cAMP-dependent protein kinase type II regulatory subunit, putative

Overview
NamecAMP-dependent protein kinase type II regulatory subunit, putative
Smed IDSMED30023807
Length (bp)1047
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of cAMP-dependent protein kinase type II regulatory subunit, putative (SMED30023807) t-SNE clustered cells

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type II regulatory subunit, putative (SMED30023807) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of cAMP-dependent protein kinase type II regulatory subunit, putative (SMED30023807) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for cAMP-dependent protein kinase type II regulatory subunit, putative (SMED30023807) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023807

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
testis primordiumSMED30023807SMESG000013519.1 Contig1310_SE3GPL10652PMID:20844018
Wang et al., 2010
whole organism juvenile cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Human
Match: PRKAR2B (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 141.354 bits (355), Expect = 8.479e-38
Identity = 85/254 (33.46%), Postives = 151/254 (59.45%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKK-------VLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+++++ A K I LF+ L+  + +++++ M  K+VKD E +I + D GDNFYVI+RG ++ Y +    G+ +  Y+N G FGELAL+YNTPR AT+ AT+ G LW LDR +F+R I+++   KRK  E+ ++  P L++L   E + ++D +  + +++ + +  +GD+ D+ ++++ GE++I  K  G+  V++           G YFGE  ++  +P + +A    +VK   +  + F      LL  C E
Sbjct:  141 QRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAF----ERLLGPCME 390          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Human
Match: PRKAR2B (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 141.354 bits (355), Expect = 8.479e-38
Identity = 85/254 (33.46%), Postives = 151/254 (59.45%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKK-------VLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+++++ A K I LF+ L+  + +++++ M  K+VKD E +I + D GDNFYVI+RG ++ Y +    G+ +  Y+N G FGELAL+YNTPR AT+ AT+ G LW LDR +F+R I+++   KRK  E+ ++  P L++L   E + ++D +  + +++ + +  +GD+ D+ ++++ GE++I  K  G+  V++           G YFGE  ++  +P + +A    +VK   +  + F      LL  C E
Sbjct:  141 QRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAF----ERLLGPCME 390          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 138.658 bits (348), Expect = 7.167e-37
Identity = 84/255 (32.94%), Postives = 148/255 (58.04%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY----KEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQII--------KKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +++++ M  +IVK  E +I + D GDNFYVIERG Y+       + + + +Y+N G FGELAL+YNTPR AT++AT++G LW LDR +F+R I+++   KRK  E+ ++  P+L++L   E + ++D +  + + + + +  +G+  D+ Y+I+ GE+ I+        K    Q+V       G YFGE  ++  +P + +A     VK  ++  + F      LL  C +
Sbjct:  126 QRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAF----ERLLGPCMD 376          

HSP 2 Score: 49.6766 bits (117), Expect = 5.010e-6
Identity = 47/145 (32.41%), Postives = 76/145 (52.41%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIE--------RGKYEAYKEGKF----LKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRS-----ETLVK 632
            ++   +S ++S+ L + LE +E  +I++ +  KI KD E II + +  D+FY+IE        R + ++ K+G      + R     YFGELAL+ N PR A+  A  D +   +D  +F+R +L    D  KR+     E LVK
Sbjct:  248 KRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFER-LLGPCMDIMKRNISHYEEQLVK 391          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 138.658 bits (348), Expect = 7.167e-37
Identity = 84/255 (32.94%), Postives = 148/255 (58.04%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY----KEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQII--------KKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +++++ M  +IVK  E +I + D GDNFYVIERG Y+       + + + +Y+N G FGELAL+YNTPR AT++AT++G LW LDR +F+R I+++   KRK  E+ ++  P+L++L   E + ++D +  + + + + +  +G+  D+ Y+I+ GE+ I+        K    Q+V       G YFGE  ++  +P + +A     VK  ++  + F      LL  C +
Sbjct:  126 QRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAF----ERLLGPCMD 376          

HSP 2 Score: 49.6766 bits (117), Expect = 5.010e-6
Identity = 47/145 (32.41%), Postives = 76/145 (52.41%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIE--------RGKYEAYKEGKF----LKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRS-----ETLVK 632
            ++   +S ++S+ L + LE +E  +I++ +  KI KD E II + +  D+FY+IE        R + ++ K+G      + R     YFGELAL+ N PR A+  A  D +   +D  +F+R +L    D  KR+     E LVK
Sbjct:  248 KRKMFESFIESVPLLKSLEVSERMKIVDVIGEKIYKDGERIITQGEKADSFYIIESGEVSILIRSRTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFER-LLGPCMDIMKRNISHYEEQLVK 391          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Human
Match: PRKAR2A (protein kinase cAMP-dependent type II regulatory subunit alpha [Source:HGNC Symbol;Acc:HGNC:9391])

HSP 1 Score: 122.865 bits (307), Expect = 2.981e-31
Identity = 80/246 (32.52%), Postives = 139/246 (56.50%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY----KEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +++++ M  +IVK  E +I + D GDNFYVIERG Y+       + + + +Y+N G FGELAL+YNTPR AT++AT++G LW LDR +F+R I+++   KRK  E+ ++  P+L++L   E + ++D +       + ++K+G+   T       + +  K    Q+V       G YFGE  ++  +P + +A     VK  ++  + F      LL  C +
Sbjct:  126 QRCRLQEACKDILLFKNLDQEQLSQVLDAMFERIVKADEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIVATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLLKSLEVSERMKIVDVI------GEKIYKDGERIIT-------QTKSNKDGGNQEVEIARCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAF----ERLLGPCMD 354          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 114.005 bits (284), Expect = 9.020e-29
Identity = 82/252 (32.54%), Postives = 134/252 (53.17%), Query Frame = 3
Query:  261 IKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSNKI-LFKEGDNNDTIYLIDEGEIQIIKKVNGQ---DVVKKVLKSGTYFGEETVLFKRPSSFT--ARTG-PSVKLGLLSDETFIINIYSLLSKCTENCESFIK 995
            ++SA++   LF  LEE+E   + + M        E II++ + GDNFYVI++G  + Y   +++      G FGELAL+Y TPR ATVIA TD +LW++DR +++R ++     KRK  +  + K  IL +L + E   + D+++   F     + ++G   D  ++I EGE  +++K +     DVV   L    YFGE  +L  RP + T  A+T    +KL     E  +  +  +L +   N  S++K
Sbjct:   81 LESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGH-LGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNSYVK 331          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 114.39 bits (285), Expect = 1.267e-28
Identity = 82/252 (32.54%), Postives = 134/252 (53.17%), Query Frame = 3
Query:  261 IKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSNKI-LFKEGDNNDTIYLIDEGEIQIIKKVNGQ---DVVKKVLKSGTYFGEETVLFKRPSSFT--ARTG-PSVKLGLLSDETFIINIYSLLSKCTENCESFIK 995
            ++SA++   LF  LEE+E   + + M        E II++ + GDNFYVI++G  + Y   +++      G FGELAL+Y TPR ATVIA TD +LW++DR +++R ++     KRK  +  + K  IL +L + E   + D+++   F     + ++G   D  ++I EGE  +++K +     DVV   L    YFGE  +L  RP + T  A+T    +KL     E  +  +  +L +   N  S++K
Sbjct:  113 LESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGH-LGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNSYVK 363          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Celegans
Match: kin-2 (cAMP-dependent protein kinase regulatory subunit [Source:UniProtKB/Swiss-Prot;Acc:P30625])

HSP 1 Score: 114.39 bits (285), Expect = 1.427e-28
Identity = 82/252 (32.54%), Postives = 134/252 (53.17%), Query Frame = 3
Query:  261 IKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSNKI-LFKEGDNNDTIYLIDEGEIQIIKKVNGQ---DVVKKVLKSGTYFGEETVLFKRPSSFT--ARTG-PSVKLGLLSDETFIINIYSLLSKCTENCESFIK 995
            ++SA++   LF  LEE+E   + + M        E II++ + GDNFYVI++G  + Y   +++      G FGELAL+Y TPR ATVIA TD +LW++DR +++R ++     KRK  +  + K  IL +L + E   + D+++   F     + ++G   D  ++I EGE  +++K +     DVV   L    YFGE  +L  RP + T  A+T    +KL     E  +  +  +L +   N  S++K
Sbjct:  123 LESAMRKNLLFAHLEEDEQKTMYDAMFPVEKSAGETIIEQGEEGDNFYVIDKGTVDVYVNHEYVLTINEGGSFGELALIYGTPRAATVIAKTDVKLWAIDRLTYRRILMGSVTKKRKMYDEFLSKVQILADLDQWERANVADALERCDFEPGTHVVEQGQPGDEFFIILEGEANVLQKRSDDAPFDVVGH-LGMSDYFGEIALLLDRPRAATVVAKTHLKCIKLDRNRFERVMGPVREILKRDVSNYNSYVK 373          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 97.4413 bits (241), Expect = 6.472e-22
Identity = 63/233 (27.04%), Postives = 119/233 (51.07%), Query Frame = 3
Query:  252 KDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSF-SNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVK--KVLKSGTYFGEETVLFK--RPSSFTARTGPSVKLGLLSDETF 935
            K  I+ A++     + L + +  E++  M     +  + +I+E +PGD  +V+  G+ +  +EG  L +       GELA+LYN  R A+V A TD QLW LDR+ FQ    +   ++  +    + K  I QNL E     + D +    +     + ++G+  D  ++I+ G++++ +++ G+   +  +VL  G +FGE  +L +  R ++  A+  P V++  L  E+F
Sbjct:  158 KQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQA-PGVEVLTLDRESF 389          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Celegans
Match: egl-4 (cGMP-dependent protein kinase egl-4 [Source:UniProtKB/Swiss-Prot;Acc:O76360])

HSP 1 Score: 97.4413 bits (241), Expect = 6.472e-22
Identity = 63/233 (27.04%), Postives = 119/233 (51.07%), Query Frame = 3
Query:  252 KDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSF-SNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVK--KVLKSGTYFGEETVLFK--RPSSFTARTGPSVKLGLLSDETF 935
            K  I+ A++     + L + +  E++  M     +  + +I+E +PGD  +V+  G+ +  +EG  L +       GELA+LYN  R A+V A TD QLW LDR+ FQ    +   ++  +    + K  I QNL E     + D +    +     + ++G+  D  ++I+ G++++ +++ G+   +  +VL  G +FGE  +L +  R ++  A+  P V++  L  E+F
Sbjct:  158 KQMIRDAVQKNDFLKQLAKEQIIELVNCMYEMRARAGQWVIQEGEPGDRLFVVAEGELQVSREGALLGKMRAGTVMGELAILYNCTRTASVQALTDVQLWVLDRSVFQMITQRLGMERHSQLMNFLTKVSIFQNLSEDRISKMADVMDQDYYDGGHYIIRQGEKGDAFFVINSGQVKVTQQIEGETEPREIRVLNQGDFFGERALLGEEVRTANIIAQA-PGVEVLTLDRESF 389          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0112902)

HSP 1 Score: 161.384 bits (407), Expect = 4.829e-46
Identity = 105/307 (34.20%), Postives = 166/307 (54.07%), Query Frame = 3
Query:   81 HATTSARNRASLGTVDMEQLANAIRSLPRHGVTAEKVDPRDATXXXXXXXX-XXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTA-RTGPSVKLGLLSDETFIINIYSLLSKCTENCESFI 992
            H   S  ++ S+ + D +     + S  R  V AE  DP              K+  Q+ ++  ++K++ LF  LE+ + N++++ M  + V+  + II++ D GDNFYVIE G Y+ Y   K +  Y ++G FGELALLYN PR ATV A T G LW++DR +F+R +L+ AF KRK  E L+   P+L+ L  +E + L D++  +S+ N + + K+GD  D +Y I+EG + +    +  +V    L  G YFGE  ++  RP + +   TG  VKL  L     +I    L+ KC+   +  I
Sbjct:   54 HTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLD----VICFERLMGKCSGGIQRSI 356          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0112901)

HSP 1 Score: 160.229 bits (404), Expect = 1.240e-45
Identity = 102/288 (35.42%), Postives = 159/288 (55.21%), Query Frame = 3
Query:   81 HATTSARNRASLGTVDMEQLANAIRSLPRHGVTAEKVDPRDATXXXXXXXX-XXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTA-RTGPSVKLGLLSDETF 935
            H   S  ++ S+ + D +     + S  R  V AE  DP              K+  Q+ ++  ++K++ LF  LE+ + N++++ M  + V+  + II++ D GDNFYVIE G Y+ Y   K +  Y ++G FGELALLYN PR ATV A T G LW++DR +F+R +L+ AF KRK  E L+   P+L+ L  +E + L D++  +S+ N + + K+GD  D +Y I+EG + +    +  +V    L  G YFGE  ++  RP + +   TG  VKL  L  E F
Sbjct:   54 HTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDTEAF 341          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0088437)

HSP 1 Score: 158.688 bits (400), Expect = 5.714e-45
Identity = 104/301 (34.55%), Postives = 163/301 (54.15%), Query Frame = 3
Query:   81 HATTSARNRASLGTVDMEQLANAIRSLPRHGVTAEKVDPRDATXXXXXXXX-XXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTA-RTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            H   S  ++ S+ + D +     + S  R  V AE  DP              K+  Q+ ++  ++K++ LF  LE+ + N++++ M  + V+  + II++ D GDNFYVIE G Y+ Y   K +  Y ++G FGELALLYN PR ATV A T G LW++DR +F+R +L+ AF KRK  E L+   P+L+ L  +E + L D++  +S+ N + + K+GD  D +Y I+EG + +    +  +V    L  G YFGE  ++  RP + +   TG  VKL  L  + F      LL  C +
Sbjct:   54 HTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAF----ERLLGPCMD 350          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Fly
Match: Pka-R2 (gene:FBgn0022382 transcript:FBtr0088438)

HSP 1 Score: 158.688 bits (400), Expect = 5.714e-45
Identity = 104/301 (34.55%), Postives = 163/301 (54.15%), Query Frame = 3
Query:   81 HATTSARNRASLGTVDMEQLANAIRSLPRHGVTAEKVDPRDATXXXXXXXX-XXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTA-RTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            H   S  ++ S+ + D +     + S  R  V AE  DP              K+  Q+ ++  ++K++ LF  LE+ + N++++ M  + V+  + II++ D GDNFYVIE G Y+ Y   K +  Y ++G FGELALLYN PR ATV A T G LW++DR +F+R +L+ AF KRK  E L+   P+L+ L  +E + L D++  +S+ N + + K+GD  D +Y I+EG + +    +  +V    L  G YFGE  ++  RP + +   TG  VKL  L  + F      LL  C +
Sbjct:   54 HTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAF----ERLLGPCMD 350          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Fly
Match: Pka-R1 (gene:FBgn0259243 transcript:FBtr0300533)

HSP 1 Score: 123.635 bits (309), Expect = 1.670e-32
Identity = 88/255 (34.51%), Postives = 138/255 (54.12%), Query Frame = 3
Query:  165 RHGVTAEKVDPRDATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEG-EIQIIKKVNGQDVVK-KVLKSGTYFGEETVLFKRPSSFTART-GP--SVKL 911
            R G++AE V   DAT  + +             K+  K++ LF  L+E+E ++I + M        E II++ D GDNFYVI+ G+ + +   + +      G FGELAL+Y TPR ATV A TD +LW +DR+S++R ++     KRK  E  + +  IL++L + E + + DS++  SF + + + K+G   D  Y+I EG  + + ++  G+D  +   L S  YFGE  +L  RP + T    GP   VKL
Sbjct:   12 RGGISAEPVTEEDATNYVKKVVPKDYKTMNALSKAIAKNV-LFAHLDESERSDIFDAMFPVNHIAGENIIQQGDEGDNFYVIDVGEVDVFVNSELVTTISEGGSFGELALIYGTPRAATVRAKTDVKLWGIDRDSYRRILMGSTIRKRKMYEEFLSRVSILESLDKWERLTVADSLETCSFDDGETIVKQGAAGDDFYIILEGCAVVLQQRSEGEDPAEVGRLGSSDYFGEIALLLDRPRAATVVARGPLKCVKL 265          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Zebrafish
Match: prkar2ab (protein kinase, cAMP-dependent, regulatory, type II, alpha, B [Source:ZFIN;Acc:ZDB-GENE-040426-2427])

HSP 1 Score: 144.821 bits (364), Expect = 2.468e-39
Identity = 83/222 (37.39%), Postives = 137/222 (61.71%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLK----RYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNG-------QDVVKKVLKSGTYFGEETVLFKRPSS 878
            Q+ +++ A K I LF+ LEE++  E+++ M   +VK  E II + D GDNFYVIERG YE   +   L+    RY++ G FGELAL+YNTPR AT+ A  +G LW+LDR +F R I+++   KR+  E+ ++  P+L++L   E + ++D +  +SFS+ + + ++GD+ D  Y+++ GE++I+ +          ++V       G YFGE  ++ KRP +
Sbjct:  148 QRQRLQDACKHILLFKTLEEDQLAEVLDSMFEVLVKPGECIINQGDDGDNFYVIERGVYEIVIQQDGLQHSVGRYDHKGSFGELALMYNTPRAATIRALQEGALWALDRATFHRLIVKNNAKKRRMYESFIECVPLLKSLQLSERMKIVDVLGMRSFSDGERIIQQGDSADCFYIVESGEVRIMIRSKTRACQLLQEEVEVARCSRGQYFGELALVTKRPRA 369          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 141.739 bits (356), Expect = 2.279e-38
Identity = 85/247 (34.41%), Postives = 141/247 (57.09%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKR----YENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFS-NKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +++++ M  K+V   E II ++D GDNFYVIERG +E   +     R    Y+N G FGELAL+YNTPR AT+IAT+ G LW LDR +F+R I+++   KRK  E  +   P+L +L   E + ++D +  + ++  + +  +GD  D  Y+++ G ++I  K +  +V       G YFGE  ++  +P + +A    SVK  ++  + F      LL  C +
Sbjct:  117 QRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKADGTTRTVGSYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMKRSKVEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAF----ERLLGPCMD 359          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Zebrafish
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 141.354 bits (355), Expect = 4.156e-38
Identity = 85/254 (33.46%), Postives = 146/254 (57.48%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQII----KKVNGQD---VVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +E+++ M   +V+ ++ +I + D GDNFYVIERG Y+   +    G  + +Y N G FGELAL+YNTPR AT+IA  +G LW LDR +F+R I+++   KR+  E  ++  P+L++L   E + ++D +  ++F + + +  +GD  D  Y+++ GE++I+     K + QD   V       G YFGE  ++  +P + +A     VK  ++  + F      LL  C E
Sbjct:  123 QRCRLQEACKDILLFKALDQEQFSEVLDAMFEVLVQPQDHVIDQGDDGDNFYVIERGVYDIVVQKDGVGCCVGQYNNKGSFGELALMYNTPRAATIIAKDEGALWGLDRATFRRLIVKNNAKKRRMYECFIESIPLLKSLELSERMKIVDVLGVKTFQDGERIIMQGDKADCFYIVESGEVKIMMKSKTKADRQDNAEVEIARCSRGQYFGELALVTNKPRAASAYAIGDVKCLVIDIQAF----ERLLGPCKE 372          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 139.043 bits (349), Expect = 1.734e-37
Identity = 85/247 (34.41%), Postives = 141/247 (57.09%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKR----YENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFS-NKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +++++ M  K+V   E II ++D GDNFYVIERG +E   +     R    Y+N G FGELAL+YNTPR AT+IAT+ G LW LDR +F+R I+++   KRK  E  +   P+L +L   E + ++D +  + ++  + +  +GD  D  Y+++ G ++I  K   ++V       G YFGE  ++  +P + +A    SVK  ++  + F      LL  C +
Sbjct:  112 QRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKADGTTRTVGSYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMK-RSKEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAF----ERLLGPCMD 353          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Zebrafish
Match: PRKAR2B (si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113-22])

HSP 1 Score: 136.346 bits (342), Expect = 2.410e-36
Identity = 85/254 (33.46%), Postives = 141/254 (55.51%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKR----YENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFS-NKILFKEGDNNDTIYLIDEGEIQIIKK-------VNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +++++ M  K+V   E II ++D GDNFYVIERG +E   +     R    Y+N G FGELAL+YNTPR AT+IAT+ G LW LDR +F+R I+++   KRK  E  +   P+L +L   E + ++D +  + ++  + +  +GD  D  Y+++ G ++I  K          ++V       G YFGE  ++  +P + +A    SVK  ++  + F      LL  C +
Sbjct:  121 QRQRLQEACKDILLFKNLDQEQMSQVLDAMFEKVVVSGEHIIDQDDDGDNFYVIERGMFEILLKADGTTRTVGSYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIGTLPLLTSLEVSERMKVVDVLSTKVYNGGEQIIAQGDLADCFYIVESGHVRITMKRSKSKNDTEDEEVEIATCSRGQYFGELALVTNKPRAASAYAMDSVKCLVMDVQAF----ERLLGPCMD 370          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 150.214 bits (378), Expect = 3.305e-42
Identity = 87/254 (34.25%), Postives = 151/254 (59.45%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKV---NGQDVVKKV----LKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +++++ M    VK +E +I + D GDNFYV+ERG+Y+ + E     + + RY+N G FGELAL+YNTPR AT++AT++G LW LDR +F+R IL++   KRK  E  ++  P+L+ L   E + ++D +  + + +   +  +GD  D  ++++ GE++I+ K     GQ+  ++V     KSG YFGE  ++  +P + +A     VK  ++  + F      LL  C +
Sbjct:   26 QRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQSRCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAF----ERLLGPCMD 275          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 149.443 bits (376), Expect = 6.455e-41
Identity = 87/254 (34.25%), Postives = 151/254 (59.45%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKV---NGQDVVKKV----LKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +++++ M    VK +E +I + D GDNFYV+ERG+Y+ + E     + + RY+N G FGELAL+YNTPR AT++AT++G LW LDR +F+R IL++   KRK  E  ++  P+L+ L   E + ++D +  + + +   +  +GD  D  ++++ GE++I+ K     GQ+  ++V     KSG YFGE  ++  +P + +A     VK  ++  + F      LL  C +
Sbjct:  127 QRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQSRCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAF----ERLLGPCMD 376          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Xenopus
Match: fgf1 (fibroblast growth factor 1 [Source:Xenbase;Acc:XB-GENE-485966])

HSP 1 Score: 149.058 bits (375), Expect = 8.833e-41
Identity = 87/254 (34.25%), Postives = 151/254 (59.45%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKV---NGQDVVKKV----LKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +++++ M    VK +E +I + D GDNFYV+ERG+Y+ + E     + + RY+N G FGELAL+YNTPR AT++AT++G LW LDR +F+R IL++   KRK  E  ++  P+L+ L   E + ++D +  + + +   +  +GD  D  ++++ GE++I+ K     GQ+  ++V     KSG YFGE  ++  +P + +A     VK  ++  + F      LL  C +
Sbjct:  132 QRCRLQEACKDILLFKNLDQEQLSQVLDAMFEMRVKPQEHVIDQGDDGDNFYVVERGQYDIFVERDGQSRCVGRYDNHGSFGELALMYNTPRAATIVATSEGALWGLDRVTFRRIILKNNAKKRKTYEIFIESVPVLKFLELSERMKIVDVIAARVYKDGDRIIAQGDKADCFFIVESGEVKIMMKSKTKTGQESNQEVEIARCKSGQYFGELALVTNKPRAASAYAVGDVKCLIMDVQAF----ERLLGPCMD 381          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Xenopus
Match: ednrb2 (endothelin receptor B subtype 2 [Source:Xenbase;Acc:XB-GENE-1219159])

HSP 1 Score: 132.88 bits (333), Expect = 7.588e-35
Identity = 81/254 (31.89%), Postives = 146/254 (57.48%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKR----YENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQS-FSNKILFKEGDNNDTIYLIDEGEIQIIKKVNG-------QDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+++++ A K I LF+ L++ + +++++ M  K+VK  E +I + D GDNFYVI+RG Y+ + +   + R    Y+N G FGELAL+YNTPR AT++AT+ G +W LDR +F+R I+++   K++  E  ++  P L++L   E + ++D +  ++ +  + +  +GD  D+ Y+++ GE++I  K          + V       G YFGE  ++  +P + +A    +VK  ++  + F      LL  C E
Sbjct:  128 QRNRLQEACKDILLFKSLDQEQMSQVLDAMFEKLVKCGEHVIDQGDDGDNFYVIDRGTYDIFVKSDGVVRCVGAYDNRGSFGELALMYNTPRAATIVATSVGSIWGLDRATFRRIIVKNNAKKKRMYENFIESLPFLKSLEFSERLKVVDVIGTKTYYDGEQIIAQGDGADSFYIVESGEVRINMKSKSKPDAETNEAVEIARYTRGQYFGELALVTNKPRAASAYAVGNVKCLVMDVQAF----ERLLGPCME 377          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Xenopus
Match: ednrb2 (endothelin receptor B subtype 2 [Source:Xenbase;Acc:XB-GENE-1219159])

HSP 1 Score: 132.88 bits (333), Expect = 7.766e-35
Identity = 81/254 (31.89%), Postives = 146/254 (57.48%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKR----YENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQS-FSNKILFKEGDNNDTIYLIDEGEIQIIKKVNG-------QDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+++++ A K I LF+ L++ + +++++ M  K+VK  E +I + D GDNFYVI+RG Y+ + +   + R    Y+N G FGELAL+YNTPR AT++AT+ G +W LDR +F+R I+++   K++  E  ++  P L++L   E + ++D +  ++ +  + +  +GD  D+ Y+++ GE++I  K          + V       G YFGE  ++  +P + +A    +VK  ++  + F      LL  C E
Sbjct:  116 QRNRLQEACKDILLFKSLDQEQMSQVLDAMFEKLVKCGEHVIDQGDDGDNFYVIDRGTYDIFVKSDGVVRCVGAYDNRGSFGELALMYNTPRAATIVATSVGSIWGLDRATFRRIIVKNNAKKKRMYENFIESLPFLKSLEFSERLKVVDVIGTKTYYDGEQIIAQGDGADSFYIVESGEVRINMKSKSKPDAETNEAVEIARYTRGQYFGELALVTNKPRAASAYAVGNVKCLVMDVQAF----ERLLGPCME 365          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 139.428 bits (350), Expect = 2.947e-37
Identity = 84/254 (33.07%), Postives = 152/254 (59.84%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVK-----KVLKS--GTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+++++ A K I LF+ L+  + +++++ M  K+VK+ E +I + D GDNFYVI+RG ++ Y +    G+ +  Y+N G FGELAL+YNTPR AT+ AT+ G LW LDR +F+R I+++   KRK  E+ ++  P L++L   E + ++D +  + +++ + +  +GD  D+ ++++ GE++I  K  G+  V+     ++ +   G YFGE  ++  +P + +A    +VK   +  + F      LL  C E
Sbjct:  139 QRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAF----ERLLGPCME 388          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 139.428 bits (350), Expect = 2.947e-37
Identity = 84/254 (33.07%), Postives = 152/254 (59.84%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVK-----KVLKS--GTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+++++ A K I LF+ L+  + +++++ M  K+VK+ E +I + D GDNFYVI+RG ++ Y +    G+ +  Y+N G FGELAL+YNTPR AT+ AT+ G LW LDR +F+R I+++   KRK  E+ ++  P L++L   E + ++D +  + +++ + +  +GD  D+ ++++ GE++I  K  G+  V+     ++ +   G YFGE  ++  +P + +A    +VK   +  + F      LL  C E
Sbjct:  139 QRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAF----ERLLGPCME 388          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Mouse
Match: Prkar2a (protein kinase, cAMP dependent regulatory, type II alpha [Source:MGI Symbol;Acc:MGI:108025])

HSP 1 Score: 137.117 bits (344), Expect = 1.568e-36
Identity = 85/255 (33.33%), Postives = 147/255 (57.65%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY----KEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQII--------KKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +++++ M  KIVK  E +I + D GDNFYVIERG Y+       + + + +Y+N G FGELAL+YNTPR AT+IAT++G LW LDR +F+R I+++   KRK  E+ ++  P+ ++L   E + ++D +  + + + + +  +G+  D+ Y+I+ GE+ I+        K    Q+V       G YFGE  ++  +P + +A     VK  ++  + F      LL  C +
Sbjct:  124 QRCRLQEACKDILLFKNLDQEQLSQVLDAMFEKIVKTDEHVIDQGDDGDNFYVIERGTYDILVTKDNQTRSVGQYDNRGSFGELALMYNTPRAATIIATSEGSLWGLDRVTFRRIIVKNNAKKRKMFESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQGEKADSFYIIESGEVSILIRSKTKSNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAF----ERLLGPCMD 374          

HSP 2 Score: 50.447 bits (119), Expect = 1.854e-6
Identity = 49/141 (34.75%), Postives = 73/141 (51.77%), Query Frame = 3
Query:  264 KSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSG-------------YFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRS-----ETLVK 632
            +S ++S+ LF+ LE +E  +I++ +  KI KD E II + +  D+FY+IE G+       K  K  +N G             YFGELAL+ N PR A+  A  D +   +D  +F+R +L    D  KR+     E LVK
Sbjct:  251 ESFIESVPLFKSLEMSERMKIVDVIGEKIYKDGERIIAQGEKADSFYIIESGEVSILIRSK-TKSNKNGGNQEVEIAHCHKGQYFGELALVTNKPRAASAYAVGDVKCLVMDVQAFER-LLGPCMDIMKRNISHYEEQLVK 389          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Mouse
Match: Prkar2b (protein kinase, cAMP dependent regulatory, type II beta [Source:MGI Symbol;Acc:MGI:97760])

HSP 1 Score: 127.102 bits (318), Expect = 4.571e-34
Identity = 71/210 (33.81%), Postives = 122/210 (58.10%), Query Frame = 3
Query:  381 NDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVK-----KVLKS--GTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
             D GDNFYVI+RG ++ Y +    G+ +  Y+N G FGELAL+YNTPR AT+ AT+ G LW LDR +F+R I+++   KRK  E+ ++  P L++L   E + ++D +  + +++ + +  +GD  D+ ++++ GE++I  K  G+  V+     ++ +   G YFGE  ++  +P + +A    +VK   +  + F      LL  C E
Sbjct:   23 GDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDLADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCFRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAF----ERLLGPCME 228          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Mouse
Match: Prkar1b (protein kinase, cAMP dependent regulatory, type I beta [Source:MGI Symbol;Acc:MGI:97759])

HSP 1 Score: 120.168 bits (300), Expect = 1.682e-31
Identity = 82/251 (32.67%), Postives = 136/251 (54.18%), Query Frame = 3
Query:  261 IKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN--KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGT--YFGEETVLFKRPSSFTART-GP--SVKLGLLSDETFIINIYSLLSKCTENCESFI 992
            +  A+    LF  L++NE ++I + M        E +I++ + GDNFYVI++G+ + Y  G+++      G FGELAL+Y TPR ATV A TD +LW +DR+S++R ++     KRK  E  + K  IL++L + E + + D+++   F +  KI+  +G+  D  Y+I EG   ++++ +  +   +V + G   YFGE  +L  RP + T    GP   VKL     E  +     +L +  +   SFI
Sbjct:    4 LAKAISKNVLFSHLDDNERSDIFDAMFPVTHIGGETVIQQGNEGDNFYVIDQGEVDVYVNGEWVTNISEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVV-QGEPGDDFYIITEGTASVLQRRSPNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFI 253          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. UniProt/SwissProt
Match: sp|P81900|KAPR2_DROME (cAMP-dependent protein kinase type II regulatory subunit OS=Drosophila melanogaster OX=7227 GN=Pka-R2 PE=1 SV=2)

HSP 1 Score: 158.688 bits (400), Expect = 5.727e-44
Identity = 104/301 (34.55%), Postives = 163/301 (54.15%), Query Frame = 3
Query:   81 HATTSARNRASLGTVDMEQLANAIRSLPRHGVTAEKVDPRDATXXXXXXXX-XXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTA-RTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            H   S  ++ S+ + D +     + S  R  V AE  DP              K+  Q+ ++  ++K++ LF  LE+ + N++++ M  + V+  + II++ D GDNFYVIE G Y+ Y   K +  Y ++G FGELALLYN PR ATV A T G LW++DR +F+R +L+ AF KRK  E L+   P+L+ L  +E + L D++  +S+ N + + K+GD  D +Y I+EG + +    +  +V    L  G YFGE  ++  RP + +   TG  VKL  L  + F      LL  C +
Sbjct:   54 HTDQSTDDQLSVNSQDADAEPPVMASSRRKSVFAEAYDPEADDDDDGATAVFPKTDEQRARLVESVKNVLLFRSLEKEQMNQVLDAMFERKVQPGDFIIRQGDDGDNFYVIESGVYKVYINDKHINTYNHTGLFGELALLYNMPRAATVQAETSGLLWAMDRQTFRRILLKSAFRKRKMYEELLNSVPMLKALQNYERMNLADALVSKSYDNGERIIKQGDAADGMYFIEEGTVSVRMDQDDAEVEISQLGKGQYFGELALVTHRPRAASVYATGGVVKLAFLDVKAF----ERLLGPCMD 350          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. UniProt/SwissProt
Match: sp|Q26619|KAPR_STRPU (cAMP-dependent protein kinase type II regulatory subunit OS=Strongylocentrotus purpuratus OX=7668 PE=2 SV=1)

HSP 1 Score: 149.058 bits (375), Expect = 2.309e-40
Identity = 91/245 (37.14%), Postives = 141/245 (57.55%), Query Frame = 3
Query:  165 RHGVTAEKVDPR-DATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKK-----VLKSGTYFGEETVLFKRPSS 878
            R  V AEK DP  D      +    KS  Q+ ++  A+K+I LF  L+E +  E+I+ M  K     + +I + D GDNFYVI+RG+Y+ +     +  Y++SG FGELAL+YNTPR AT+ ATTDG LW+LDR SF+R +L++A  KR+  E L++K  I ++L  +E + L D++  +++ +   +  +GD  D  Y I+ G+ +I  K    D   +     +   G YFGE  +L  +P +
Sbjct:   79 RKSVCAEKYDPEADNDTDTQKLVYPKSDEQRARLTEAVKNILLFRALDEKQMQEVIDAMFEKKTTPGDHVIDQGDDGDNFYVIDRGEYDIFVNDNKVGAYKDSGSFGELALMYNTPRAATIAATTDGILWALDRVSFRRIVLKNAAKKRRIYEELLEKVSIFKSLEPYERMNLADALVTRTYEDGDCIIAQGDGADGCYFIEAGQCRIAMKSERSDNPDEEKEVAIYNQGQYFGELALLTNKPRA 323          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. UniProt/SwissProt
Match: sp|P31322|KAP3_BOVIN (cAMP-dependent protein kinase type II-beta regulatory subunit OS=Bos taurus OX=9913 GN=PRKAR2B PE=2 SV=2)

HSP 1 Score: 142.124 bits (357), Expect = 1.940e-37
Identity = 84/254 (33.07%), Postives = 151/254 (59.45%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKK-------VLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+++++ A K I LF+ L+  + +++++ M  K+VK+ E +I + D GDNFYVI+RG ++ Y +    G+ +  Y+N G FGELAL+YNTPR AT+ AT+ G LW LDR +F+R I+++   KRK  E+ ++  P L++L   E + ++D +  + +++ + +  +GD+ D+ ++++ GE++I  K  G+  V++           G YFGE  ++  +P + +A    +VK   +  + F      LL  C E
Sbjct:  141 QRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAF----ERLLGPCME 390          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. UniProt/SwissProt
Match: sp|P12369|KAP3_RAT (cAMP-dependent protein kinase type II-beta regulatory subunit OS=Rattus norvegicus OX=10116 GN=Prkar2b PE=1 SV=3)

HSP 1 Score: 141.739 bits (356), Expect = 2.374e-37
Identity = 85/255 (33.33%), Postives = 152/255 (59.61%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKV--------NGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+++++ A K I LF+ L+  + +++++ M  K+VK+ E +I + D GDNFYVI+RG ++ Y +    G+ +  Y+N G FGELAL+YNTPR AT+ AT+ G LW LDR +F+R I+++   KRK  E+ ++  P L++L   E + ++D +  + +++ + +  +GD+ D+ ++++ GE++I  K         NG   + + L+ G YFGE  ++  +P + +A    +VK   +  + F      LL  C E
Sbjct:  139 QRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVRITMKRKGKSDIEENGAVEIARCLR-GQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAF----ERLLGPCME 388          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. UniProt/SwissProt
Match: sp|P31323|KAP3_HUMAN (cAMP-dependent protein kinase type II-beta regulatory subunit OS=Homo sapiens OX=9606 GN=PRKAR2B PE=1 SV=3)

HSP 1 Score: 141.354 bits (355), Expect = 4.072e-37
Identity = 85/254 (33.46%), Postives = 151/254 (59.45%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKK-------VLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+++++ A K I LF+ L+  + +++++ M  K+VKD E +I + D GDNFYVI+RG ++ Y +    G+ +  Y+N G FGELAL+YNTPR AT+ AT+ G LW LDR +F+R I+++   KRK  E+ ++  P L++L   E + ++D +  + +++ + +  +GD+ D+ ++++ GE++I  K  G+  V++           G YFGE  ++  +P + +A    +VK   +  + F      LL  C E
Sbjct:  141 QRNRLQEACKDILLFKNLDPEQMSQVLDAMFEKLVKDGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRAATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEFSERLKVVDVIGTKVYNDGEQIIAQGDSADSFFIVESGEVKITMKRKGKSEVEENGAVEIARCSRGQYFGELALVTNKPRAASAHAIGTVKCLAMDVQAF----ERLLGPCME 390          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. TrEMBL
Match: V5IF79 (Putative camp-dependent protein kin (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 3.490e-46
Identity = 98/250 (39.20%), Postives = 160/250 (64.00%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY-----KEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNG--QDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q++++  A+++I LF+ L+  +  E+I+ M  + VK  E +IK+ D GDNFYVI+ G Y  +     ++ K + +YENSG FGELAL+YN PR AT+ A ++G LW+++R +F+R +L+ AF KRK  ETL+++ P+L++L  +E + L D++  +SF++ +++ K+GD  D +Y +++G ++I+ K NG  +  V +V K G YFGE  +L K+P + T     +VKL LL    F      LL  C E
Sbjct:   27 QRERLSQAVRNILLFKSLDGLQMKEVIDAMFERKVKAGETVIKQGDDGDNFYVIQNGTYNIFVSTDTEKNKLVGKYENSGSFGELALMYNMPRAATITAVSEGSLWAMNRQTFRRIVLKSAFKKRKEYETLLERVPMLKSLNHYERMNLADALTPRSFADGELIIKQGDEADGMYFLEDGMVRIVVKKNGGTEMEVSRVSKGG-YFGELALLTKKPRAATVYAVGAVKLALLDVSAF----ERLLGPCKE 271          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. TrEMBL
Match: A0A1L8DLJ7 (Hipothetical protein (Fragment) OS=Nyssomyia neivai OX=330878 PE=4 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 4.797e-46
Identity = 94/243 (38.68%), Postives = 151/243 (62.14%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFS-NKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ ++  ++K+I LF  L++ + N++++ M  KIV+  + II++ D GDNFYVIE GKY A+     +  Y+NSG FGELALLYN PR AT+ A TDGQLW++DR +F+R +L+ AF KRK  E+L+   P+L+ L  +E + L D++  +S+   + + K+GD  D +Y I++G + I  + +G ++   VL  G YFGE  ++  RP + +A    ++K+  L  + F      LL  C +
Sbjct:   84 QRSRLVESVKNILLFRSLDKEQMNQVLDAMFEKIVRPDDYIIRQGDDGDNFYVIESGKYRAFVGENLIHTYDNSGSFGELALLYNMPRAATIQAATDGQLWAMDRQTFRRILLKSAFRKRKMYESLLDNVPMLKALQNYERMNLADALVPKSYGKGERIIKQGDAADGMYFIEDGAVSIRIQQDGGEIEISVLGKGQYFGELALVTHRPRAASAYAADNIKVAFLDVDAF----ERLLGPCMD 322          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. TrEMBL
Match: A0A2R5LHM2 (Putative camp-dependent protein kinase type ii regulatory subunit OS=Ornithodoros turicata OX=34597 PE=4 SV=1)

HSP 1 Score: 171.014 bits (432), Expect = 5.154e-46
Identity = 106/278 (38.13%), Postives = 167/278 (60.07%), Query Frame = 3
Query:  165 RHGVTAEKVDP-RDATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY-----KEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQI-IKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            R  V AE  DP  D     ++    KS  Q++++  A++ I LF+ L+  +  E+I+ M  + VK  E++IK+ D GDNFYVI+ G Y  +     ++ K + +Y+N+G FGELAL+YN PR AT+ A T+G LW+++R +F+R +L+ AF KRK  E L++K P+L++L  +E + L D++  +SF+N +++ K+GD+ D +Y I++G ++I +KK  G +     L  G YFGE  +L  RP + TA    +VKL  L    F      LL  C E
Sbjct:   91 RKSVFAEHYDPAEDDEDEGAKVVHPKSDEQRERLSQAVRDILLFKSLDLPQMQEVIDAMFERKVKAGEMVIKQGDDGDNFYVIQSGVYNIFVSTDREQDKLVGKYDNTGSFGELALMYNMPRAATITAVTEGSLWAMNRQTFRRIVLKSAFKKRKEYENLLEKVPMLKSLNHYERMNLCDALMPRSFTNGQVIIKQGDDADGMYFIEDGTVRITVKKDGGHEAEVSRLTKGDYFGELALLTDRPRAATAYAVGTVKLACLDVSAF----ERLLGPCKE 364          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. TrEMBL
Match: V5I0X6 (Putative camp-dependent protein kinase r2 (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 168.703 bits (426), Expect = 5.643e-46
Identity = 107/279 (38.35%), Postives = 170/279 (60.93%), Query Frame = 3
Query:  165 RHGVTAEKVDP-RDATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY-----KEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNG--QDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            R  V AE  DP  D      +    KS  Q++++  A+++I LF+ L+  +  E+I+ M  + VK  E +IK+ D GDNFYVI+ G Y  +     ++ K + +YENSG FGELAL+YN PR AT+ A ++G LW+++R +F+R +L+ AF KRK  ETL+++ P+L++L  +E + L D++  +SF++ +++ K+GD  D +Y +++G ++I+ K NG  +  V +V K G YFGE  +L K+P + T     +VKL LL    F      LL  C E
Sbjct:   13 RKSVFAEHYDPAEDEDDEGPKVVHPKSDEQRERLSQAVRNILLFKSLDGLQMKEVIDAMFERKVKAGETVIKQGDDGDNFYVIQNGTYNIFVSTDTEKNKLVGKYENSGSFGELALMYNMPRAATITAVSEGSLWAMNRQTFRRIVLKSAFKKRKEYETLLERVPMLKSLNHYERMNLADALTPRSFADGELIIKQGDEADGMYFLEDGMVRIVVKKNGGTEMEVSRVSKGG-YFGELALLTKKPRAATVYAVGAVKLALLDVSAF----ERLLGPCKE 286          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. TrEMBL
Match: B7QBH4 (cAMP-dependent protein kinase type II regulatory subunit, putative OS=Ixodes scapularis OX=6945 GN=8038748 PE=4 SV=1)

HSP 1 Score: 168.318 bits (425), Expect = 8.583e-46
Identity = 98/250 (39.20%), Postives = 160/250 (64.00%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY-----KEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNG--QDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q++++  A+++I LF+ L+  +  E+I+ M  + VK  E +IK+ D GDNFYVI+ G Y  +     ++ K + +YENSG FGELAL+YN PR AT+ A ++G LW+++R +F+R +L+ AF KRK  ETL+++ P+L++L  +E + L D++  +SF++ +++ K+GD  D +Y +++G ++I+ K NG  +  V +V K G YFGE  +L K+P + T     +VKL LL    F      LL  C E
Sbjct:   43 QRERLSQAVRNILLFKSLDGLQMKEVIDAMFERKVKAGETVIKQGDDGDNFYVIQNGTYNIFVSTDTEKNKLVGKYENSGSFGELALMYNMPRAATITAVSEGSLWAMNRQTFRRIVLKSAFKKRKEYETLLERVPMLKSLNHYERMNLADALTPRSFADGELIIKQGDEADGMYFLEDGMVRIVVKKNGGTEMEVSRVSKGG-YFGELALLTKKPRAATVYAVGAVKLALLDVSAF----ERLLGPCKE 287          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Cavefish
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 139.428 bits (350), Expect = 9.954e-38
Identity = 86/254 (33.86%), Postives = 146/254 (57.48%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQII----KKVNGQD---VVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ L++ + +E+++ M   IV+ +E +I + D GDNFYVIERG Y+   +    G  + +Y+N G FGELAL+YNTPR AT+IA  +G LW LDR +F+R I+++   KR+  E  ++  P+L++L   E + ++D +  + F + + +  +GD  D  Y+++ GE++I+     K + QD   V       G YFGE  ++  +P + +A     +K  ++  + F      LL  C E
Sbjct:  109 QRCRLQEACKDILLFKALDQEQFSEVLDAMFEVIVQPQEHVIDQGDDGDNFYVIERGVYDIVVQKDGVGCCVGQYDNKGSFGELALMYNTPRAATIIAKQEGALWGLDRATFRRLIVKNNAKKRRMYECFIESVPLLKSLEISERMKIVDVLGVKIFHDGERIIMQGDMADCFYIVESGEVKIMMKSKTKADRQDNAEVEITRCTRGQYFGELALVTNKPRAGSAYAVGDIKCLVIDVQAF----ERLLGPCKE 358          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Cavefish
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:103029925])

HSP 1 Score: 138.272 bits (347), Expect = 4.523e-37
Identity = 94/287 (32.75%), Postives = 156/287 (54.36%), Query Frame = 3
Query:  153 RSLPRHGVTAEKVDP-RDATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKR----YENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFS-NKILFKEGDNNDTIYLIDEGEIQIIKKVN-------GQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            R + R  V AE  +P  D      R    K+  Q+ +++ A K I LF+ L++ + +++++ M  K V   E II ++D GDNFYVIERG ++   +     R    Y+N G FGELAL+YNTPR AT++AT+ G LW LDR +F+R I+++   KRK  E  ++  P+L +L   E + ++D +  + +S  + +  +GD  D+ Y+++ GE++I  K N        ++V       G YFGE  ++  +P + +A    +VK  ++  + F      LL  C +
Sbjct:   93 RFIRRASVCAEAFNPDEDDEDKEPRVTHPKTDEQRHRLQEACKDILLFKNLDQEQMSQVLDAMFDKAVTSGEHIIDQDDDGDNFYVIERGTFDILVKSDGTSRTVGSYDNRGSFGELALMYNTPRAATIVATSPGALWCLDRLTFRRIIVKNNAKKRKMYEAFIETLPLLTSLEVSERMKVVDVLSSKVYSKGEQIIAQGDLADSFYIVESGEVRITMKRNRLKTDSEEEEVDIATCTRGQYFGELALVTNKPRAASAYAVENVKCLVMDVQAF----ERLLGPCMD 375          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Cavefish
Match: prkar2ab (protein kinase, cAMP-dependent, regulatory, type II, alpha, B [Source:ZFIN;Acc:ZDB-GENE-040426-2427])

HSP 1 Score: 122.094 bits (305), Expect = 2.076e-31
Identity = 84/247 (34.01%), Postives = 137/247 (55.47%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY--KEG--KFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A K I LF+ LE+   +E+++ M   +VK +E II + D GDNFYVIERG Y+    K+G  + + +Y+N G FGELAL+YNTPR AT+IAT  G LW+LDR +F R I+++   KR+  E  ++  P+L++L   E + ++D +  +SF N +++ K+          D  E+++ +   GQ           YFGE  ++  +P + +       K  ++  + F      LL  C E
Sbjct:  116 QRSRLQEACKDILLFKTLEK--FSEVLDAMFEVLVKPQEHIIDQGDDGDNFYVIERGVYDIVVGKDGVSRCVGKYDNKGSFGELALMYNTPRAATIIATQSGALWALDRATFHRLIVRNNAKKRRMYEAFIECVPLLKSLELSERMKIVDVLGAKSFKNGELIIKQTKAGQR----DNAEVEVARCSRGQ-----------YFGELALVTNKPRAASVYAVGETKCLVIDVQAF----ERLLGPCKE 341          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Cavefish
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:111191378])

HSP 1 Score: 120.168 bits (300), Expect = 1.595e-30
Identity = 92/288 (31.94%), Postives = 149/288 (51.74%), Query Frame = 3
Query:  165 RHGVTAEKVDPRDATXXXXXXXXXXXPIQKD-----QIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN--KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGT--YFGEETVLFKRPSSFTART-GP--SVKLGLLSDETFIINIYSLLSKCTENCESFI 992
            R GV+AE     DA   + +       I KD      +  A+    LF  L++NE ++I + M        E +I++ D GDNFYVI++G+ + Y  G+++      G FGELAL+Y TPR ATV A TD +LW +DR+S++R ++     KRK  E  + K  IL++L + E + + D+++   F +  KI+  +G+  D  ++I EG   ++++ +  +   +V + G   YFGE  +L  RP + T    GP   VKL     E  +     +L +  +   SFI
Sbjct:   98 RGGVSAEVYTEEDAVSYVRKV------IPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNGEWVTGIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLEKWERLTVADALEPVQFEDGEKIVV-QGEPGDDFFIITEGTASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVARGPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFI 378          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Cavefish
Match: prkar1ab (cAMP-dependent protein kinase type I-alpha regulatory subunit [Source:NCBI gene;Acc:103038385])

HSP 1 Score: 114.775 bits (286), Expect = 1.424e-28
Identity = 82/252 (32.54%), Postives = 138/252 (54.76%), Query Frame = 3
Query:  261 IKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSF--SNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGT--YFGEETVLFKRPSSFT--ARTGP--SVKLGLLSDETFIINIYSLLSKCTENCESFI 992
            +  A++   LF  L++NE ++I + M        E++I++ D GDNFYVI++G+ + Y   ++       G FGELAL+Y TPR ATV A T+ +LW +DR+S++R ++     KRK  E  + K  IL++L + E + + D+++   F  S KI+  +G+  D  ++I EG   ++++ +  +   +V + G   YFGE  +L  RP + T  AR GP   VKL     E  +     +L +  +   SF+
Sbjct:  126 LAKAIEKNVLFSHLDDNERSDIFDAMFPVTYIAGEIVIQQGDEGDNFYVIDQGEMDVYVNNEWATSIGEGGSFGELALIYGTPRAATVRAKTNAKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDSQKIVV-QGEPGDEFFIILEGCAAVLQRRSENEEFVEVGRLGPSDYFGEIALLMNRPRAATVVAR-GPLKCVKLDRPRFERVLGPCSDILKRNIQQYNSFV 375          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Sea Lamprey
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:HGNC Symbol;Acc:HGNC:9392])

HSP 1 Score: 129.798 bits (325), Expect = 3.410e-35
Identity = 70/186 (37.63%), Postives = 119/186 (63.98%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKR----YENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKK 791
            Q+++++ A K I +F+ L++ + +++++ M  K V+  E +I +   GDNFYVIERG Y+ Y     + R    Y N G FGELAL+YNT R AT+IAT++G LW LDR +F+R I+++A  KRK  E  ++  P+L++L   E + ++D +  +SF + + +  +G+  D  YL++ GE++I  +
Sbjct:  138 QRNRLQEACKHILIFKNLDQEQMSQVLDAMFEKTVETGEHVIDQGADGDNFYVIERGMYDIYVTTNDVSRCVGAYNNRGSFGELALMYNTSRAATIIATSEGALWGLDRLTFRRIIVKNAAKKRKMYECFIETVPLLKSLDFSERLKVVDVIASKSFQDSERIIAQGEKADCFYLVESGEVRIAMR 323          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Sea Lamprey
Match: prkar2aa (protein kinase, cAMP-dependent, regulatory, type II, alpha A [Source:ZFIN;Acc:ZDB-GENE-030131-1007])

HSP 1 Score: 116.701 bits (291), Expect = 3.345e-31
Identity = 59/182 (32.42%), Postives = 105/182 (57.69%), Query Frame = 3
Query:  459 YENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKV---------LKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Y+N G FGELAL+YNTPR AT++ATT+G LW++DR +F+R IL++A  KRK  E  ++  P+L++L   E + ++D++  +S+ + + +  +G   D  ++++ GE++I+ K   Q   +              G YFGE +++  +P + +A    +VK  ++  + F      LL  C +
Sbjct:   20 YDNRGSFGELALMYNTPRAATIVATTEGSLWAMDRATFRRIILKNAAQKRKMYEAFIESVPLLKSLDASERMKVVDTITTKSYEDGEQIIAQGAKADCFFIVEAGEVRIMMKSKTQPPAETTKEGEVEIARCTRGQYFGELSLVTNKPRAASAYAVGNVKCAVMGVQPF----ERLLGPCMD 197          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001198.1 (pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 gene:ENSPMAG00000001068.1 transcript:ENSPMAT00000001198.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.9518 bits (193), Expect = 8.917e-17
Identity = 57/212 (26.89%), Postives = 112/212 (52.83%), Query Frame = 3
Query:  261 IKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVL--FKRPSSFTA 887
            ++ A++S  L + ++  +T  + + M+       E II E D      V   G  +  K+G+ L   +    FGELA+LY+  R ATV A TD +L  L R++F+  +++ +  +RK     +K    L+NL + +   + D ++  +F++ + +  EG+     Y+I  G++++ ++V G   + +VL+ G +FGE  ++   +R ++ TA
Sbjct:    3 VEQAVRSNELLKRMQPGQTVLLGDCMSETTRARGETIIAEGDSSRRLKVDVEGLLDVSKQGESLCTLQPGALFGELAILYDCTRTATVKALTDVRLLYLSRHAFRSVLMRESQLRRKLIIKFLKTAKTLKNLPDEQLSKMFDCMEESAFADGEAIVNEGEVGHIFYVILRGQVRVSQEVEGSPRLIRVLEPGDHFGELALIRNMRRTATCTA 214          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005026.1 (pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 gene:ENSPMAG00000004571.1 transcript:ENSPMAT00000005026.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 64.6994 bits (156), Expect = 1.399e-13
Identity = 32/74 (43.24%), Postives = 43/74 (58.11%), Query Frame = 3
Query:  426 EAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPIL 647
            E Y   + +      G FGELAL+Y TPR ATV A TD +LW +DR+S++R ++     KRK  E  + K  IL
Sbjct:   22 EVYVNVELVTSIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSIL 95          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001825.1 (pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gene:ENSPMAG00000001656.1 transcript:ENSPMAT00000001825.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 63.5438 bits (153), Expect = 1.022e-11
Identity = 45/146 (30.82%), Postives = 70/146 (47.95%), Query Frame = 3
Query:  153 RSLPRHGVTAEKVD----PRDATXXXXX-XXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQ 575
            R L + GV+AE       PR      +   +  K+P  +  IK+AL        LE+     ++E M  +    ++ +I+E + G++ YV+     +  + G  L        FGELA+LYN  R ATV A T  ++W LDR +FQ
Sbjct:  130 RPLAKAGVSAEPASSSSLPRQQVGGTACWARVHKNPCSQRLIKAALAKNEFLRRLEDGRVARMVECMYERAYSPEQAVIREGEAGNHLYVLAAASLDCQQRGTCLGHMHPGTVFGELAILYNCKRTATVKAVTAVRVWVLDRLTFQ 275          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Yeast
Match: BCY1 (Regulatory subunit of the cyclic AMP-dependent protein kinase (PKA); PKA is a component of a signaling pathway that controls a variety of cellular processes, including metabolism, cell cycle, stress response, stationary phase, and sporulation [Source:SGD;Acc:S000001295])

HSP 1 Score: 119.398 bits (298), Expect = 6.551e-31
Identity = 89/278 (32.01%), Postives = 140/278 (50.36%), Query Frame = 3
Query:  105 RASLGTVDMEQLANAIRSLPRHGVTAEKVDPRDATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSF-SNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETF 935
            R    T  +    NA R   R  V+ E + P +           KS  Q  +++ ++++ FLF  L+ +    +I  +  K V     IIK+ D GD FYV+E+G  + Y     +        FGELAL+YN+PR ATV+AT+D  LW+LDR +F++ +L  +F KR   + L+K  P+L++L  ++   L D++  + +   + + +EGD  +  YLI+ G + + KK  GQ V+ K LK   YFGE  +L   P   T       K+  L    F
Sbjct:  126 REKTSTPPLPMHFNAQR---RTSVSGETLQPNNFDDWTPDHYKEKSEQQLQRLEKSIRNNFLFNKLDSDSKRLVINCLEEKSVPKGATIIKQGDQGDYFYVVEKGTVDFYVNDNKVNSSGPGSSFGELALMYNSPRAATVVATSDCLLWALDRLTFRKILLGSSFKKRLMYDDLLKSMPVLKSLTTYDRAKLADALDTKIYQPGETIIREGDQGENFYLIEYGAVDVSKK--GQGVINK-LKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGF 397          

HSP 2 Score: 56.9954 bits (136), Expect = 1.637e-9
Identity = 31/74 (41.89%), Postives = 48/74 (64.86%), Query Frame = 3
Query:  384 DPGDNFYVIERGKYEAYKEGK-FLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFD 602
            D G+NFY+IE G  +  K+G+  + + ++  YFGE+ALL + PR ATV AT   ++ +L ++ FQR +L  A D
Sbjct:  334 DQGENFYLIEYGAVDVSKKGQGVINKLKDHDYFGEVALLNDLPRQATVTATKRTKVATLGKSGFQR-LLGPAVD 406          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Nematostella
Match: EDO38262 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDH8])

HSP 1 Score: 142.895 bits (359), Expect = 2.183e-39
Identity = 79/209 (37.80%), Postives = 130/209 (62.20%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY----KEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKV----LKSGTYFGE 848
            Q+ ++  A+K+I LF+ L + + NE+++ M  +  +  + II + D GDNFYVI+RG+Y+ Y     + K +  Y+N G FGELAL+YNTPR AT+++T++G +W LDR +F+R +L+ A  KRK  E L++  P+LQ + E+E + L D++  + F + + + K+GD  D +Y ++ G +  I+  N  D   +V       G YFGE
Sbjct:  119 QRQRLNDAIKNILLFKNLAKEQLNEVLDAMFERKTQAGDHIIDQGDDGDNFYVIDRGQYDIYVRIDGQEKMVGSYDNKGSFGELALMYNTPRAATIVSTSEGVIWGLDRMTFRRILLKAAAKKRKVHEALLETVPLLQEITEYERMNLADALVSRQFKDGECIIKQGDEADFMYFVESGTVS-IRMHNKSDPTTEVEIAQCTKGGYFGE 326          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Nematostella
Match: EDO49534 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGJ3])

HSP 1 Score: 119.013 bits (297), Expect = 1.882e-30
Identity = 82/256 (32.03%), Postives = 146/256 (57.03%), Query Frame = 3
Query:  159 LPRHGVTAEKVDPRDATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEG----KFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQI-IKKVNGQDVVKKVLKSGT--YFGEETVL--FKRPSSFTARTG 896
            L R  V  E  +P ++    +++   KS   + ++++ + +IF+F+   +++ N +++ M  ++V  +E II++ D GDNFY+I+ G++E   E     + L R +  G FGELAL+YN PR+AT+ A T G LW LDR SF+R ++     KR+  ETL+++ P+L  L  +E   L D++    + + + + ++ D  D +Y I+ G ++I I+    +  VK +  +G   YFGE  ++   KR +S  A+ G
Sbjct:   87 LRRDSVAGEVYEPVNSNCVSAQRFYPKSEDARKRLENVIGNIFIFKSCGKDQINMMLDAMYERVVYQEETIIRQGDAGDNFYIIDEGEFEVLFETNGAQEKLGRLKGPGSFGELALMYNCPRSATIRACTPGVLWVLDRKSFRRILVDTTERKRRHYETLLERIPVLSQLTAYERTSLADALTTSVYRDEECIIRQDDPADCLYFIESGIVEISIRDSKDRSKVKVISTAGPGEYFGELALVNKTKRGASVHAKGG 342          

HSP 2 Score: 50.447 bits (119), Expect = 4.750e-7
Identity = 31/113 (27.43%), Postives = 58/113 (51.33%), Query Frame = 3
Query:  600 DKRKRSETLVKKNPILQNLLEHESIMLIDSV-KFQSFSNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETF 935
            D RKR E ++    I ++  + +  M++D++ +   +  + + ++GD  D  Y+IDEGE +++ + NG       LK    FGE  +++  P S T R      L +L  ++F
Sbjct:  116 DARKRLENVIGNIFIFKSCGKDQINMMLDAMYERVVYQEETIIRQGDAGDNFYIIDEGEFEVLFETNGAQEKLGRLKGPGSFGELALMYNCPRSATIRACTPGVLWVLDRKSF 228          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Nematostella
Match: EDO48439 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJW7])

HSP 1 Score: 108.227 bits (269), Expect = 1.171e-26
Identity = 69/231 (29.87%), Postives = 129/231 (55.84%), Query Frame = 3
Query:  261 IKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEG-KFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSV---KFQSFSNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGT--YFGEETVLFKRPSSFTARTGPSVKLGLLSDETF 935
            +  A+    LF  L+ENE ++I + M+       E+IIK+ D GDNFY+++ G+ + +      +      G FGELAL+Y TPR AT+ A TD +LW++DR +++R ++     KR+  E  ++K  IL++L + E + + D++   +FQ   + ++  +G++ D  ++I EG   ++++ +  +   +V + G   YFGE  ++  RP + T +   ++K   L  + F
Sbjct:  121 LSKAITKNILFSHLDENERSDIFDAMSLVKHGAGEIIIKQGDEGDNFYIVDSGEVDVFVNNVGLVSTIGEGGSFGELALIYGTPRAATIKAKTDVKLWAIDRVTYRRILMGSQIRKRRMYEQFLEKVSILESLDKWERLTVADALEPTQFQDGDDVVV--QGEHGDEFFIIVEGTAVVLQRRSANEDFIEVSRLGPSDYFGEIALVLNRPRAATVQARGTLKCVKLDRQRF 349          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Nematostella
Match: EDO41163 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S513])

HSP 1 Score: 97.8265 bits (242), Expect = 6.054e-23
Identity = 65/205 (31.71%), Postives = 112/205 (54.63%), Query Frame = 3
Query:  384 DPGDNFYVIERGKYEAY----KEGKFLK--RYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNND-TIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            D GDNFYVI  G+Y+ +      G  +K   +  +G FGELAL++N+ RNAT++A T+G LW+LDR++F + ++  A  +R+R+  L+K   IL+ L   E   + D++  + F + + + +EG+ +   +Y I++G++++   V   +V K V     YFGE  ++  +P S +       K   L  + F      L+  C E
Sbjct:  155 DEGDNFYVINTGEYDVFALDTNTGASIKVHTFNGTGMFGELALMHNSLRNATIVAKTEGTLWALDRSTFVQVVVGGAQRRRERNIELLKSVSILKELKPDELDKVSDALYPKEFKDGEAVIREGNESAYCMYFIEKGKVRVT--VKDGEVEKTVEFDKNYFGELALVMNQPRSASVYAVGECKFASLKKDDF----ERLMGPCKE 353          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Nematostella
Match: EDO38407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ7])

HSP 1 Score: 98.5969 bits (244), Expect = 1.238e-22
Identity = 74/243 (30.45%), Postives = 125/243 (51.44%), Query Frame = 3
Query:  165 RHGVTAEKVDPRDATXXXXXXXXXXXPIQ--------KDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSF--SNKILFKEGDNNDTIYLIDEGEIQIIKKVN--GQDVVKKVLKSGTYFGEETV 857
            R G++AE   P+ A +     K    P+Q        K+ IK A+      + LE ++  E++E M  ++ K  E IIKE +PG + YV+E GK +  KEG  L        FGELA+LYN  R A+V A T G+LW++DR +FQ  +++    +       ++   +L++L E   + + D ++ ++F    + + ++G   DT ++I  G + I ++ N     V  + L  G YFGE+ +
Sbjct:   46 RQGISAE---PQSAKQVADSSK----PLQRHPKNSRSKELIKEAILDNDFLKNLEASQVREVVECMCERMFKRDEYIIKEKEPGSHLYVLEEGKCQVTKEGTVLGHMGPGKAFGELAILYNCTRTASVRAQTSGKLWAIDRQTFQTIMMKTGLMRTAEHMEFLRSVNLLKDLAESYLLKIADVIE-ETFYEEGEYIIRQGARGDTFFIIKSGNVDITQRTNVHSDPVHVRNLSKGAYFGEKAL 280          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Medaka
Match: prkar2aa (cAMP-dependent protein kinase type II-alpha regulatory subunit [Source:NCBI gene;Acc:101159349])

HSP 1 Score: 144.05 bits (362), Expect = 2.350e-39
Identity = 82/250 (32.80%), Postives = 143/250 (57.20%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSF-SNKILFKEGDNNDTIYLIDEGEIQIIKK-------VNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A + I LF+ L++ + +++++ M    V+ +E +I +   GDNFYVIERG Y+    GK + +Y N G FGELAL+YNTPR AT+IAT +G LW LDR +F+R I+++   KR+  ET ++  P+L+ L  +E + ++D +  + F   + +  +G+  +  Y+++ GE++I+ K        +  +V       G YFGE  ++  +P + +A     VK  ++  + F      LL  C E
Sbjct:  121 QRCRLQEACRDILLFKTLDQEQFSQVLDAMFELKVQPQEHVIDQGHDGDNFYVIERGIYDIVVSGKCVGQYNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKRRMYETFIESVPLLKTLEPNERMKIVDVLGMKQFLDGERIIAQGEKAECFYIVESGEVKIMMKSKTKADHADNAEVEITRCSRGQYFGELALVTNKPRAASAYAVGDVKCLVIDVQAF----ERLLGSCKE 366          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Medaka
Match: prkar2aa (cAMP-dependent protein kinase type II-alpha regulatory subunit [Source:NCBI gene;Acc:101159349])

HSP 1 Score: 131.339 bits (329), Expect = 1.117e-34
Identity = 80/244 (32.79%), Postives = 136/244 (55.74%), Query Frame = 3
Query:  249 QKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSF--SNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            Q+ +++ A + I LF+ L++ + +++++ M    V+ +E +I +   GDNFYVIERG Y+    GK + +Y N G FGELAL+YNTPR AT+IAT +G LW LDR +F+R I+++   KR+  ET ++  P+L+ L  +E + ++D +  + F    +I+ +   ++      D  E++I +   GQ           YFGE  ++  +P + +A     VK  ++  + F      LL  C E
Sbjct:  121 QRCRLQEACRDILLFKTLDQEQFSQVLDAMFELKVQPQEHVIDQGHDGDNFYVIERGIYDIVVSGKCVGQYNNKGSFGELALMYNTPRAATIIATQEGALWGLDRATFRRLIVKNNAKKRRMYETFIESVPLLKTLEPNERMKIVDVLGMKQFLDGERIIAQTKADH-----ADNAEVEITRCSRGQ-----------YFGELALVTNKPRAASAYAVGDVKCLVIDVQAF----ERLLGSCKE 344          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Medaka
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:101166375])

HSP 1 Score: 131.724 bits (330), Expect = 1.318e-34
Identity = 90/288 (31.25%), Postives = 155/288 (53.82%), Query Frame = 3
Query:  153 RSLPRHGVTAEKVDP-RDATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVN--------GQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            R + R  V AE  +P  D      R    K+  Q+ +++ A + I LF+ L+  E +++++ M  K   + E II ++D GDNFYVIE G +  + +     K +  Y+N G FGELAL+YNTPR AT+IAT+ G LW LDR +F+R I+++   KR+  E  ++  P+L +L   E + ++D +  + +++ + +  +GD  D  Y+++ G+++I  K +         ++V       G YFGE  ++  +P + +A    SVK  ++  + F      LL  C +
Sbjct:   98 RFIRRASVCAEAFNPDEDEEDKEPRVTYPKTDEQRQRLQEACRDILLFKNLDPEEISQVLDAMFEKFCTEGEHIIDQDDDGDNFYVIESGTFNIFVKVDGIEKLVGCYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRRLYEAFIETLPLLTSLETSERMKVVDVLSTRVYNDSQQIIAQGDLADCFYIVESGQVRITMKRSRMTKKDQEEEEVEIATCTRGQYFGELALVTNKPRAASAYAVGSVKCLVMDVQAF----ERLLGPCMD 381          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Medaka
Match: prkar1b (protein kinase cAMP-dependent type I regulatory subunit beta [Source:NCBI gene;Acc:101155602])

HSP 1 Score: 118.627 bits (296), Expect = 5.028e-30
Identity = 94/289 (32.53%), Postives = 150/289 (51.90%), Query Frame = 3
Query:  165 RHGVTAEKVDPRDATXXXXXXXXXXXPIQKD-----QIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN--KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGT--YFGEETVLFKRPSSFT--ARTGP--SVKLGLLSDETFIINIYSLLSKCTENCESFI 992
            R GV+AE     DA   + +       I KD      +  A+    LF  L++NE ++I + M        E +I++ D GDNFYVI++G+ + Y  G+ +      G FGELAL+Y TPR ATV A TD +LW +DR+S++R ++     KRK  E  + K  IL++L + E + + D+++   F +  KI+  +G+  D  ++I EG   ++++ +  +   +V + G   YFGE  +L  RP + T  AR GP   VKL     E  +     +L +  +   SFI
Sbjct:   96 RGGVSAEVYTEEDAVSYVRKV------IPKDYKTMTALAKAISKNVLFAHLDDNERSDIFDAMFPVTHIAGETVIQQGDEGDNFYVIDQGEVDVYVNGELVTNIGEGGSFGELALIYGTPRAATVKAKTDLKLWGIDRDSYRRILMGSTLRKRKMYEEFLSKVSILESLDKWERLTVADALEPVQFEDGEKIVV-QGEPGDDFFIITEGIASVLQRRSDNEEYVEVGRLGPSDYFGEIALLLNRPRAATVVAR-GPLKCVKLDRPRFERVLGPCSEILKRNIQRYNSFI 376          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Medaka
Match: si:ch211-272n13.7 (protein kinase cAMP-dependent type II regulatory subunit beta [Source:NCBI gene;Acc:101166375])

HSP 1 Score: 119.013 bits (297), Expect = 6.336e-30
Identity = 69/211 (32.70%), Postives = 117/211 (55.45%), Query Frame = 3
Query:  381 NDPGDNFYVIERGKYEAYKE----GKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVN--------GQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTE 974
            +D GDNFYVIE G +  + +     K +  Y+N G FGELAL+YNTPR AT+IAT+ G LW LDR +F+R I+++   KR+  E  ++  P+L +L   E + ++D +  + +++ + +  +GD  D  Y+++ G+++I  K +         ++V       G YFGE  ++  +P + +A    SVK  ++  + F      LL  C +
Sbjct:  168 DDDGDNFYVIESGTFNIFVKVDGIEKLVGCYDNRGSFGELALMYNTPRAATIIATSPGALWCLDRLTFRRIIVKNNAKKRRLYEAFIETLPLLTSLETSERMKVVDVLSTRVYNDSQQIIAQGDLADCFYIVESGQVRITMKRSRMTKKDQEEEEVEIATCTRGQYFGELALVTNKPRAASAYAVGSVKCLVMDVQAF----ERLLGPCMD 374          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Planmine SMEST
Match: SMESG000013519.1 (SMESG000013519.1)

HSP 1 Score: 520.005 bits (1338), Expect = 0.000e+0
Identity = 290/290 (100.00%), Postives = 290/290 (100.00%), Query Frame = 3
Query:  129 MEQLANAIRSLPRHGVTAEKVDPRDATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTENCESFIKS 998
            MEQLANAIRSLPRHGVTAEKVDPRDATKSISRKKSIKSPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFKIVKDKEVIIKENDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTENCESFIKS
Sbjct:    1 MEQLANAIRSLPRHGVTAEKVDPRDATKSISRKKSIKSPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFKIVKDKEVIIKENDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTENCESFIKS 290          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Planmine SMEST
Match: SMESG000051354.1 (SMESG000051354.1)

HSP 1 Score: 170.629 bits (431), Expect = 2.070e-49
Identity = 105/278 (37.77%), Postives = 164/278 (58.99%), Query Frame = 3
Query:  156 SLPRHGVTAEKVDPR---DATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFL-KRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKCTEN 977
            ++PR  +T E  DP    D T   +RK   K+P Q D+I   L++IF F  L+E + ++II+ M F  V   + IIKENDPG+NFYVI+ G + A  + K + + Y+  G+FGELALLYN PR+A+VIA TDG LW +DR +F++ IL+ A+ KR+R    +   P+L++L ++E   L D++K ++ +N+ +  +GD  D +Y I+EGE+ +  +   ++  +  LK+G YFGE  +L   P           KL  L  +++      LL  C +N
Sbjct:   87 NVPRQSITCESFDPSSIDDETFEKNRKIYPKTPKQMDKITDILETIFFFNCLDEIQFSKIIQSMFFIEVFKGDEIIKENDPGNNFYVIDYGTFTASNKSKSIYEVYKGEGFFGELALLYNCPRSASVIADTDGGLWVIDRVTFRQLILKSAYQKRQRYLKFISSVPLLEDLTKYEQCNLADALKTKTINNEKVISQGDAGDKMYFIEEGEVLVTVRTGEEEREESRLKAGDYFGEVALLANIPRIANVYALGYTKLAELDAKSYT----RLLGPCIDN 360          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Planmine SMEST
Match: SMESG000017499.1 (SMESG000017499.1)

HSP 1 Score: 144.05 bits (362), Expect = 1.546e-39
Identity = 79/239 (33.05%), Postives = 141/239 (59.00%), Query Frame = 3
Query:  165 RHGVTAEKVDPRDATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSN-KILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKV--LKSGTYFGEETVLFKRP 872
            R  V AE  DP             K+  Q+ ++  A+K IFLF  L++ +  ++I+ M   +V+  + +I + D GD+FYVIE+G ++ +  G  +  Y ++G FGELAL+YNTPR AT+I+ T+G LW++DR +F+  +L++AF KR+  E L++   +L  L  ++   + D++  +++ + +++ ++G     ++ I+ GE+++I+  N     K+V  L  G YFGE  +L K P
Sbjct:   76 RQSVAAESFDPEKEDDEDLPVIYSKTDAQRSRLVEAIKPIFLFRSLDDEQRGKVIDSMREVVVESDQKVIVQGDGGDDFYVIEKGMFDIFVNGSKIGNYSDTGSFGELALMYNTPRAATIISVTNGILWAMDRKTFRHIVLKNAFKKRQMYEGLLQSVDLLDELSSYDRTNVADALVSRTYEDSEMILEQGKPGMEMFFIENGEVRVIRDTNDGSPPKEVNRLHKGDYFGEVALLIKEP 314          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Planmine SMEST
Match: SMESG000059969.1 (SMESG000059969.1)

HSP 1 Score: 140.969 bits (354), Expect = 1.736e-38
Identity = 97/286 (33.92%), Postives = 158/286 (55.24%), Query Frame = 3
Query:  129 MEQLANAIRSLPRHGVTAEKVDPRDATXXXXXXXXXXXPIQKDQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAYKEG----KFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSF-SNKILFKEGDNNDTIYLIDEGEIQI-IKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETFIINIYSLLSKC 968
            ++++  ++R+  R  + AEK DP ++          KSP QK+++   LK   LF   + ++   I++ M  + V+  + II E D GDNFYVI+ G ++         K +  Y N+G FGELAL++N  R+ATV A T G LW L+   F+  +++  F KRK  E+++K  PIL +L E+E + L D++  Q F  N+ + KEGD  + +Y I+ G +++ IKK + +  V ++  +G YFGE  ++ K+P S +      VKL  L  ++F      LL  C
Sbjct:   73 IQKIDGSLRAQRRRSIAAEKYDP-ESDVEEQLIIYPKSPEQKERLIQGLKHTILFHDFDSDQLQVIVDCMFSRTVEAGQKIINEGDVGDNFYVIDNGIFDVQTNKANIQKLVHTYNNNGCFGELALMHNQSRSATVTARTSGCLWVLEGRHFKELVMKITFKKRKMYESIIKSVPILNDLDENERMDLSDALVTQKFEDNECIIKEGDEAEGMYFIESGLVRVTIKKGDYEAEVSRI-SAGKYFGEMALVEKKPRSASVYAVGLVKLAFLKVDSF----ERLLGPC 352          

HSP 2 Score: 47.7506 bits (112), Expect = 7.848e-6
Identity = 42/122 (34.43%), Postives = 66/122 (54.10%), Query Frame = 3
Query:  264 KSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEA-YKEGKF---LKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRS 617
            +S +KS+ +   L+ENE  ++ + +  +  +D E IIKE D  +  Y IE G      K+G +   + R     YFGE+AL+   PR+A+V A    +L  L  +SF+R +L   FD  KR+
Sbjct:  239 ESIIKSVPILNDLDENERMDLSDALVTQKFEDNECIIKEGDEAEGMYFIESGLVRVTIKKGDYEAEVSRISAGKYFGEMALVEKKPRSASVYAVGLVKLAFLKVDSFER-LLGPCFDVMKRA 359          
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Planmine SMEST
Match: SMESG000042097.1 (SMESG000042097.1)

HSP 1 Score: 137.117 bits (344), Expect = 5.225e-37
Identity = 86/232 (37.07%), Postives = 134/232 (57.76%), Query Frame = 3
Query:  255 DQIKSALKSIFLFEGLEENETNEIIEFMTFXXXXXXXXXXXXNDPGDNFYVIERGKYEAY----KEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQRHILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSF-SNKILFKEGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSSFTARTGPSVKLGLLSDETF 935
            +QIK A KS+FLF  L ++E N +I  M  K     E++I++++ GD FY+I+ G YEA+    KE   +K Y   GYFGE+AL+YN  R ATVI+ T+G LW+LDR  F+  +L  AF+KR     +++K  I +NL  +E   + DS+  + F ++  +  +GDN   +Y+I+ GE+ + K  N  + V   L +  YFGE + +       +A     V+L ++S E F
Sbjct:  112 EQIKDATKSVFLFNILNDDELNSVIRSMVRKDTISGEIVIEKDEEGDFFYIIDNGIYEAFIMNNKEPVRVKSYHGEGYFGEIALMYNCQRTATVISRTNGTLWALDRKKFKEIVLMKAFEKRANFYKILRKIDIFKNLNNYELNHIADSLYKKEFNASDCIIVQGDNALEMYIIESGEVLVTKTENNVEKVLFHLHANDYFGEVSFITNNCLQVSAYAITDVELMVISKEAF 343          
The following BLAST results are available for this feature:
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PRKAR2B8.479e-3833.46protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2B8.479e-3833.46protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2A7.167e-3732.94protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2A7.167e-3732.94protein kinase cAMP-dependent type II regulatory s... [more]
PRKAR2A2.981e-3132.52protein kinase cAMP-dependent type II regulatory s... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
kin-29.020e-2932.54cAMP-dependent protein kinase regulatory subunit ... [more]
kin-21.267e-2832.54cAMP-dependent protein kinase regulatory subunit ... [more]
kin-21.427e-2832.54cAMP-dependent protein kinase regulatory subunit ... [more]
egl-46.472e-2227.04cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
egl-46.472e-2227.04cGMP-dependent protein kinase egl-4 [Source:UniPr... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pka-R24.829e-4634.20gene:FBgn0022382 transcript:FBtr0112902[more]
Pka-R21.240e-4535.42gene:FBgn0022382 transcript:FBtr0112901[more]
Pka-R25.714e-4534.55gene:FBgn0022382 transcript:FBtr0088437[more]
Pka-R25.714e-4534.55gene:FBgn0022382 transcript:FBtr0088438[more]
Pka-R11.670e-3234.51gene:FBgn0259243 transcript:FBtr0300533[more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar2ab2.468e-3937.39protein kinase, cAMP-dependent, regulatory, type I... [more]
PRKAR2B2.279e-3834.41si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
prkar2aa4.156e-3833.46protein kinase, cAMP-dependent, regulatory, type I... [more]
PRKAR2B1.734e-3734.41si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
PRKAR2B2.410e-3633.46si:ch211-272n13.7 [Source:ZFIN;Acc:ZDB-GENE-160113... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
fgf13.305e-4234.25fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
fgf16.455e-4134.25fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
fgf18.833e-4134.25fibroblast growth factor 1 [Source:Xenbase;Acc:XB-... [more]
ednrb27.588e-3531.89endothelin receptor B subtype 2 [Source:Xenbase;Ac... [more]
ednrb27.766e-3531.89endothelin receptor B subtype 2 [Source:Xenbase;Ac... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Prkar2b2.947e-3733.07protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2b2.947e-3733.07protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2a1.568e-3633.33protein kinase, cAMP dependent regulatory, type II... [more]
Prkar2b4.571e-3433.81protein kinase, cAMP dependent regulatory, type II... [more]
Prkar1b1.682e-3132.67protein kinase, cAMP dependent regulatory, type I ... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P81900|KAPR2_DROME5.727e-4434.55cAMP-dependent protein kinase type II regulatory s... [more]
sp|Q26619|KAPR_STRPU2.309e-4037.14cAMP-dependent protein kinase type II regulatory s... [more]
sp|P31322|KAP3_BOVIN1.940e-3733.07cAMP-dependent protein kinase type II-beta regulat... [more]
sp|P12369|KAP3_RAT2.374e-3733.33cAMP-dependent protein kinase type II-beta regulat... [more]
sp|P31323|KAP3_HUMAN4.072e-3733.46cAMP-dependent protein kinase type II-beta regulat... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V5IF793.490e-4639.20Putative camp-dependent protein kin (Fragment) OS=... [more]
A0A1L8DLJ74.797e-4638.68Hipothetical protein (Fragment) OS=Nyssomyia neiva... [more]
A0A2R5LHM25.154e-4638.13Putative camp-dependent protein kinase type ii reg... [more]
V5I0X65.643e-4638.35Putative camp-dependent protein kinase r2 (Fragmen... [more]
B7QBH48.583e-4639.20cAMP-dependent protein kinase type II regulatory s... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar2aa9.954e-3833.86protein kinase, cAMP-dependent, regulatory, type I... [more]
si:ch211-272n13.74.523e-3732.75protein kinase cAMP-dependent type II regulatory s... [more]
prkar2ab2.076e-3134.01protein kinase, cAMP-dependent, regulatory, type I... [more]
prkar1b1.595e-3031.94protein kinase cAMP-dependent type I regulatory su... [more]
prkar1ab1.424e-2832.54cAMP-dependent protein kinase type I-alpha regulat... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
si:ch211-272n13.73.410e-3537.63protein kinase cAMP-dependent type II regulatory s... [more]
prkar2aa3.345e-3132.42protein kinase, cAMP-dependent, regulatory, type I... [more]
ENSPMAT00000001198.18.917e-1726.89pep scaffold:Pmarinus_7.0:GL480445:10050:25657:1 g... [more]
ENSPMAT00000005026.11.399e-1343.24pep scaffold:Pmarinus_7.0:GL484567:1893:8879:-1 ge... [more]
ENSPMAT00000001825.11.022e-1130.82pep scaffold:Pmarinus_7.0:GL485714:520:7294:-1 gen... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
BCY16.551e-3132.01Regulatory subunit of the cyclic AMP-dependent pro... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO382622.183e-3937.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO495341.882e-3032.03Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO484391.171e-2629.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO411636.054e-2331.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO384071.238e-2230.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prkar2aa2.350e-3932.80cAMP-dependent protein kinase type II-alpha regula... [more]
prkar2aa1.117e-3432.79cAMP-dependent protein kinase type II-alpha regula... [more]
si:ch211-272n13.71.318e-3431.25protein kinase cAMP-dependent type II regulatory s... [more]
prkar1b5.028e-3032.53protein kinase cAMP-dependent type I regulatory su... [more]
si:ch211-272n13.76.336e-3032.70protein kinase cAMP-dependent type II regulatory s... [more]
back to top
BLAST of cAMP-dependent protein kinase type II regulatory subunit, putative vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000013519.10.000e+0100.00SMESG000013519.1[more]
SMESG000051354.12.070e-4937.77SMESG000051354.1[more]
SMESG000017499.11.546e-3933.05SMESG000017499.1[more]
SMESG000059969.11.736e-3833.92SMESG000059969.1[more]
SMESG000042097.15.225e-3737.07SMESG000042097.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023807 ID=SMED30023807|Name=cAMP-dependent protein kinase type II regulatory subunit, putative|organism=Schmidtea mediterranea sexual|type=transcript|length=1047bp
AACTTTATTCAGTATTTCTTGAAAAATCAATTATAATTATTTCATTTCTA
TCGTTAATCTAAAAGCTGGAGAAATCAAAACATGCAACGACATCAGCTCG
AAATCGAGCTTCTCTTGGAACGGTTGACATGGAGCAATTAGCGAACGCCA
TTCGGTCTTTGCCTCGGCATGGGGTAACAGCGGAAAAGGTTGATCCTCGC
GATGCTACAAAAAGTATTTCAAGAAAAAAAAGTATAAAAAGTCCAATACA
AAAAGATCAAATCAAATCAGCTTTGAAATCGATTTTCCTATTCGAAGGAC
TTGAAGAAAACGAAACGAATGAAATAATTGAATTCATGACCTTTAAAATC
GTAAAAGACAAGGAAGTTATTATCAAAGAAAATGATCCGGGTGACAATTT
CTATGTCATCGAAAGAGGCAAGTATGAAGCTTATAAAGAAGGAAAGTTTC
TTAAACGTTACGAAAATTCCGGTTATTTCGGTGAATTGGCTTTGTTGTAC
AACACTCCAAGAAATGCCACTGTCATAGCGACCACTGATGGACAGTTGTG
GAGTTTGGATCGGAATTCATTTCAACGCCACATTTTACAGCACGCATTCG
ACAAACGAAAAAGATCGGAAACCTTAGTGAAGAAAAATCCCATTCTCCAA
AATCTCCTGGAACACGAATCGATCATGCTAATCGATTCAGTGAAATTCCA
AAGCTTTTCCAACAAAATCCTTTTCAAAGAAGGCGACAACAACGACACGA
TCTATTTGATTGATGAAGGAGAAATTCAGATTATCAAAAAAGTCAATGGA
CAAGATGTCGTGAAAAAGGTCCTGAAATCGGGAACGTATTTCGGAGAAGA
AACGGTTCTGTTTAAGCGGCCCAGCTCGTTTACCGCGAGAACCGGACCAA
GTGTGAAACTAGGATTGCTCAGTGACGAAACATTTATTATTAATATTTAT
TCATTGCTGTCAAAATGTACGGAAAATTGCGAATCGTTTATCAAATCGCT
TAATTGAATACTCATTTGAAATTTTTTCGTATTTTTTTATTACATAA
back to top

protein sequence of SMED30023807-orf-1

>SMED30023807-orf-1 ID=SMED30023807-orf-1|Name=SMED30023807-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=293bp
MEQLANAIRSLPRHGVTAEKVDPRDATKSISRKKSIKSPIQKDQIKSALK
SIFLFEGLEENETNEIIEFMTFKIVKDKEVIIKENDPGDNFYVIERGKYE
AYKEGKFLKRYENSGYFGELALLYNTPRNATVIATTDGQLWSLDRNSFQR
HILQHAFDKRKRSETLVKKNPILQNLLEHESIMLIDSVKFQSFSNKILFK
EGDNNDTIYLIDEGEIQIIKKVNGQDVVKKVLKSGTYFGEETVLFKRPSS
FTARTGPSVKLGLLSDETFIINIYSLLSKCTENCESFIKSLN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004715non-membrane spanning protein tyrosine kinase activity
GO:0016301kinase activity
GO:0016740transferase activity
GO:0000166nucleotide binding
GO:0005515protein binding
GO:0008603cAMP-dependent protein kinase regulator activity
GO:0030552cAMP binding
Vocabulary: biological process
TermDefinition
GO:0016310phosphorylation
GO:0018108peptidyl-tyrosine phosphorylation
GO:2000479regulation of cAMP-dependent protein kinase activity
GO:0001932regulation of protein phosphorylation
GO:0007411axon guidance
GO:0007622rhythmic behavior
GO:0007623circadian rhythm
GO:0045475locomotor rhythm
GO:0045859regulation of protein kinase activity
GO:0048148behavioral response to cocaine
GO:0048149behavioral response to ethanol
GO:0048511rhythmic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003304testis primordium
Vocabulary: INTERPRO
TermDefinition
IPR000595cNMP-bd_dom
IPR014710RmlC-like_jellyroll
IPR018490cNMP-bd-like
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005886plasma membrane
GO:0005952cAMP-dependent protein kinase complex
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00103CAMPKINASEcoord: 115..124
score: 72.67
coord: 127..138
score: 46.67
coord: 90..104
score: 45.56
coord: 75..89
score: 35.11
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 16..35
NoneNo IPR availablePANTHERPTHR11635CAMP-DEPENDENT PROTEIN KINASE REGULATORY CHAINcoord: 12..269
NoneNo IPR availablePANTHERPTHR11635:SF162CAMP-DEPENDENT PROTEIN KINASE TYPE II REGULATORY SUBUNITcoord: 12..269
IPR000595Cyclic nucleotide-binding domainSMARTSM00100cnmp_10coord: 172..288
e-value: 1.6E-8
score: 44.3
coord: 54..167
e-value: 3.9E-25
score: 99.5
IPR000595Cyclic nucleotide-binding domainPFAMPF00027cNMP_bindingcoord: 75..154
e-value: 3.3E-18
score: 65.5
coord: 195..269
e-value: 1.1E-10
score: 41.4
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 172..269
score: 17.975
IPR000595Cyclic nucleotide-binding domainPROSITEPS50042CNMP_BINDING_3coord: 54..169
score: 33.863
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 54..162
e-value: 1.4227E-25
score: 96.2409
IPR000595Cyclic nucleotide-binding domainCDDcd00038CAP_EDcoord: 172..269
e-value: 6.03707E-13
score: 62.3434
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 156..289
e-value: 1.7E-20
score: 75.0
IPR014710RmlC-like jelly roll foldGENE3DG3DSA:2.60.120.10coord: 18..155
e-value: 4.6E-42
score: 144.9
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 34..161
IPR018490Cyclic nucleotide-binding-likeSUPERFAMILYSSF51206cAMP-binding domain-likecoord: 163..270