O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein

Overview
NameO-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein
Smed IDSMED30023806
Length (bp)1965
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein (SMED30023806) t-SNE clustered cells

Violin plots show distribution of expression levels for O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein (SMED30023806) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein (SMED30023806) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein (SMED30023806) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023806

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023806SMESG000023263.1 SmedASXL_016510SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30023806SMESG000023263.1 dd_Smed_v4_17617_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023806SMESG000023263.1 dd_Smed_v6_17617_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30023806SMESG000023263.1 OX_Smed_1.0.12279ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30023806SMESG000023263.1 dd_Smed_v4_17617_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Human
Match: POMGNT1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:HGNC Symbol;Acc:HGNC:19139])

HSP 1 Score: 135.191 bits (339), Expect = 1.364e-32
Identity = 114/419 (27.21%), Postives = 194/419 (46.30%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG     E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ R L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:  109 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVFGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRRSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 502          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Human
Match: POMGNT1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:HGNC Symbol;Acc:HGNC:19139])

HSP 1 Score: 135.191 bits (339), Expect = 2.017e-32
Identity = 114/419 (27.21%), Postives = 194/419 (46.30%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG     E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ R L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:  109 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVFGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRRSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 502          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Celegans
Match: M70.4 (pep chromosome:WBcel235:IV:2253004:2263660:-1 gene:WBGene00019786.1 transcript:M70.4a.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M70.4)

HSP 1 Score: 60.8474 bits (146), Expect = 2.282e-9
Identity = 47/197 (23.86%), Postives = 98/197 (49.75%), Query Frame = 3
Query:  813 YRSLCSCNSLDT--IP-HFANRQ--NQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETY--LSEYMPDTTFMISRKLWQNELSL 1382
            +   C   +LD+  +P H ++ Q  +     +PI V S   P  L   + SL + +GL+ + +L+  D+ Y E+  +V LF +K + ++  G     S N++    +++NAF  F  A  ++++E++V  S D L+YF+   +     + +    A N+  F   +   +T   +  ++P  ++++ R L++  + L
Sbjct:  478 HEEFCGAANLDSPIMPRHLSDEQRSSDAIFNVPILVASGLAPDSLRITLESLLNQEGLNTQMVLVTYDKEYSENADLVSLFHVKSVAIQSNG-----SYNAH-LLLSLSNAFSIFPDASSVLVIEEDVTLSTDWLHYFSSIYEPYKADSTVDLALAFNSNGFIDTSGDGQTVYRIKNHLPIGSYLMKRDLYEKHIRL 668          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Celegans
Match: M70.4 (pep chromosome:WBcel235:IV:2253004:2263704:-1 gene:WBGene00019786.1 transcript:M70.4a.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:M70.4)

HSP 1 Score: 60.8474 bits (146), Expect = 2.282e-9
Identity = 47/197 (23.86%), Postives = 98/197 (49.75%), Query Frame = 3
Query:  813 YRSLCSCNSLDT--IP-HFANRQ--NQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETY--LSEYMPDTTFMISRKLWQNELSL 1382
            +   C   +LD+  +P H ++ Q  +     +PI V S   P  L   + SL + +GL+ + +L+  D+ Y E+  +V LF +K + ++  G     S N++    +++NAF  F  A  ++++E++V  S D L+YF+   +     + +    A N+  F   +   +T   +  ++P  ++++ R L++  + L
Sbjct:  478 HEEFCGAANLDSPIMPRHLSDEQRSSDAIFNVPILVASGLAPDSLRITLESLLNQEGLNTQMVLVTYDKEYSENADLVSLFHVKSVAIQSNG-----SYNAH-LLLSLSNAFSIFPDASSVLVIEEDVTLSTDWLHYFSSIYEPYKADSTVDLALAFNSNGFIDTSGDGQTVYRIKNHLPIGSYLMKRDLYEKHIRL 668          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Celegans
Match: gly-13 (Putative alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase [Source:UniProtKB/Swiss-Prot;Acc:Q11068])

HSP 1 Score: 58.9214 bits (141), Expect = 6.972e-9
Identity = 64/227 (28.19%), Postives = 99/227 (43.61%), Query Frame = 3
Query:  891 IPIAVVSVNDPHYLLRVISSLTSVKGLHPK-NILIFIDQNYEESKLIVDLFKLKLIRVR-LQG---NIDMPSKNSYKFRTAIANAFRHFYLA----------QYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNN---QYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSR--VFYFGRQRES 1511
            IP+ V S N    +   +  L   +    K  I++  D + E  K  V  F  K+  ++ L G   NI +P   S++  TA     RH+ LA            +II ED++D S D   YF+ T  ++ N  K++ V A N+   Q     T     Y S++     +M+S K W  EL   WP       W  W +D   + DR C+ P +SR  +  +G++  S
Sbjct:   93 IPVLVFSCNRAMAVRDHVEKLIRYRPSQEKFPIIVTQDCDNENVKNEVKKFGDKVEYIKHLAGDKANITIPP--SHRQYTAYYRIARHYKLALNHVFVDKGYSSVIITEDDLDISPDFFSYFSSTRYLLENDEKLWCVTAWNDNGKQENIDMTAASTLYRSDFFAGLGWMMSSKTWH-ELEPIWPVG----FWDDWMRDPARRKDRQCIRPEISRTGMMSYGKEGAS 312          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Celegans
Match: gly-12 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:Q8MQ38])

HSP 1 Score: 49.2914 bits (116), Expect = 6.485e-6
Identity = 34/132 (25.76%), Postives = 63/132 (47.73%), Query Frame = 3
Query: 1098 SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQY---FCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRV 1484
            S  ++ A+  AF+ F    ++I+ ED++D   D   YF     ++ +   I+ V+A N+         T     + +++ P   +M+++KLW NELS  +P       W  W +   ++  R C+ P +SR 
Sbjct:  149 SAHYKWALDKAFKGFRY-DHVIVTEDDLDIGNDFFSYFRWGKQVLNSDDTIWCVSAWNDNGGGPLIDSTRGDLIWRTDFFPGLGWMLTKKLW-NELSPGFP----VAYWDDWMRKPEVRKSRSCIRPEISRT 274          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Celegans
Match: gly-12 (GLYcosylation related [Source:UniProtKB/TrEMBL;Acc:Q8MQ38])

HSP 1 Score: 49.2914 bits (116), Expect = 6.485e-6
Identity = 34/132 (25.76%), Postives = 63/132 (47.73%), Query Frame = 3
Query: 1098 SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQY---FCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRV 1484
            S  ++ A+  AF+ F    ++I+ ED++D   D   YF     ++ +   I+ V+A N+         T     + +++ P   +M+++KLW NELS  +P       W  W +   ++  R C+ P +SR 
Sbjct:  149 SAHYKWALDKAFKGFRY-DHVIVTEDDLDIGNDFFSYFRWGKQVLNSDDTIWCVSAWNDNGGGPLIDSTRGDLIWRTDFFPGLGWMLTKKLW-NELSPGFP----VAYWDDWMRKPEVRKSRSCIRPEISRT 274          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Fly
Match: Mgat1 (gene:FBgn0034521 transcript:FBtr0086259)

HSP 1 Score: 56.225 bits (134), Expect = 6.472e-8
Identity = 40/151 (26.49%), Postives = 74/151 (49.01%), Query Frame = 3
Query: 1083 MPSKNSYKFRTAIANAFRHFYLA---------QYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAA--SNNQYFCSETFQRET-YLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGR 1499
            +P +  +K    IA   RH+  A         +++II+ED+++ + D   YF  T  ++     ++ V+A   N +    +  Q E  Y +++ P   +M+++ LW  ELS+ WP +     W  W +    + DR+C+ P +SR   FG+
Sbjct:  187 LPKEKKFKGYYKIA---RHYGWALNTTFAVGFEFVIIVEDDLNVAPDFFEYFLGTHKLLKQDPSLWCVSAWNDNGKAAVVDAAQPELLYRTDFFPGLGWMLTKDLWA-ELSVKWPKSF----WDDWIRHPAQRKDRVCIRPEISRTRTFGK 329          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Zebrafish
Match: pomgnt1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:ZFIN;Acc:ZDB-GENE-070112-991])

HSP 1 Score: 143.28 bits (360), Expect = 1.860e-35
Identity = 126/448 (28.12%), Postives = 205/448 (45.76%), Query Frame = 3
Query:  222 YSNNFYNRRIKRYPE--KEQIEFQISVCPKKIEMTISNIQLINDS----RDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVT-----SWILLAHKGVGKIAELYQWKNIKFP-------KECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANR-QNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            Y +   N    R P   ++ ++ ++     K+ + +    ++ D       G H+ V N+ATG  MA    +  S   + A  +  FL  +  GRI+I     F  + +GT        L+    NLL        VT      W L+  KG     ++Y  K+ K P          L+    L  SEE A C +W D+E  R R+  C  VEGY S+CSC     I    +   N     IP+AV++ N P+YL R++ SL S  G++P+ I +FID  YEE   +VDLF LK ++     +  +  KN   S  ++ ++   F     A + I++E+++D S D   +  QTI ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L+++EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:   74 YDDALPNMETPRRPASGRKVLDIEVYSSRSKVYVAVDGTTVLEDEIREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMIL--FLNMVTRGRILI-----FTIKDEGTFH------LKDAAKNLLKGLGSQVAVTLGWRDMWTLVVKKG----GQVYGEKHSKSPALSTWGDPVLLKTEVQLTASEE-AEC-HWADTELNRRRKLFCSKVEGYGSICSCKDPAPIEFNPDPLSNNNVYNIPVAVIAGNRPNYLYRMLRSLLSSHGVNPQMITVFIDGYYEEPMDVVDLFGLKGVQ-----HTPISIKNARVSQHYKASLTATFNLHPDADFAIVLEEDLDISIDFFSFLGQTIHLLHEDDSLYCISAWNDQGYEHTAEDPSLLYRVESMPGLGWVLKKSLYKDELEPKWPTPEKLWDWDMWMRMPEQRKGRECVIPDVSRSYHFG 497          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Zebrafish
Match: pomgnt1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:ZFIN;Acc:ZDB-GENE-070112-991])

HSP 1 Score: 143.28 bits (360), Expect = 1.860e-35
Identity = 126/448 (28.12%), Postives = 205/448 (45.76%), Query Frame = 3
Query:  222 YSNNFYNRRIKRYPE--KEQIEFQISVCPKKIEMTISNIQLINDS----RDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVT-----SWILLAHKGVGKIAELYQWKNIKFP-------KECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANR-QNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            Y +   N    R P   ++ ++ ++     K+ + +    ++ D       G H+ V N+ATG  MA    +  S   + A  +  FL  +  GRI+I     F  + +GT        L+    NLL        VT      W L+  KG     ++Y  K+ K P          L+    L  SEE A C +W D+E  R R+  C  VEGY S+CSC     I    +   N     IP+AV++ N P+YL R++ SL S  G++P+ I +FID  YEE   +VDLF LK ++     +  +  KN   S  ++ ++   F     A + I++E+++D S D   +  QTI ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L+++EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:   74 YDDALPNMETPRRPASGRKVLDIEVYSSRSKVYVAVDGTTVLEDEIREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMIL--FLNMVTRGRILI-----FTIKDEGTFH------LKDAAKNLLKGLGSQVAVTLGWRDMWTLVVKKG----GQVYGEKHSKSPALSTWGDPVLLKTEVQLTASEE-AEC-HWADTELNRRRKLFCSKVEGYGSICSCKDPAPIEFNPDPLSNNNVYNIPVAVIAGNRPNYLYRMLRSLLSSHGVNPQMITVFIDGYYEEPMDVVDLFGLKGVQ-----HTPISIKNARVSQHYKASLTATFNLHPDADFAIVLEEDLDISIDFFSFLGQTIHLLHEDDSLYCISAWNDQGYEHTAEDPSLLYRVESMPGLGWVLKKSLYKDELEPKWPTPEKLWDWDMWMRMPEQRKGRECVIPDVSRSYHFG 497          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Zebrafish
Match: pomgnt1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:ZFIN;Acc:ZDB-GENE-070112-991])

HSP 1 Score: 91.6633 bits (226), Expect = 1.843e-20
Identity = 58/195 (29.74%), Postives = 102/195 (52.31%), Query Frame = 3
Query:  876 QTYIQ------IPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQ 1430
            QTY Q      +P+AV++ N P+YL R++ SL S  G++P+ I +FID  YEE   +VDLF LK ++     +  +  KN   S  ++ ++   F     A + I++E+++D S D   +  QTI ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L+++EL   WP       W +W +
Sbjct:   43 QTYQQKSSAKNLPVAVIAGNRPNYLYRMLRSLLSSHGVNPQMITVFIDGYYEEPMDVVDLFGLKGVQ-----HTPISIKNARVSQHYKASLTATFNLHPDADFAIVLEEDLDISIDFFSFLGQTIHLLHEDDSLYCISAWNDQGYEHTAEDPSLLYRVESMPGLGWVLKKSLYKDELEPKWPTPEKLWDWDMWMR 232          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Zebrafish
Match: mgat1b (alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase b [Source:ZFIN;Acc:ZDB-GENE-061103-589])

HSP 1 Score: 50.447 bits (119), Expect = 5.758e-6
Identity = 47/223 (21.08%), Postives = 98/223 (43.95%), Query Frame = 3
Query:  885 IQIPIAVVS---VNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYK-----------FRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNN---QYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQ 1502
            I IPI V++   V     L R+I    S + L+P  I++  D  + ++  ++  +  ++  +      D+P +  ++           +R A+   F  F  +  ++I+ED+++ + D   YF     I+ +   ++ ++A N+               Y +++ P   +M+ +++W  EL   WP       W  W +    + +R C+ P +SR   FGR+
Sbjct:  197 IIIPILVIACDRVTVKRSLDRLIQYRPSAE-LYP--IIVSQDCGHADTARVIGSYGSQITHISQPDLADIPVRPDHRKFQGYYKIARHYRWALNQVFNVFAYST-VVIVEDDLEVAPDFFEYFRALYPILRSDPTLWCISAWNDNGRDGLVDPGKAELLYRTDFFPGLGWMLLKEVW-AELEPKWPK----AFWDDWMRHPEQRKNRSCIRPEISRTITFGRK 410          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Zebrafish
Match: mgat1b (alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase b [Source:ZFIN;Acc:ZDB-GENE-061103-589])

HSP 1 Score: 50.447 bits (119), Expect = 5.870e-6
Identity = 47/223 (21.08%), Postives = 98/223 (43.95%), Query Frame = 3
Query:  885 IQIPIAVVS---VNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYK-----------FRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNN---QYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQ 1502
            I IPI V++   V     L R+I    S + L+P  I++  D  + ++  ++  +  ++  +      D+P +  ++           +R A+   F  F  +  ++I+ED+++ + D   YF     I+ +   ++ ++A N+               Y +++ P   +M+ +++W  EL   WP       W  W +    + +R C+ P +SR   FGR+
Sbjct:  199 IIIPILVIACDRVTVKRSLDRLIQYRPSAE-LYP--IIVSQDCGHADTARVIGSYGSQITHISQPDLADIPVRPDHRKFQGYYKIARHYRWALNQVFNVFAYST-VVIVEDDLEVAPDFFEYFRALYPILRSDPTLWCISAWNDNGRDGLVDPGKAELLYRTDFFPGLGWMLLKEVW-AELEPKWPKAF----WDDWMRHPEQRKNRSCIRPEISRTITFGRK 412          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Xenopus
Match: pomgnt1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:NCBI gene;Acc:100158594])

HSP 1 Score: 140.969 bits (354), Expect = 1.184e-34
Identity = 126/450 (28.00%), Postives = 217/450 (48.22%), Query Frame = 3
Query:  219 NYSNNFYNRRIKRYP--EKEQIEFQISVCPKKIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKN---FQGQRKGTNFIE-LGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICP------NWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFAN----RQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            +Y  +       R P   K+ ++ +I     K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GRI+I   K+   F  +    N ++ LG   QI  S  L  +        W  +  KG     +++  K+ K P         + L  +I + P      +WPD+E  R R+R C  VEGY S+CSC   D  P   N    ++N+    +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V+L+ LK I+     +  +  KN   S  ++ ++   F     A+++I++E+++D S D   + +QTI ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L+++EL   WP       W +W +    + DR CL P VSR ++FG
Sbjct:   73 DYDESLQQEDSPRRPASSKKVLDIEIYSSRSKVYIAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVARGRILIFTIKDEGSFHLKDTAKNLLKSLGS--QIAPS--LGWR------DMWTFVVKKG----GQIFGEKHSKSPA-LSTWGDPILLKTDIQLVPPADAECHWPDTELNRRRKRFCSKVEGYGSVCSCK--DPTPIEFNPMPLKENKV-TTVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVELYGLKGIQ-----HTPISIKNARVSQHYKASLTATFNLHPDAKFVIVLEEDLDISVDFFSFLSQTIHLLEEDESLYCISAWNDQGYEHTAEDPSLLYRVETMPGLGWVLRKNLYKDELEPKWPTPEKLWDWDMWMRMPEQRKDRECLIPDVSRSYHFG 497          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Xenopus
Match: pomgnt1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:NCBI gene;Acc:100158594])

HSP 1 Score: 140.969 bits (354), Expect = 1.409e-34
Identity = 126/450 (28.00%), Postives = 217/450 (48.22%), Query Frame = 3
Query:  219 NYSNNFYNRRIKRYP--EKEQIEFQISVCPKKIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKN---FQGQRKGTNFIE-LGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICP------NWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFAN----RQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            +Y  +       R P   K+ ++ +I     K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GRI+I   K+   F  +    N ++ LG   QI  S  L  +        W  +  KG     +++  K+ K P         + L  +I + P      +WPD+E  R R+R C  VEGY S+CSC   D  P   N    ++N+    +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V+L+ LK I+     +  +  KN   S  ++ ++   F     A+++I++E+++D S D   + +QTI ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L+++EL   WP       W +W +    + DR CL P VSR ++FG
Sbjct:   73 DYDESLQQEDSPRRPASSKKVLDIEIYSSRSKVYIAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVARGRILIFTIKDEGSFHLKDTAKNLLKSLGS--QIAPS--LGWR------DMWTFVVKKG----GQIFGEKHSKSPA-LSTWGDPILLKTDIQLVPPADAECHWPDTELNRRRKRFCSKVEGYGSVCSCK--DPTPIEFNPMPLKENKV-TTVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVELYGLKGIQ-----HTPISIKNARVSQHYKASLTATFNLHPDAKFVIVLEEDLDISVDFFSFLSQTIHLLEEDESLYCISAWNDQGYEHTAEDPSLLYRVETMPGLGWVLRKNLYKDELEPKWPTPEKLWDWDMWMRMPEQRKDRECLIPDVSRSYHFG 497          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Xenopus
Match: pomgnt1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:NCBI gene;Acc:100158594])

HSP 1 Score: 136.346 bits (342), Expect = 5.343e-33
Identity = 126/447 (28.19%), Postives = 212/447 (47.43%), Query Frame = 3
Query:  219 NYSNNFYNRRIKRYP--EKEQIEFQISVCPKKIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKN---FQGQRKGTNFIE-LGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICP------NWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFAN----RQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            +Y  +       R P   K+ ++ +I     K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GRI+I   K+   F  +    N ++ LG   QI  S  L  +        W  +  KG     +++  K+ K P         + L  +I + P      +WPD+E  R R+R C  VEGY S+CSC   D  P   N    ++N+    +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V+L+ LK I+                   +I NA R    A+++I++E+++D S D   + +QTI ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L+++EL   WP       W +W +    + DR CL P VSR ++FG
Sbjct:   73 DYDESLQQEDSPRRPASSKKVLDIEIYSSRSKVYIAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVARGRILIFTIKDEGSFHLKDTAKNLLKSLGS--QIAPS--LGWR------DMWTFVVKKG----GQIFGEKHSKSPA-LSTWGDPILLKTDIQLVPPADAECHWPDTELNRRRKRFCSKVEGYGSVCSCK--DPTPIEFNPMPLKENKV-TTVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVELYGLKGIQ---------------HTPISIKNA-RVSQDAKFVIVLEEDLDISVDFFSFLSQTIHLLEEDESLYCISAWNDQGYEHTAEDPSLLYRVETMPGLGWVLRKNLYKDELEPKWPTPEKLWDWDMWMRMPEQRKDRECLIPDVSRSYHFG 483          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Xenopus
Match: pomgnt1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:NCBI gene;Acc:100158594])

HSP 1 Score: 128.257 bits (321), Expect = 1.840e-30
Identity = 124/445 (27.87%), Postives = 209/445 (46.97%), Query Frame = 3
Query:  219 NYSNNFYNRRIKRYP--EKEQIEFQISVCPKKIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKN---FQGQRKGTNFIE-LGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICP----NWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFAN----RQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            +Y  +       R P   K+ ++ +I     K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GRI+I   K+   F  +    N ++ LG   QI  S  L  +        W  +  KG     +++  K+ K P         + L  +I + P    +WPD+E  R R+R C  VEGY S+CSC   D  P   N    ++N+    +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V+L+ LK I+     +  +  KN        A   +H Y+  +L +M D       ++ + +QTI ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L+++EL   WP       W +W +    + DR CL P VSR ++FG
Sbjct:   73 DYDESLQQEDSPRRPASSKKVLDIEIYSSRSKVYIAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVARGRILIFTIKDEGSFHLKDTAKNLLKSLGS--QIAPS--LGWR------DMWTFVVKKG----GQIFGEKHSKSPA-LSTWGDPILLKTDIQLVPPAECHWPDTELNRRRKRFCSKVEGYGSVCSCK--DPTPIEFNPMPLKENKV-TTVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVELYGLKGIQ-----HTPISIKN--------ARVSQHVYILDHLSLMFD----IKLMIVFLSQTIHLLEEDESLYCISAWNDQGYEHTAEDPSLLYRVETMPGLGWVLRKNLYKDELEPKWPTPEKLWDWDMWMRMPEQRKDRECLIPDVSRSYHFG 480          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Xenopus
Match: pomgnt1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:NCBI gene;Acc:100158594])

HSP 1 Score: 128.257 bits (321), Expect = 2.287e-30
Identity = 138/544 (25.37%), Postives = 239/544 (43.93%), Query Frame = 3
Query:  219 NYSNNFYNRRIKRYP--EKEQIEFQISVCPKKIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKN---FQGQRKGTNFIE-LGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICP----NWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIP--HFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG----RQRESFKSVQIHKSDKTKFLNYDLNPLSTSSHDAF---LKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKC 1778
            +Y  +       R P   K+ ++ +I     K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GRI+I   K+   F  +    N ++ LG   QI  S  L  +        W  +  KG     +++  K+ K P         + L  +I + P    +WPD+E  R R+R C  VEGY S+CSC     I       ++N+    +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V+L+ LK I+     +  +  KN        A   +H Y+  +L +M D       ++ + +QTI ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L+++EL   WP       W +W +    + DR CL P VSR ++FG         F      K       N  L+ + +   DA+   + +I  ++   +  K  C ++ I        +      ++ + M    D + W  L KC
Sbjct:   73 DYDESLQQEDSPRRPASSKKVLDIEIYSSRSKVYIAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVARGRILIFTIKDEGSFHLKDTAKNLLKSLGS--QIAPS--LGWR------DMWTFVVKKG----GQIFGEKHSKSPA-LSTWGDPILLKTDIQLVPPAECHWPDTELNRRRKRFCSKVEGYGSVCSCKDPTPIEFNPMPLKENKV-TTVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVELYGLKGIQ-----HTPISIKN--------ARVSQHVYILDHLSLMFD----IKLMIVFLSQTIHLLEEDESLYCISAWNDQGYEHTAEDPSLLYRVETMPGLGWVLRKNLYKDELEPKWPTPEKLWDWDMWMRMPEQRKDRECLIPDVSRSYHFGIVGLNMNGYFHEAYFKKHKFNTVPNVQLSNVKSLQKDAYEIEIHRILSEAEILDHSKNPCEDSFI-------PDTEGKTYVMYIKMEQEADFTTWTQLAKC 574          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Mouse
Match: Pomgnt1 (protein O-linked mannose beta 1,2-N-acetylglucosaminyltransferase [Source:MGI Symbol;Acc:MGI:1915523])

HSP 1 Score: 134.42 bits (337), Expect = 1.522e-32
Identity = 113/419 (26.97%), Postives = 195/419 (46.54%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG   + E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:   87 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 480          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Mouse
Match: Pomgnt1 (protein O-linked mannose beta 1,2-N-acetylglucosaminyltransferase [Source:MGI Symbol;Acc:MGI:1915523])

HSP 1 Score: 134.42 bits (337), Expect = 1.574e-32
Identity = 113/419 (26.97%), Postives = 195/419 (46.54%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG   + E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:  109 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 502          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Mouse
Match: Pomgnt1 (protein O-linked mannose beta 1,2-N-acetylglucosaminyltransferase [Source:MGI Symbol;Acc:MGI:1915523])

HSP 1 Score: 134.42 bits (337), Expect = 1.574e-32
Identity = 113/419 (26.97%), Postives = 195/419 (46.54%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG   + E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:  109 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 502          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Mouse
Match: Pomgnt1 (protein O-linked mannose beta 1,2-N-acetylglucosaminyltransferase [Source:MGI Symbol;Acc:MGI:1915523])

HSP 1 Score: 134.42 bits (337), Expect = 1.574e-32
Identity = 113/419 (26.97%), Postives = 195/419 (46.54%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG   + E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:  109 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 502          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Mouse
Match: Pomgnt1 (protein O-linked mannose beta 1,2-N-acetylglucosaminyltransferase [Source:MGI Symbol;Acc:MGI:1915523])

HSP 1 Score: 125.176 bits (313), Expect = 1.731e-29
Identity = 106/412 (25.73%), Postives = 184/412 (44.66%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG                 EC                 +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:  109 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGEA---------------EC-----------------HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 469          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q5RCB9|PMGT1_PONAB (Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Pongo abelii OX=9601 GN=POMGNT1 PE=2 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 1.019e-32
Identity = 113/416 (27.16%), Postives = 195/416 (46.88%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG   + E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+    G  +  ++ S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ R L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:  109 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQHTPIGIKN--ARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRRSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 502          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q5EAB6|PMGT1_BOVIN (Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Bos taurus OX=9913 GN=POMGNT1 PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 1.863e-32
Identity = 116/440 (26.36%), Postives = 201/440 (45.68%), Query Frame = 3
Query:  243 RRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRD----GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            RRI   P +  ++ ++     K+ + +    ++ D       G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG   + E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:   89 RRIGSGPRR-VLDVEVYSSRSKVYVAVDGTTVLEDEAQEQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 502          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q8WZA1|PMGT1_HUMAN (Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Homo sapiens OX=9606 GN=POMGNT1 PE=1 SV=2)

HSP 1 Score: 135.191 bits (339), Expect = 6.553e-32
Identity = 114/419 (27.21%), Postives = 194/419 (46.30%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG     E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ R L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:  109 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVFGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRRSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 502          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q5XIN7|PMGT1_RAT (Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Pomgnt1 PE=2 SV=1)

HSP 1 Score: 135.191 bits (339), Expect = 6.984e-32
Identity = 113/419 (26.97%), Postives = 195/419 (46.54%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG   + E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:  109 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 502          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. UniProt/SwissProt
Match: sp|Q91X88|PMGT1_MOUSE (Protein O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1 OS=Mus musculus OX=10090 GN=Pomgnt1 PE=1 SV=1)

HSP 1 Score: 134.42 bits (337), Expect = 1.101e-31
Identity = 113/419 (26.97%), Postives = 195/419 (46.54%), Query Frame = 3
Query:  306 KIEMTISNIQLIND-SRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAE-------LYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCN-------SLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            K+ + +    ++ D +R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I   K+            L + L       L  +       +W  +  KG   + E       L  W +    K  + +S     S E A C +W D+E  R RRR C  VEGY S+CSC        S D +P      +   + +P+AV++ N P+YL R++ SL S +G+ P+ I +FID  YEE   +V LF L+ I+     +  +  KN   S  ++ ++   F  F  A++ +++E+++D + D   + +Q+I ++     ++ ++A N+Q Y  +       Y  E MP   +++ + L++ EL   WP       W +W +    +  R C+ P VSR ++FG
Sbjct:  109 KVYVAVDGTTVLEDEAREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMVL--FLNMVAPGRVLICTVKDEGSFHLKDTAKALLRSLGSQAGPALGWR------DTWAFVGRKGGPVLGEKHSKSPALSSWGDPVLLKTDVPLS-----SAEEAEC-HWADTELNRRRRRFCSKVEGYGSVCSCKDPTPIEFSPDPLP------DNKVLNVPVAVIAGNRPNYLYRMLRSLLSAQGVSPQMITVFIDGYYEEPMDVVALFGLRGIQ-----HTPISIKNARVSQHYKASLTATFNLFPEAKFAVVLEEDLDIAVDFFSFLSQSIHLLEEDDSLYCISAWNDQGYEHTAEDPALLYRVETMPGLGWVLRKSLYKEELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFG 502          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. TrEMBL
Match: V4AMT2 (ILEI domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_102560 PE=4 SV=1)

HSP 1 Score: 182.57 bits (462), Expect = 1.153e-45
Identity = 160/532 (30.08%), Postives = 250/532 (46.99%), Query Frame = 3
Query:  345 DSRDGFHIFVFNEATGSFMA-HFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQG--QRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICP------NWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANR-QNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGR---------QRESFKSVQIHKSDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCXXXXXXXXXXCWYKMSCMLCFESTKVLLIGEPFS 1880
            D+  G H+ V N+ATGS MA   +D  N    +  + +  FLK I DGRIII   K+ +G  Q K T    L  +   Y +N+      N+  T W  +A KG  KI E +     K P       KS+ L+  I + P      NWPD+E  R R   C  VEGY ++CSC     I     + +N     IPIAV++ N PHYL R++ +L SV G +P+ + +FID  +EE   +  L+ +K I+    G  +  ++ S  ++T++   F     A Y I++E+++D S D   YF+QT  ++   + ++ ++A N+Q Y  S   +   Y  E MP   +++ RKL+++EL   WP       W +W ++  I+ DR C+ P VSR ++FG          Q   FK   I      K    DL+ +    ++  + ++  KS E   +  N  +     N +D         L+ +SM S  D + W  L KC           ++K    L  +   +L+IG P S
Sbjct:  126 DTNRGVHVVVLNQATGSVMAKRIFDTYNQ---HEDEAMVLFLKMISDGRIIIFTIKD-EGTFQLKSTARQYLASMGSEYITNI------NWRDT-WAFVAIKGGKKIGEAHN----KSPSLSSWGEKSV-LTVHIKLSPKSESRCNWPDNESNRRREVFCSKVEGYGNVCSCTDPSPISFSPQKLENNKISDIPIAVIASNRPHYLYRMLGTLLSVPGANPQLVTVFIDGYFEEPLEVTKLWGIKGIQHTPMGIKN--ARISQHYKTSLTATFNLHPKADYAIVIEEDLDVSPDFFNYFSQTKHLLDEDSSLYCISAWNDQGYEHSCKNESLLYRVETMPGLGWLLRRKLYKDELEPKWPTPDKQWDWDMWMRNNFIRKDRECIIPDVSRTYHFGSKGLNMNPYFQEIYFKKHSIVAKPDVKL--KDLDRMKQKEYEGVINELI-KSGEVLSENHNPCDDSFIPNTKD------KTYLLYISMKSPTDYTTWKILAKC-FHIWDLDVRGFHKSMWRLFLKENHILIIGVPAS 629          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. TrEMBL
Match: R7V1L9 (ILEI domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_154180 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.218e-42
Identity = 130/441 (29.48%), Postives = 221/441 (50.11%), Query Frame = 3
Query:  231 NFYNRRIKRY--PEKEQIEFQISVCPKKIEMTISNIQLINDSRD----GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKN---FQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVG--KIAELYQWKN--IKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANRQ---NQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYF---CSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG 1496
            N   R IK+   P  + IE ++     K+ +T+    ++ DS      G H+ V N+ATGS MA    +  S   + A  +  FL  + +GRIII   K+   FQ +++    ++     Q+ + +  S+   +    +W ++ HKG G  ++AE++        +    L  ++    S+E + C NWP+SE    RR  C  +EGY S+CSC  LD  P         +     IP+AV++ + PHYL R++ SL S  G++P  I +FID  +E    +  LF L+ I+    G  +  ++ +  ++ ++   F  F  AQY+II+E+++D S D   YF+QT+ ++   + ++ V+A N+Q +   C +      Y  E MP   +++ R L++ EL   WP       W +W +   I+ +R CL P VSR ++FG
Sbjct:   67 NGAPRNIKQVLEPGPQYIELEVLSSKNKVSVTVDGTMIMEDSSADHSRGIHVLVLNQATGSVMAQRVFDTYSPHEDEAMVL--FLNMVSNGRIIIFAIKDEGSFQMKQQARELLQ-----QLGSQHSASLGWRD----TWAMVIHKGAGDQRLAEVFNKSPDLASWGSPVLLHAEVALRSQEESEC-NWPESEANNRRRIFCNKLEGYGSVCSC--LDPAPLTFTPDPVPDNLVHNIPVAVIASDRPHYLYRMLRSLLSADGVNPDMITVFIDGYFEAPLEVTHLFGLRGIQHTPIGVKN--ARIAQHYKASLTATFHLFPEAQYMIILEEDLDVSPDFFSYFSQTLPLLEQDSSLYCVSAWNDQGYEHSCEDPAL--LYRVETMPGLGWILKRSLYKEELEANWPTPEKQWDWDMWMRLPSIRKNRECLVPDVSRTYHFG 489          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. TrEMBL
Match: A0A267GSA8 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig001922g5 PE=4 SV=1)

HSP 1 Score: 174.096 bits (440), Expect = 1.299e-42
Identity = 151/537 (28.12%), Postives = 275/537 (51.21%), Query Frame = 3
Query:  315 MTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSN--LLSMKRGNFTVT-SWILLAHKGVGKIAE-LYQWKNIKFPKECLRMSKSLGL-SEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANRQN--QTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYL--SEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSV-QIHKSDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSK-----WNYLRKCXXXXXXXXXXCWYKMSCMLCFESTKVLLIGEPFS 1880
            + I ++ L+N S  G HIF+ N+AT S M H      S++      +   L S+  GR++I+   + Q  R+  +  E   +  + +S   ++S K+ +  VT SW+L+A   +G+I E L Q +  +     LR+S  + L SE+  ICP+WP SE T  RRR C+L EG+ ++C C++   I  F +R     T+  +P+ V+S N P +L R +SSL S++ L+     + +   +EE +LI DL KL   +   +  +     N Y  R  +A++F  F  A ++I++E +VDSS DL+ +FN+T+ ++     +F + A N+Q F + T Q    L  ++ +P     I R  W+++L+  WP+   D +   W    M    R CL P +SR F +    +S + + ++  + +T+  ++ ++  + S++D+ L+ + D S+ +N        + +   A    + + N  L  + +S+R  + +     W  + +C   SL    +C YK +C + F+   +L++  P +
Sbjct:  117 LAIDDVLLVNQSTQGLHIFIVNQATASLMGH---QVFSSL----DELKPLLTSVTAGRLLIL--TSVQKFRRTGSADEAAALRLLGSSGFQIVSPKKPDMEVTASWVLIAFAKIGRIDEQLMQSRGRQ-----LRLSTQVRLVSEDDPICPSWPPSEDTTRRRRFCQLAEGFNNVCDCSTPAAI-SFQSRPAPWSTHGVVPLTVLSSNQPQFLFRTLSSLLSIQSLNVSQTHVMLRGFFEEPRLICDLLKLAYTQ---RKQVSASLANLY--RLGMADSFHLFPTASFVILLEGDVDSSPDLVEFFNRTLPLMRRDPNLFCIGAWNDQSF-THTSQEPGLLLRTQQVPLKAVAIRRTTWESQLNEQWPEGPIDLA--SWLGRVM-GPRRYCLRPALSRAFVYS---QSLRLIDRLRPAYRTESASFCIDEEAHSNYDSRLQGLIDSSVGFNSHFARGCQSAVL-AATSLASRTVNSTLPSLLISARASNIRVAQQFWTRVARC--FSLNAGLTCLYKGTCQINFQRFILLVLFRPLA 623          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. TrEMBL
Match: A0A023EZ29 (Putative n-acetylglucosaminyltransferase i OS=Triatoma infestans OX=30076 PE=2 SV=1)

HSP 1 Score: 169.859 bits (429), Expect = 4.729e-41
Identity = 151/586 (25.77%), Postives = 266/586 (45.39%), Query Frame = 3
Query:  237 YNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRDG----FHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICP------NWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANR-QNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLS-EYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGR---------QRESFKSVQIHKSDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCXXXXXXXXXXCWYKMSCMLCFESTKVLLIGEPFSSI-LN*DELPICLNVPF 1928
            YN ++   P    IE   S    ++ +T+    ++ D   G     HI V N+A+GS M+    +  S   + A  +  FL  I DGRI+I     F  + +GT  ++ G    + T       +G      W ++  KG GK+      K+  F         S+ L+ ++ + P      +WPD+E    R + C  +EGY S+CSC+   T+       +N   + +P+ V++ N PHYL R + SL S +G   + I +FID  +EE   +  L  L+ I+    G  +  S+ S  ++ + + AF  F  A Y+I++E+++D S D   YF+QT+ ++   + I+ ++A N+  +   +    T L  E MP   +++SR L++NEL   WP       W +W +   I+  R C+ P VSR F+FG          Q   FKS   +     K   +++  +    ++  +  I       N     C +  I    +  +  + N++++ + M++ +D   W  + KC           ++K    L  +  ++L+IG P+S   L   E  + L++PF
Sbjct:   93 YNAQVDSTPASLSIEVLSS--QSRVTVTVDGATIVEDGEKGEGRGMHIVVLNQASGSVMSQRLFDTYSLHEDEAMAL--FLNMISDGRIVI-----FSIKDEGTYQLK-GGARSVLTRLGSRHAQGLSWRDMWAMVVQKG-GKVHGESYSKSPAFSS----WGASVILTVQVPLVPLDRSICSWPDTEENNRRLQFCNRIEGYGSVCSCDDPATLSFNPEPVENNNVLSVPVVVIASNRPHYLYRTLRSLLSARGARKEMITVFIDGYFEEPLEVTRLLGLRGIQHTPIGYKN--SRISQHYKASFSAAFNMFPHADYIIVVEEDLDVSEDFFSYFSQTVKLLEMDSSIYCISAWNDLGYEETSSNVSTLLRVETMPGLGWLLSRILYKNELEAKWPTPEKMWDWDMWMRMSEIRKGRECVIPEVSRTFHFGASGINMNSYFQDRYFKSHSFNTQPHAKL--HNIESVIKHKYEDLIHSILKTGTFLNHSISPCDDNFIPNKIK--QQTTENVLILFIKMNNSKDFDTWLQVAKC-FKIWDLDARGYHKAMWRLRIKRHQLLVIGYPYSPYSLYKPEFIVPLSLPF 656          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. TrEMBL
Match: A0A0B6ZBY8 (ILEI domain-containing protein (Fragment) OS=Arion vulgaris OX=1028688 GN=ORF56744 PE=4 SV=1)

HSP 1 Score: 166.007 bits (419), Expect = 3.970e-40
Identity = 140/571 (24.52%), Postives = 268/571 (46.94%), Query Frame = 3
Query:  237 YNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDS----RDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKN---FQGQRKGTNFIE-LG--KILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELY-QWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANR-QNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYF---CSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQ----RESFKSVQIHK----SDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCXXXXXXXXXXCWYKMSCMLCFESTKVLLIGEPFS 1880
            +NRR+    + + I   +    + + + +    ++ D       G H+ + N++TGS MA    +  S   + A  +  FL  +  GRI++   K+   FQ +      ++ LG  KI  I   ++            W  +  KG G I E + +  NI+   + + M+  + LS        WP+ E ++ R+  C  VEGY S+CSC+    +     +  N     IPIAV++ + PHYL R++ +L SV G +P  + +FID  +EE   +  LF L+ I+    G  +  ++ S  ++ ++   F  +  AQY I++E+++  S D   YF+QT  ++   + ++ ++A N+Q +   C +  Q   Y  E MP   +++ R L+++EL   WP       W +W +   ++ DR C+ P +SR ++FG +       F+ V   K    S+K+  L  D++ +  + ++  + ++   +   +  K+ C    I  N  +     S +  + + M +  D + W  + KC  +  + ++  ++K    L  ++ +V++IG P S
Sbjct:   16 FNRRLSVPSQPQSITINLVSSRESVFIAVDGTTVLQDEGFEKNRGIHVIILNQSTGSVMAKRVFDTYSQQEDDAMVL--FLNMVSKGRILVFAIKDEGSFQLKAPARALLKSLGSEKITDIGYRDM------------WAYVTMKGGGNIGEKHSKAANIESWADKVEMTVEVPLSIADQDECAWPNDEGSKRRKAFCSRVEGYGSVCSCDGSAPVTFKPEKLSNSKVSDIPIAVIASDRPHYLYRMLETLLSVPGANPDMVTVFIDGYFEEPLAVTKLFGLRGIQHTPLGLRN--ARISQHYKASLTATFNLYPNAQYAIVIEEDLTVSPDFFNYFSQTKHLLDEDSSLYCISAWNDQGYEHSCKDPSQ--LYRVETMPGLGWLLKRSLYKDELEPQWPTPEKQWDWDMWMRSNAVRKDRECIIPDISRTYHFGSKGLNMNPYFQEVYFKKHSLLSEKSVKLK-DVDRMKKNEYEKLINELISVARPIDHTKVPCDKDFIPENVPE-----STIFTVYIEMETANDFTVWKSIAKCQHIWDLDVRG-FHKSMWRLFIKNHQVIIIGTPAS 561          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Cavefish
Match: pomgnt1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:ZFIN;Acc:ZDB-GENE-070112-991])

HSP 1 Score: 89.3521 bits (220), Expect = 2.969e-18
Identity = 121/542 (22.32%), Postives = 221/542 (40.77%), Query Frame = 3
Query:  219 NYSNNFYNRRIKRYPE--KEQIEFQISVCPKKIEMTISNIQLINDSRD----GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVT-----SWILLAHKGVGKIAELYQWKNIKFP-------KECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANRQ---NQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSVQIHKSDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKC 1778
            +Y +N  N    R P   ++ ++ ++     K+ + +    ++ D       G H+ V N+ATG  MA    +  S   + A  +  FL  +  GR++I     F  + +GT        L+    NLL         T      W L+  KG     ++Y  K+ K P          L+    L  +EE A C +W ++E  R R+  C  VEGY S+CSC   D  P   N +   N     +P+AV++ N P+YL R++ SL S  G++P+ I   +D        +V+LF LK ++                 + A  +   H    ++             + ++ +QTI ++     ++ ++A N+Q Y  +       Y  E MP   +++ + ++++EL   WP  + +K  K+ F  F        L  L   V++   +  +  +VQ+   D  K  +Y++           ++ +  ++   +  K  C ++ I        +      ++ + M    D+S W  L KC
Sbjct:   74 DYDDNLANMETPRRPASGRKVLDIEVYSSRSKVYVAVDGTTVLEDEMREQGRGIHVIVLNQATGHVMAKRVFDTYSPHEDEAMIL--FLNMVTRGRVLI-----FTIKDEGTFH------LKDAAKNLLKGLGSQVAATLSWRDMWALVVKKG----GQVYGEKHSKSPALSTWGDPVLLKTEVQLTAAEE-AEC-HWAETELNRRRKLFCSKVEGYGSICSCK--DPAPIEFNPEPLPNNNVYNVPVAVIAGNRPNYLYRMLRSLLSSHGVNPQMITEPMD--------VVELFGLKGVQ-----------HTPISIKNARVSQVIHVSPLKF-------------IFFFLSQTIHLLNEDESLYCISAWNDQGYEHTAEDPSLLYRVESMPGLGWVLKKSIYKDELEPKWP--TPEKVRKLQFSLF----GGFGLVGLCCEVYFKKHKFNTVPNVQLKNVDGLKKDDYEVE----------IQNLLREAEVLDHSKNPCEDSFI-------PDTEGKTYIMFIKMEQETDTSTWTELAKC 539          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Cavefish
Match: mgat1a (alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like [Source:NCBI gene;Acc:103038529])

HSP 1 Score: 55.4546 bits (132), Expect = 1.319e-7
Identity = 47/185 (25.41%), Postives = 86/185 (46.49%), Query Frame = 3
Query: 1092 KNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNN---QYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESF-----KSVQIHK--SDKTKFLNYDLNPLSTSSHDA-FLKKI 1613
            K S  +R A+   F  F  +  +II+ED+++ + D   YF     ++ + T ++ V+A N+   + +         Y +++ P   +M+ + LW  EL   WP +     W  W +    + DR C+ P +SR   FGR+  S      K ++  K  ++   F   DL+ L    +D  F+K++
Sbjct:  189 KISRHYRWAMNQVFNSFSYSS-VIIVEDDLEVAPDFFEYFTALYPVLKSDTSLWCVSAWNDNGREGYVDPGKPSLLYRTDFFPGLGWMLLKDLWL-ELEPKWPASF----WDDWMRHPDQRKDRSCIRPEISRTLTFGRKGVSLGQFYDKYLRFIKLNTESVPFTKTDLSYLEKKKYDEDFVKEV 367          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Cavefish
Match: mgat1b (alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase b [Source:ZFIN;Acc:ZDB-GENE-061103-589])

HSP 1 Score: 55.0694 bits (131), Expect = 1.492e-7
Identity = 56/254 (22.05%), Postives = 111/254 (43.70%), Query Frame = 3
Query:  804 VEGYRSLCSCNS----LDTIPHFANRQNQTYIQIPIAVVS---VNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYK-----------FRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNN---QYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQ 1502
            ++ +RSL   +     + T P  AN Q      IPI V++   V     L ++I    SV+ LHP  I++  D  + E+  ++  +  ++  +      D+P +  ++           +R A+   F  F  +  ++I+ED+++ + D   YF     I+ +   ++ ++A N+               Y +++ P   +M+ +++W  EL   WP       W  W +    + +R C+ P +SR   FGR+
Sbjct:   73 IQSHRSLWEQHKDNPVVTTPPPEANPQPV----IPILVIACDRVTVSRSLDKLIQYRPSVE-LHP--IIVSQDCGHAETARVIGSYGSQVTHISQPDLADIPVRPDHRKFQGYYKIARHYRWALNQVFNTFSYST-VVIVEDDLEVAPDFFEYFRALYPILRSDPSLWCISAWNDNGRDGLVDPGKADLLYRTDFFPGLGWMLLKEVWA-ELEPKWPK----AFWDDWMRHPEQRKERSCIRPEISRTITFGRK 313          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO45785 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRM3])

HSP 1 Score: 137.887 bits (346), Expect = 1.020e-34
Identity = 98/354 (27.68%), Postives = 171/354 (48.31%), Query Frame = 3
Query:  462 FLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRG-NFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANR-QNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRET--YLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQ 1502
            F+  + DGRI+    K+            L KIL       L  +    F V     +  + +GK   L  W         + +  ++ L+    I   W ++E  + RR  C   EGY S+CSC +   I   ++       +++P+A+++ N PHYL R+I S+ S  G  PK + +FID  +EE   +  LF L+ I+     +  + SKN   S  ++ ++   F  +  A+Y+II+E+++D S DL YYF Q + ++ +   ++ ++A N+Q +   T    T  Y  E MP   +++ RK++++EL   WP       W +W +   I+  R C+ P +SR ++FG +
Sbjct:   21 FINLVSDGRILCFAAKDDASMSLKKTTRNLFKILGSENFERLGWRDNFAFVVQKKGKVYAESLGKAETLGTWA------APVSIDVNVPLASGKNIECRWEETEVNKRRRVFCNKYEGYGSVCSCTNPAEIDIKSDPLPGNALLELPVAIIASNRPHYLYRMIRSMLSASGADPKMVTVFIDGYFEEPLAVAKLFGLRGIQ-----HTPISSKNARISQHYKASLTTTFNLYPKAEYMIIIEEDLDVSPDLFYYFQQLLPVMNDDGSVYCISAWNDQGY-DHTVGDNTMLYRVETMPGLGWVLKRKMYKDELEPKWPTPDKFWDWDMWMRLPEIRKGRECIIPDISRTYHFGTK 362          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Nematostella
Match: EDO45873 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RRS3])

HSP 1 Score: 135.191 bits (339), Expect = 9.611e-34
Identity = 96/353 (27.20%), Postives = 168/353 (47.59%), Query Frame = 3
Query:  753 NWPDSEXXXXXXXXXXLVEGYRSLCSC---NSLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNID-MPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQ----RESFKSVQI--HKSDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKC 1778
            +W DSE +R RR  C   EGY+ +C C   + +D  P     +    +++PIAV++   PHYL R++ +L  V GL P  + +FID  Y+E   I  LF L   RV     I  + S+ +  ++ ++  +F  F  AQYL+I+E+++D S D+L YF Q + I+     +F ++A N+Q Y  S       Y  E MP   +++SRK+++ EL   WP       W +W +       R C+ P VSR ++FG +       F+      H  ++   + ++   +   +++  + ++   +   + D   C+N   F       +      +  ++M    D   WN + +C
Sbjct:  117 DWEDSEASRRRREFCDKYEGYKGVCKCVEPSIIDMDP--PTLEGGGRVKLPIAVMASRRPHYLFRMLKTLHGVVGLDPSMVTVFIDGFYDEPASIAKLFNL---RVDAHAPISKLNSRIAQHYKKSLTTSFARFPDAQYLVILEEDLDISVDILTYFQQMLPILETDESLFCISAWNDQGYEHSSHDPSMMYRLETMPGLGWVLSRKIYKGELEAKWPKPDVFWDWDMWTRSPDQLKGRECIIPDVSRTYHFGAKGLNMNPYFQDAYFTKHAFNRQPNVKFNAEIMRKDNYEKEIHRLITSATLLDHDTTPCANPKSF-----VPDTKEKTYVFYIAMKQHGDWKTWNNVARC 459          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Medaka
Match: pomgnt1 (protein O-linked mannose N-acetylglucosaminyltransferase 1 (beta 1,2-) [Source:NCBI gene;Acc:101165468])

HSP 1 Score: 140.198 bits (352), Expect = 1.812e-34
Identity = 134/506 (26.48%), Postives = 227/506 (44.86%), Query Frame = 3
Query:  336 LINDSRD---GFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKN---FQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFP-------KECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANR-QNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKN---SYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQ-YFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFG----RQRESFKSVQIHKSDKTKFLNYDLNPLSTSSHDAF---LKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKC 1778
            L +D R+   G H+ V N+ATG  MA    +  S   + A  +  FL  +  GRI+I   K+   F  +    N ++      + +   LS+   +     W L+  KG     ++Y  K+ K P          L+    L  SEE A C  W D+E  R R+  C  VEGY S+CSC     I    +   N     +P+AV++ N P+YL R++ SL S  G++P  I +FID  YEE   +V+LF LK ++     +  +  KN   S  ++ ++   F     A + +++E+++D S D   + +QTI ++     ++ ++A N+Q Y  +       Y  E MP   +++ R ++++EL   WP       W +W +    +  R C+ P VSR ++FG         F  V   K       N  L  + +   DA+   ++K+  ++   +  K  C ++ +        +      ++ V M S  D++ W  L KC
Sbjct:  115 LEDDMREQSRGIHVIVLNQATGHVMAKRIFDTYSPHEDEAMIL--FLNMVTRGRILIFTIKDEGTFHLKNAAKNLLK-----GLGSQASLSLNWRDM----WTLVTKKG----GQVYGEKHSKSPALSTWGDPVLLKTEVQLTASEE-AEC-LWADTELNRRRKLFCSKVEGYGSICSCKDPAPIEFNPDPLPNNNVYNVPVAVIAGNRPNYLYRMLRSLLSANGVNPHMITVFIDGYYEEPMDVVELFGLKGVQ-----HTPISIKNARVSQHYKASLTATFNLHPEANFAVVLEEDLDVSIDFFSFLSQTIHLLDEDDSLYCISAWNDQGYEHTAEDPSLLYRVESMPGLGWVLKRSIYKDELEPKWPTPEKLWDWDMWMRMPEQRRGRECIIPDVSRSYHFGIIGLNMNGYFHEVYFKKHKFNTVPNVQLKNVDSLKKDAYEVEIQKLLKEAEVLDHSKNPCEDSFV-------PDTEGKTYVMFVKMDSEADTTTWTELAKC 591          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Medaka
Match: mgat1b (alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglucosaminyltransferase-like [Source:NCBI gene;Acc:101173236])

HSP 1 Score: 58.9214 bits (141), Expect = 9.877e-9
Identity = 50/220 (22.73%), Postives = 97/220 (44.09%), Query Frame = 3
Query:  891 IPIAVVS---VNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDM---PSKNSYKFRTAIANAFR-------HFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNN---QYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQ 1502
            IPI V++   V     L R+I    S + LHP  I++  D  + E+  ++  +  ++  +R     D+   P    ++    IA  +R       H +    ++I+ED+++ + D   YF     I+     ++ V+A N+         +     Y +++ P   +M+ +++W +EL   WP       W  W +    + +R C+ P +SR   FGR+
Sbjct:  172 IPILVIACDRVTVKRSLDRLIQYRPSPE-LHP--IIVSQDCGHAETARVIGSYGAQVTHIRQPDLADIRVRPEHRKFQGYYKIARHYRWALNQVFHTFSQPTVVIVEDDLEVAPDFFEYFRALYPILNADPTLWCVSAWNDNGRDALVDPSRPELLYRTDFFPGLGWMLLKEMW-DELEPKWPS----AFWDDWMRQPEQRRNRSCIRPEISRTITFGRK 383          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000023263.1 (SMESG000023263.1)

HSP 1 Score: 1181.01 bits (3054), Expect = 0.000e+0
Identity = 592/594 (99.66%), Postives = 593/594 (99.83%), Query Frame = 3
Query:  111 VVIYFHPNWLAKITDSQQEKVCKHSKCGHVKKLKPTNYSNNFYNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSVQIHKSDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCXXXXXXXXXXCWYKMSCMLCFESTKVLLIGEPFSSILN 1892
            +VIYFHPNWLAKITDSQQEKVCKHSKCGHVKKLKPTNYSNNFYNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSERTRARRRLCRLVEGYRSLCSCNSLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSVQIHK DKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCLQLSLVQLQSCWYKMSCMLCFESTKVLLIGEPFSSILN
Sbjct:   23 LVIYFHPNWLAKITDSQQEKVCKHSKCGHVKKLKPTNYSNNFYNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSERTRARRRLCRLVEGYRSLCSCNSLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSVQIHKGDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCLQLSLVQLQSCWYKMSCMLCFESTKVLLIGEPFSSILN 616          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000023263.1 (SMESG000023263.1)

HSP 1 Score: 1181.01 bits (3054), Expect = 0.000e+0
Identity = 592/594 (99.66%), Postives = 593/594 (99.83%), Query Frame = 3
Query:  111 VVIYFHPNWLAKITDSQQEKVCKHSKCGHVKKLKPTNYSNNFYNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSVQIHKSDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCXXXXXXXXXXCWYKMSCMLCFESTKVLLIGEPFSSILN 1892
            +VIYFHPNWLAKITDSQQEKVCKHSKCGHVKKLKPTNYSNNFYNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSERTRARRRLCRLVEGYRSLCSCNSLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSVQIHK DKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCLQLSLVQLQSCWYKMSCMLCFESTKVLLIGEPFSSILN
Sbjct:   27 LVIYFHPNWLAKITDSQQEKVCKHSKCGHVKKLKPTNYSNNFYNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSERTRARRRLCRLVEGYRSLCSCNSLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSVQIHKGDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCLQLSLVQLQSCWYKMSCMLCFESTKVLLIGEPFSSILN 620          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000023263.1 (SMESG000023263.1)

HSP 1 Score: 1160.59 bits (3001), Expect = 0.000e+0
Identity = 580/582 (99.66%), Postives = 581/582 (99.83%), Query Frame = 3
Query:  111 VVIYFHPNWLAKITDSQQEKVCKHSKCGHVKKLKPTNYSNNFYNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSEXXXXXXXXXXLVEGYRSLCSCNSLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSVQIHKSDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCXXXXXXXXXXCWYKMSCMLCFESTKV 1856
            +VIYFHPNWLAKITDSQQEKVCKHSKCGHVKKLKPTNYSNNFYNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSERTRARRRLCRLVEGYRSLCSCNSLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSVQIHK DKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCLQLSLVQLQSCWYKMSCMLCFESTKV
Sbjct:   40 LVIYFHPNWLAKITDSQQEKVCKHSKCGHVKKLKPTNYSNNFYNRRIKRYPEKEQIEFQISVCPKKIEMTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHFLKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTVTSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPDSERTRARRRLCRLVEGYRSLCSCNSLDTIPHFANRQNQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVRLQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESFKSVQIHKGDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNTDIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCLQLSLVQLQSCWYKMSCMLCFESTKV 621          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000078301.1 (SMESG000078301.1)

HSP 1 Score: 59.6918 bits (143), Expect = 4.172e-9
Identity = 34/118 (28.81%), Postives = 64/118 (54.24%), Query Frame = 3
Query: 1158 LIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNN---QYFCSETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQ 1502
            L+I+ED++D + D   YF+ T  I+ N  K+F V+A N+   +   +++   + Y +++ P   +M+ R  W+ E+   WPD+     W  + +   I+ +R C+ P + R   FGR+
Sbjct:  231 LLIVEDDLDIAPDFFSYFSATNFILRNDNKLFCVSAWNDNGKKNLVNQSANAQLYRTDFFPGLGWMMLRTFWE-EIREKWPDS----FWDEYLRQPEIRKNRQCIRPEIPRTATFGRK 343          
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Planmine SMEST
Match: SMESG000034058.1 (SMESG000034058.1)

HSP 1 Score: 53.5286 bits (127), Expect = 2.839e-7
Identity = 56/240 (23.33%), Postives = 106/240 (44.17%), Query Frame = 3
Query:  873 NQTYIQIPIAVVSVNDPHYLLRVISSLTSVKGLHPK----NILIFIDQNYEE--SKLIVDLFKLKL-IRVRLQGNIDMPSKNSYKFRTAIANAFRH-------------------FYLAQY-------LIIMEDNVDSSGDLLYYFNQTIDIIGNQTKIFNVAASNNQYFCS---ETFQRETYLSEYMPDTTFMISRKLWQNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRV 1484
            N+  I IP+ V+S N  HYL   ++S+   +  + +       +F+ Q   +  ++ +++ F+ KL   +  + NI   ++N  K   A +    H                   FY + Y       +II ED+++ S D+  YF+    I+ N T +F ++A N+    S    +   + Y +++ P   +M+ +  W  E+   WP    D+  ++ F    IK +R C+ P +SR 
Sbjct:   51 NKKDIIIPVLVLSCNRSHYLNETLNSIFQARSSNEEFGFIKFPVFVSQACSDLLAQSVIESFRKKLWAYISFESNISEITRNLNKINKAYSKISDHYLKALNWVFGFHVETKSVKFYKSLYDFTKHKAVIIFEDDLEVSTDIFKYFSALYPILQNDTSLFCISAWNDYGHLSNVNRSSPEQLYRTDFFPGLGWMMLKSFWM-EVKDEWPIVFWDEFLRLKF----IKQNRQCIRPEISRT 285          
The following BLAST results are available for this feature:
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
POMGNT11.364e-3227.21protein O-linked mannose N-acetylglucosaminyltrans... [more]
POMGNT12.017e-3227.21protein O-linked mannose N-acetylglucosaminyltrans... [more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
M70.42.282e-923.86pep chromosome:WBcel235:IV:2253004:2263660:-1 gene... [more]
M70.42.282e-923.86pep chromosome:WBcel235:IV:2253004:2263704:-1 gene... [more]
gly-136.972e-928.19Putative alpha-1,3-mannosyl-glycoprotein 2-beta-N-... [more]
gly-126.485e-625.76GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
gly-126.485e-625.76GLYcosylation related [Source:UniProtKB/TrEMBL;Ac... [more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mgat16.472e-826.49gene:FBgn0034521 transcript:FBtr0086259[more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pomgnt11.860e-3528.13protein O-linked mannose N-acetylglucosaminyltrans... [more]
pomgnt11.860e-3528.13protein O-linked mannose N-acetylglucosaminyltrans... [more]
pomgnt11.843e-2029.74protein O-linked mannose N-acetylglucosaminyltrans... [more]
mgat1b5.758e-621.08alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglu... [more]
mgat1b5.870e-621.08alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglu... [more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pomgnt11.184e-3428.00protein O-linked mannose N-acetylglucosaminyltrans... [more]
pomgnt11.409e-3428.00protein O-linked mannose N-acetylglucosaminyltrans... [more]
pomgnt15.343e-3328.19protein O-linked mannose N-acetylglucosaminyltrans... [more]
pomgnt11.840e-3027.87protein O-linked mannose N-acetylglucosaminyltrans... [more]
pomgnt12.287e-3025.37protein O-linked mannose N-acetylglucosaminyltrans... [more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pomgnt11.522e-3226.97protein O-linked mannose beta 1,2-N-acetylglucosam... [more]
Pomgnt11.574e-3226.97protein O-linked mannose beta 1,2-N-acetylglucosam... [more]
Pomgnt11.574e-3226.97protein O-linked mannose beta 1,2-N-acetylglucosam... [more]
Pomgnt11.574e-3226.97protein O-linked mannose beta 1,2-N-acetylglucosam... [more]
Pomgnt11.731e-2925.73protein O-linked mannose beta 1,2-N-acetylglucosam... [more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RCB9|PMGT1_PONAB1.019e-3227.16Protein O-linked-mannose beta-1,2-N-acetylglucosam... [more]
sp|Q5EAB6|PMGT1_BOVIN1.863e-3226.36Protein O-linked-mannose beta-1,2-N-acetylglucosam... [more]
sp|Q8WZA1|PMGT1_HUMAN6.553e-3227.21Protein O-linked-mannose beta-1,2-N-acetylglucosam... [more]
sp|Q5XIN7|PMGT1_RAT6.984e-3226.97Protein O-linked-mannose beta-1,2-N-acetylglucosam... [more]
sp|Q91X88|PMGT1_MOUSE1.101e-3126.97Protein O-linked-mannose beta-1,2-N-acetylglucosam... [more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4AMT21.153e-4530.08ILEI domain-containing protein OS=Lottia gigantea ... [more]
R7V1L91.218e-4229.48ILEI domain-containing protein OS=Capitella teleta... [more]
A0A267GSA81.299e-4228.12Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A023EZ294.729e-4125.77Putative n-acetylglucosaminyltransferase i OS=Tria... [more]
A0A0B6ZBY83.970e-4024.52ILEI domain-containing protein (Fragment) OS=Arion... [more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
pomgnt12.969e-1822.32protein O-linked mannose N-acetylglucosaminyltrans... [more]
mgat1a1.319e-725.41alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglu... [more]
mgat1b1.492e-722.05alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglu... [more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO457851.020e-3427.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO458739.611e-3427.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
pomgnt11.812e-3426.48protein O-linked mannose N-acetylglucosaminyltrans... [more]
mgat1b9.877e-922.73alpha-1,3-mannosyl-glycoprotein 2-beta-N-acetylglu... [more]
back to top
BLAST of O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000023263.10.000e+099.66SMESG000023263.1[more]
SMESG000023263.10.000e+099.66SMESG000023263.1[more]
SMESG000023263.10.000e+099.66SMESG000023263.1[more]
SMESG000078301.14.172e-928.81SMESG000078301.1[more]
SMESG000034058.12.839e-723.33SMESG000034058.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023806 ID=SMED30023806|Name=O-linked-mannose beta-1,2-N-acetylglucosaminyltransferase 1-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1965bp
GAAGATAAAATAAATTCGACTGTTGGATAATTTAATGGCAAAATTAGATG
AAATGGTTCAAAAATTGAAATTTCTCTTCTATGTGATTGTGACATCCGTT
TTCTTGAATTGTCGTAATATATTTCCATCCGAATTGGCTCGCAAAAATTA
CCGACAGTCAACAAGAAAAGGTTTGTAAACACTCAAAATGTGGTCATGTT
AAAAAATTGAAACCGACGAATTACAGTAATAATTTTTATAACAGAAGAAT
AAAGAGATACCCGGAGAAAGAACAAATTGAATTCCAAATATCCGTTTGCC
CAAAGAAAATTGAAATGACAATTTCCAATATTCAGCTCATCAATGACAGT
CGGGACGGATTTCACATCTTTGTGTTCAATGAGGCCACGGGTTCATTTAT
GGCTCACTTCTATGATAATGCTAATTCAACAATGGGAAATTGGGCCAAAA
ATGTAGATCACTTTTTAAAATCTATTCAGGACGGTCGAATAATAATAATT
TTACACAAGAATTTTCAAGGTCAGCGTAAAGGAACTAATTTTATTGAGTT
AGGAAAAATTTTACAAATTTACACAAGCAACTTGTTATCGATGAAAAGGG
GAAATTTCACAGTGACATCCTGGATATTATTGGCACATAAAGGAGTTGGG
AAAATAGCCGAACTGTATCAATGGAAAAATATCAAATTTCCCAAAGAGTG
CTTAAGAATGTCAAAGTCTTTAGGTCTTTCTGAAGAAATTGCAATTTGTC
CCAATTGGCCTGATTCCGAGAGAACGAGAGCAAGACGTCGCCTTTGTCGT
TTGGTGGAAGGGTACAGATCCCTTTGTTCATGCAATTCCCTTGACACGAT
TCCTCATTTCGCAAATCGGCAGAATCAGACTTACATTCAGATTCCAATTG
CCGTCGTTAGCGTCAATGATCCTCATTATCTCCTCAGAGTAATTTCTAGT
TTAACTTCGGTGAAAGGACTCCATCCAAAAAATATTCTAATATTCATCGA
CCAAAATTATGAAGAATCCAAGCTAATAGTCGACCTATTCAAACTGAAGT
TAATTCGAGTTCGTCTTCAAGGCAACATTGATATGCCATCAAAGAATTCC
TACAAATTTCGAACAGCAATAGCAAATGCATTTCGGCACTTTTATCTTGC
TCAATATTTGATCATCATGGAGGACAATGTGGATTCCAGTGGAGATCTTC
TGTATTATTTCAATCAAACAATAGACATTATTGGAAATCAGACAAAAATA
TTCAATGTTGCAGCTTCGAATAATCAATATTTTTGTTCCGAAACATTTCA
AAGAGAAACTTATTTAAGTGAATATATGCCTGATACGACATTCATGATCA
GCCGGAAGCTGTGGCAAAATGAATTGAGCCTTTACTGGCCCGACAATTCA
GGGGATAAATCATGGAAAGTATGGTTCCAAGATTTCATGATAAAATCTGA
TAGATTGTGTTTATATCCTCTTGTAAGCAGAGTATTTTATTTTGGACGTC
AGAGAGAATCTTTTAAGTCGGTTCAAATTCACAAAAGTGACAAAACAAAA
TTCCTAAATTATGACTTAAATCCATTATCCACAAGCAGCCATGATGCTTT
CTTAAAGAAGATTTCCGACAAATCACTCGAATGGAATTTGGATAAAATTA
ATTGTTCAAACACAGACATTTTCCGTAATGCGAGAGATTTCAAAAATGAA
TCATCAAATCTCATATTAATAAAAGTGTCAATGTCCTCAAGGGAAGATTC
ATCAAAATGGAATTATTTGAGAAAGTGTCTACAACTATCACTTGTCCAGT
TACAGTCTTGTTGGTACAAGATGTCTTGCATGCTTTGCTTCGAATCTACT
AAGGTGCTTCTAATTGGTGAACCATTCTCTTCAATATTAAATTAAGATGA
ACTCCCAATTTGTTTAAATGTGCCATTCCGATTTCAGAAATAATTATAAT
AATTTCTAATTCTCT
back to top

protein sequence of SMED30023806-orf-1

>SMED30023806-orf-1 ID=SMED30023806-orf-1|Name=SMED30023806-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=527bp
MTISNIQLINDSRDGFHIFVFNEATGSFMAHFYDNANSTMGNWAKNVDHF
LKSIQDGRIIIILHKNFQGQRKGTNFIELGKILQIYTSNLLSMKRGNFTV
TSWILLAHKGVGKIAELYQWKNIKFPKECLRMSKSLGLSEEIAICPNWPD
SERTRARRRLCRLVEGYRSLCSCNSLDTIPHFANRQNQTYIQIPIAVVSV
NDPHYLLRVISSLTSVKGLHPKNILIFIDQNYEESKLIVDLFKLKLIRVR
LQGNIDMPSKNSYKFRTAIANAFRHFYLAQYLIIMEDNVDSSGDLLYYFN
QTIDIIGNQTKIFNVAASNNQYFCSETFQRETYLSEYMPDTTFMISRKLW
QNELSLYWPDNSGDKSWKVWFQDFMIKSDRLCLYPLVSRVFYFGRQRESF
KSVQIHKSDKTKFLNYDLNPLSTSSHDAFLKKISDKSLEWNLDKINCSNT
DIFRNARDFKNESSNLILIKVSMSSREDSSKWNYLRKCLQLSLVQLQSCW
YKMSCMLCFESTKVLLIGEPFSSILN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR029044Nucleotide-diphossugar_trans
IPR004139Glyco_trans_13
Vocabulary: molecular function
TermDefinition
GO:0008375acetylglucosaminyltransferase activity
GO:0016740transferase activity
GO:0016757transferase activity, transferring glycosyl groups
Vocabulary: biological process
TermDefinition
GO:0006486protein glycosylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableTMHMMTMhelixcoord: 13..32