V++D  +C+R+   +L++ R      + KG      E +  L+AR  V +K  VP+ + +  T E   +  QCV M+   EEVIE+WYF HQD+DLM +LC + VL  +  GCLN
Sbjct:   47 TKCQVCRLMVSELLERLKITNYKETLNKGYGLDLGEDPRLQIHYHTSELRLADVLDD--LCDRV---KLYRARAGPAFPYIKGAKSHLREAMDDLAARSKVGLKFHVPDDVIEDYTYEVVRMKFQCVHMLELFEEVIEEWYFEHQDQDLMTWLCRERVLKIDEQGCLN 209          
BLAST of Protein canopy-like protein 3 vs. Ensembl Nematostella
Match: EDO35469 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SLC4])

HSP 1 Score: 111.694 bits (278), Expect = 1.022e-27
Identity = 51/117 (43.59%), Postives = 77/117 (65.81%), Query Frame = 2
Query:  278 IKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNN 628
            I Y KSELRLTE +E+   C  +  Y++HK++  + R+ K    TF+TLK L  RGV++ +  P+ +WD P AE + L  +C  MV QHE+ I +WY+NH D++L  +LC++ VLN+
Sbjct:   28 INYRKSELRLTEALEEA--CSNVLDYKVHKDKPLAQRYEKVESVTFKTLKGLKKRGVKVDLGFPDQMWDTPDAEVTRLKNRCEYMVEQHEDDITEWYWNHPDENLTQWLCIERVLNS 142          
BLAST of Protein canopy-like protein 3 vs. Ensembl Nematostella
Match: EDO37273 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG93])

HSP 1 Score: 48.9062 bits (115), Expect = 4.533e-7
Identity = 24/66 (36.36%), Postives = 32/66 (48.48%), Query Frame = 2
Query:  464 VPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLS 661
             PE   D PT E   L K+C  M+   + ++  W+   Q +DL  +LC   VL  E   CLN  LS
Sbjct:  129 TPEENLDDPTGEIRRLEKKCKKMLVAEQHMLVHWFMKEQSRDLTTWLCANRVLIGEDQDCLNVDLS 194          
BLAST of Protein canopy-like protein 3 vs. Ensembl Medaka
Match: cnpy3 (protein canopy homolog 3-like [Source:NCBI gene;Acc:101158057])

HSP 1 Score: 167.548 bits (423), Expect = 3.658e-50
Identity = 89/181 (49.17%), Postives = 120/181 (66.30%), Query Frame = 2
Query:  143 DRHGVKLATKCEVCKILAIELISRFKETDK-KEVYETGYK-LDNKNI--IKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESK 673
            D   V L  KCEVCK ++IE+ S F+ET K KEV ++ Y  +D K    IKY KS+LR  EV+E  ++C+R+ +Y LHKER  S RFAKG+ +TF TL  L  +GV++ MD+P  LW++ +AE + L KQC  M+ Q+EEVIEDWY   Q++DL  FLC KHVL  +   CLNE  + + K
Sbjct:   25 DDEWVHLPNKCEVCKFVSIEMKSAFQETGKTKEVIDSKYNFIDGKGAPPIKYVKSDLRFIEVVE--NVCQRLLEYNLHKERSGSNRFAKGMSETFSTLHGLVNKGVKVVMDIPYELWNETSAEVADLKKQCDVMIEQYEEVIEDWYKGSQEEDLTTFLCEKHVLKGQDKDCLNENWTAKKK 203          
BLAST of Protein canopy-like protein 3 vs. Ensembl Medaka
Match: cnpy2 (protein canopy homolog 2 [Source:NCBI gene;Acc:101175475])

HSP 1 Score: 48.1358 bits (113), Expect = 1.861e-6
Identity = 58/201 (28.86%), Postives = 92/201 (45.77%), Query Frame = 2
Query:   74 VLILFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDKKEVYETG-YKL--DNKNIIK---YEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHE-EVIEDWYFNHQDKDLMDFLCVK------HVLNNEYN 637
             L+L S     +F+ CS       R G  +  KC  C+ L  E+     + D K+  +TG +++  D    I+     +SE  L E++E   +CERM  Y    ER D       +    ++  ++ +R  E  MD+ E+  D     TSSL   C  +V  HE E+IE  +F H+ +++ D LC K      H LN  ++
Sbjct:    6 ALLLTSCVVVGLFLSCSQAA----RQGQDI--KCGACRALVDEMEWAISQIDPKKTIQTGSFRINPDGSQSIREVPLARSEGNLLELMES--VCERMEDY---GERTD-------LSTDRKSYIRVKSRTGE-AMDLSEATLDSRV--TSSLKFACETIVEHHEDEIIE--FFAHETENVKDKLCSKRTDLCDHALNMAHD 183          
BLAST of Protein canopy-like protein 3 vs. Planmine SMEST
Match: SMESG000068798.1 (SMESG000068798.1)

HSP 1 Score: 442.58 bits (1137), Expect = 1.886e-159
Identity = 213/215 (99.07%), Postives = 214/215 (99.53%), Query Frame = 2
Query:   38 LMKYSGNFIFKFVLILFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDKKEVYETGYKLDNKNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKETD 682
            + KYSGNFIFKFVLILFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDKKEVYETGYKLDNKNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKETD
Sbjct:    1 MHKYSGNFIFKFVLILFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKILAIELISRFKETDKKEVYETGYKLDNKNIIKYEKSELRLTEVIEDPHICERMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQPTAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNGCLNEKLSPESKETD 215          
The following BLAST results are available for this feature:
BLAST of Protein canopy-like protein 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CNPY32.030e-5352.17canopy FGF signaling regulator 3 [Source:HGNC Symb... [more]
CNPY43.703e-4243.43canopy FGF signaling regulator 4 [Source:HGNC Symb... [more]
CNPY42.148e-2242.74canopy FGF signaling regulator 4 [Source:HGNC Symb... [more]
CNPY32.626e-1154.79canopy FGF signaling regulator 3 [Source:HGNC Symb... [more]
back to top
BLAST of Protein canopy-like protein 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
C11H1.73.712e-2126.22pep chromosome:WBcel235:X:14327409:14330195:1 gene... [more]
C11H1.73.712e-2126.22pep chromosome:WBcel235:X:14327569:14330193:1 gene... [more]
C11H1.72.091e-833.33pep chromosome:WBcel235:X:14329920:14330135:1 gene... [more]
back to top
BLAST of Protein canopy-like protein 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
CNPYb2.020e-5044.00gene:FBgn0036847 transcript:FBtr0075034[more]
back to top
BLAST of Protein canopy-like protein 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cnpy38.108e-5049.46canopy FGF signaling regulator 3 [Source:NCBI gene... [more]
cnpy38.108e-5049.46canopy FGF signaling regulator 3 [Source:NCBI gene... [more]
cnpy42.063e-4945.88canopy FGF signaling regulator 4 [Source:NCBI gene... [more]
cnpy42.063e-4945.88canopy FGF signaling regulator 4 [Source:NCBI gene... [more]
cnpy44.118e-3651.82canopy FGF signaling regulator 4 [Source:NCBI gene... [more]
back to top
BLAST of Protein canopy-like protein 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein canopy-like protein 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Cnpy34.115e-5452.41canopy FGF signaling regulator 3 [Source:MGI Symbo... [more]
Cnpy42.600e-4439.23canopy FGF signaling regulator 4 [Source:MGI Symbo... [more]
Cnpy47.845e-2642.31canopy FGF signaling regulator 4 [Source:MGI Symbo... [more]
Cnpy37.274e-1153.73canopy FGF signaling regulator 3 [Source:MGI Symbo... [more]
back to top
BLAST of Protein canopy-like protein 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9DAU1|CNPY3_MOUSE2.878e-5352.41Protein canopy homolog 3 OS=Mus musculus OX=10090 ... [more]
sp|Q0P5N1|CNPY3_BOVIN5.023e-5352.72Protein canopy homolog 3 OS=Bos taurus OX=9913 GN=... [more]
sp|Q9BT09|CNPY3_HUMAN9.748e-5352.17Protein canopy homolog 3 OS=Homo sapiens OX=9606 G... [more]
sp|A5GFQ5|CNPY3_PIG1.516e-5252.17Protein canopy homolog 3 OS=Sus scrofa OX=9823 GN=... [more]
sp|A3KNS2|CNPY3_DANRE5.926e-4949.46Protein canopy homolog 3 OS=Danio rerio OX=7955 GN... [more]
back to top
BLAST of Protein canopy-like protein 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VQL91.079e-5745.64Ctg4a-related OS=Schistosoma mansoni OX=6183 GN=Sm... [more]
A0A4Z2DCJ78.573e-5744.79Protein canopy 4 isoform 1 OS=Schistosoma japonicu... [more]
K1QUP81.263e-5546.12Canopy-like protein 3 OS=Crassostrea gigas OX=2915... [more]
A0A5E4PUU82.074e-5547.09DUF3456 domain-containing protein OS=Leptidea sina... [more]
A0A0V0J3255.789e-5550.56DUF3456 domain-containing protein OS=Schistocephal... [more]
back to top
BLAST of Protein canopy-like protein 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cnpy39.702e-4949.46canopy FGF signaling regulator 3 [Source:NCBI gene... [more]
cnpy45.468e-4647.34canopy FGF signaling regulator 4 [Source:NCBI gene... [more]
back to top
BLAST of Protein canopy-like protein 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein canopy-like protein 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein canopy-like protein 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO372946.351e-2839.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO354691.022e-2743.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO372734.533e-736.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein canopy-like protein 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cnpy33.658e-5049.17protein canopy homolog 3-like [Source:NCBI gene;Ac... [more]
cnpy21.861e-628.86protein canopy homolog 2 [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Protein canopy-like protein 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000068798.11.886e-15999.07SMESG000068798.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023812 ID=SMED30023812|Name=Protein canopy-like protein 3|organism=Schmidtea mediterranea sexual|type=transcript|length=835bp
GTATCTTACACTTTTGGCGCATCGCAGTACTTAAATTTTAATGAAGTATT
CTGGAAATTTTATTTTCAAATTCGTTCTAATTTTATTCTCATTTCATTCT
TATTATGTTTTCATCGAATGTTCAGATAATGAAATAGCTGAAGATCGACA
TGGGGTGAAACTTGCAACCAAATGCGAAGTGTGTAAGATATTAGCAATTG
AGTTAATATCTCGCTTTAAGGAAACAGATAAGAAGGAAGTTTATGAAACT
GGTTACAAATTGGATAACAAAAATATCATTAAATATGAAAAATCAGAATT
ACGGTTGACGGAAGTGATTGAAGATCCCCATATTTGTGAAAGAATGTGGC
AATACCAATTACACAAAGAAAGAAAAGATAGTACTAGATTCGCCAAAGGA
ATACCTCAAACATTTGAAACTCTAAAAAAATTAAGTGCCCGTGGAGTAGA
AATCAAAATGGATGTACCAGAATCTTTGTGGGATCAGCCGACTGCTGAAA
CATCTTCATTGTACAAACAGTGTGTGCCAATGGTATCTCAGCATGAGGAA
GTTATCGAGGATTGGTACTTTAATCATCAAGATAAGGATTTAATGGATTT
TTTATGTGTCAAACACGTTCTGAACAATGAATATAACGGTTGTCTAAATG
AAAAATTGTCTCCGGAATCAAAGGAAACAGATTTCGCAACAGAAAATAAC
ACAAATAATTTAGAGACAGCGCACATTTTGTGCATTCTTTAGTTGCAAGC
AAAACTTTACAAAAATCAAGGAAAACATTTCTTTTCGAGAGTTTTCCCTT
TCATATTATTTAGAAACTTTTTTGGTAACATTGAC
back to top

protein sequence of SMED30023812-orf-1

>SMED30023812-orf-1 ID=SMED30023812-orf-1|Name=SMED30023812-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=234bp
MKYSGNFIFKFVLILFSFHSYYVFIECSDNEIAEDRHGVKLATKCEVCKI
LAIELISRFKETDKKEVYETGYKLDNKNIIKYEKSELRLTEVIEDPHICE
RMWQYQLHKERKDSTRFAKGIPQTFETLKKLSARGVEIKMDVPESLWDQP
TAETSSLYKQCVPMVSQHEEVIEDWYFNHQDKDLMDFLCVKHVLNNEYNG
CLNEKLSPESKETDFATENNTNNLETAHILCIL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005102signaling receptor binding
Vocabulary: INTERPRO
TermDefinition
IPR021852DUF3456
Vocabulary: biological process
TermDefinition
GO:0002376immune system process
GO:0045087innate immune response
Vocabulary: cellular component
TermDefinition
GO:0005783endoplasmic reticulum
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR021852Domain of unknown function DUF3456PFAMPF11938DUF3456coord: 44..192
e-value: 5.9E-41
score: 140.6
NoneNo IPR availablePANTHERPTHR15382:SF6coord: 33..222
NoneNo IPR availablePANTHERPTHR15382CTG4A-RELATEDcoord: 33..222
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..27
score: 0.587