Protein disulfide-isomerase A4

Overview
NameProtein disulfide-isomerase A4
Smed IDSMED30023805
Length (bp)2124
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein disulfide-isomerase A4 (SMED30023805) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein disulfide-isomerase A4 (SMED30023805) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein disulfide-isomerase A4 (SMED30023805) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein disulfide-isomerase A4 (SMED30023805) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023805

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior region of the whole animalSMED30023805SMESG000010656.1 dd_Smed_v4_4906_0_1dd_Smed_v4PMID:27063937
Scimone et al., 2016
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023805SMESG000010656.1 dd_Smed_v4_4906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30023805SMESG000010656.1 dd_Smed_v4_4906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30023805SMESG000010656.1 dd_Smed_v4_4906_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023805SMESG000010656.1 Contig38670newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023805SMESG000010656.1 Contig38670uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30023805SMESG000010656.1 dd_Smed_v4_4906_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Human
Match: PDIA4 (protein disulfide isomerase family A member 4 [Source:HGNC Symbol;Acc:HGNC:30167])

HSP 1 Score: 397.897 bits (1021), Expect = 6.594e-129
Identity = 230/609 (37.77%), Postives = 347/609 (56.98%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQ----NPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXXX-XXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL---KDEL 1967
            + V VLN  NFD F+   + V++EFYAPWCGHCKQ  P Y K A  LK  +PPI + K+DAT  S LASRF +SGYPT+KI K     DY+ SR++  IV  +++V  PDW PP    L LTKENF E+V  +  ILVEF+APWCGHCK LAPE+ KAAK LS  +PPI LA VDAT ETDLAK + VSGYPTLK+F+    + DY+GPR   GIVD+MI   E +      IL  + VQ    +   V+++G+F  E+D  +  + DA N  RED+   ++FS EI      +     G +++++PE  ++ YEP          +     +  F+ K   P+V           ++  ++ L + +++VDFS  ++ AT+ W  K+ ++A ++  +  FAIAD+E  + ++++L L +SGE++N   + E+  K+ M   +EFDS+ +R+F+ +   GK+ P++KS P+PK   ++G +  VVG T+  ++ D   + L+  Y   C  C+ L  + +SL+  + G+       MD + ND+P     + E F PT+ F       +P        +KF G   +   +  FI +++  L   K+EL
Sbjct:   62 NGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPY-DYNGPREKYGIVDYMI---EQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQ----GQLVVMQPEKFQSKYEPRSHMMDVQQGSTQDSAIKDFVLKYALPLVGHRKVSNDA--KRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFP-EYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEP-EEFDSDTLREFVTAFKKGKLKPVIKSQPVPKN--NKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPS-DRYKVEGF-PTIYFAPSGDKKNP--------VKFEGGDRDLEHLSKFIEEHATKLSRTKEEL 646          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Human
Match: PDIA4 (protein disulfide isomerase family A member 4 [Source:HGNC Symbol;Acc:HGNC:30167])

HSP 1 Score: 397.127 bits (1019), Expect = 9.217e-129
Identity = 230/609 (37.77%), Postives = 349/609 (57.31%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQ----NPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXXX-XXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL---KDEL 1967
            + V VLN  NFD F+   + V++EFYAPWCGHCKQ  P Y K A  LK  +PPI + K+DAT  S LASRF +SGYPT+KI K     DY+ SR++  IV  +++V  PDW PP    L LTKENF E+V  +  ILVEF+APWCGHCK LAPE+ KAAK LS  +PPI LA VDAT ETDLAK + VSGYPTLK+F+    + DY+GPR   GIVD+MI   E +      IL  + VQ    +   V+++G+F  E+D  +  + DA N  RED+   ++FS EI      +     G +++++PE  ++ YEP  +    +  +     +  F+ K   P+V           ++  ++ L + +++VDFS  ++ AT+ W  K+ ++A ++  +  FAIAD+E  + ++++L L +SGE++N   + E+  K+ M   +EFDS+ +R+F+ +   GK+ P++KS P+PK   ++G +  VVG T+  ++ D   + L+  Y   C  C+ L  + +SL+  + G+       MD + ND+P     + E F PT+ F       +P        +KF G   +   +  FI +++  L   K+EL
Sbjct:   62 NGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPY-DYNGPREKYGIVDYMI---EQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQ----GQLVVMQPEKFQSKYEPR-SHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDA--KRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFP-EYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEP-EEFDSDTLREFVTAFKKGKLKPVIKSQPVPKN--NKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPS-DRYKVEGF-PTIYFAPSGDKKNP--------VKFEGGDRDLEHLSKFIEEHATKLSRTKEEL 645          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Human
Match: PDIA3 (protein disulfide isomerase family A member 3 [Source:HGNC Symbol;Acc:HGNC:4606])

HSP 1 Score: 172.94 bits (437), Expect = 5.834e-46
Identity = 135/450 (30.00%), Postives = 223/450 (49.56%), Query Frame = 3
Query:  519 VLTLTKENFTEIVE---SSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKD---QIQFAIADDERQSDKLRELRLDDSGEEINVGCI----GENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNF 1832
            VL LT +NF   +    S+G +LVEFFAPWCGHCK LAPE+  AA  L  + P   LA VD T  T+   +Y VSGYPTLK+F++      Y GPR++DGIV  + K    A+  + +  +F+   + +   ++G F        + F+ A +  R+++   ++  + +   YD   D+G G IIL RP +L N +E     +      +T  ++  FI++N+F I       T+   + ++ K L I ++ VD+  + K  +  W  ++  +A  + D   ++ FA+A  +  S +L +  L+ +  EI V  I    GE   K+ M      D + + +FL     G +   LKS PIP++  ++G +  VV + + E++N+   + L+  Y   C  C++L               ++    MD + ND+P  S  E   F PT+ F
Sbjct:   27 VLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASIVGFFDDSFSEAHSEFLKAASNLRDNYRFAHTNVESLVNEYD---DNGEG-IILFRPSHLTNKFEDKTVAYTE--QKMTSGKIKKFIQENIFGICPHM---TEDNKDLIQGKDLLIAYYDVDYEKNAK-GSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTAGEIPVVAIRTAKGE---KFVMQEEFSRDGKALERFLQDYFDGNLKRYLKSEPIPES--NDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVP--SPYEVRGF-PTIYF 455          

HSP 2 Score: 98.9821 bits (245), Expect = 4.855e-21
Identity = 71/194 (36.60%), Postives = 100/194 (51.55%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFIN---ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYD-YDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSG 737
            S+V  L  +NF+  I+   +  +++VEF+APWCGHCK+L P Y  AA +LK   P   L KVD T  +   +++G+SGYPTLKIF+       YD  R+   IV+ +KK   P   P +      T+E F + +      +V FF        S   EF KAA   SNL    + A  +  VE+ L  EY  +G
Sbjct:   25 SDVLELTDDNFESRISDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLR------TEEEFKKFISDKDASIVGFFDDSFSEAHS---EFLKAA---SNLRDNYRFAHTN--VES-LVNEYDDNG 200          

HSP 3 Score: 79.7221 bits (195), Expect = 6.547e-15
Identity = 47/126 (37.30%), Postives = 72/126 (57.14%), Query Frame = 3
Query:  129 GFFKNILGEIPI----DSNVYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIF---KSSIPYDYDDSRSESAIVNFMKK 482
            G  K  L   PI    D  V V+ +ENFDE +N  N  V++EFYAPWCGHCK L P Y +   +L K +P I++ K+DAT  +++ S + + G+PT+      K   P  Y+  R  S  ++++++
Sbjct:  359 GNLKRYLKSEPIPESNDGPVKVVVAENFDEIVNNENKDVLIEFYAPWCGHCKNLEPKYKELGEKLSK-DPNIVIAKMDATA-NDVPSPYEVRGFPTIYFSPANKKLNPKKYEGGRELSDFISYLQR 482          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Human
Match: PDIA6 (protein disulfide isomerase family A member 6 [Source:HGNC Symbol;Acc:HGNC:30168])

HSP 1 Score: 165.622 bits (418), Expect = 5.471e-44
Identity = 97/266 (36.47%), Postives = 144/266 (54.14%), Query Frame = 3
Query:   96 ISILFSACINFGFFKNILGEIPIDSNVYVLNSENFD-EFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKS--SIPYDYDDSRSESAIVN---------------------FMKKVGSPDWQPPKNYVLTLTKENFTE-IVESSGYILVEFFAPWCGHCKSLAPEFAKAA-KILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIV 815
            +++L    ++  FF  + G      +V  L   NF+ E I ++++ +VEFYAPWCGHC++LTP + KAA  LK     + +G VDA     L  ++G+ G+PT+KIF S  + P DY   R+  AIV+                        K G  D    K  V+ LT ++F + +++S    +VEF+APWCGHCK+L PE+A AA ++       ++LA VDATV   LA  Y + G+PT+K+F+     VDY G R+   IV
Sbjct:    1 MALLVLGLVSCTFFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKD---VVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSD-SSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV 262          

HSP 2 Score: 99.3673 bits (246), Expect = 1.989e-21
Identity = 52/117 (44.44%), Postives = 74/117 (63.25%), Query Frame = 3
Query:  171 NVYVLNSENFDE-FINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLK-KNNPPILLGKVDATVESELASRFGISGYPTLKIF-KSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPK 512
            +V  L  ++FD+  +++ ++ MVEFYAPWCGHCK L P +  AA ++K +    + L  VDATV   LASR+GI G+PT+KIF K   P DYD  R+ S IV+    + S +  PP+
Sbjct:  161 DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPE 277          

HSP 3 Score: 92.8189 bits (229), Expect = 2.388e-19
Identity = 46/102 (45.10%), Postives = 64/102 (62.75%), Query Frame = 3
Query:  519 VLTLTKENFT-EIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRSSDGIVD 818
            V+ LT  NF  E+++S    LVEF+APWCGHC+ L PE+ KAA  L ++   +++  VDA     L  +Y V G+PT+K+F  NKN   DY G R+ + IVD
Sbjct:   27 VIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDV---VKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVD 125          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Human
Match: PDIA6 (protein disulfide isomerase family A member 6 [Source:HGNC Symbol;Acc:HGNC:30168])

HSP 1 Score: 163.31 bits (412), Expect = 3.290e-43
Identity = 96/254 (37.80%), Postives = 138/254 (54.33%), Query Frame = 3
Query:  132 FFKNILGEIPIDSNVYVLNSENFD-EFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKS--SIPYDYDDSRSESAIVN---------------------FMKKVGSPDWQPPKNYVLTLTKENFTE-IVESSGYILVEFFAPWCGHCKSLAPEFAKAA-KILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIV 815
            FF  + G      +V  L   NF+ E I ++++ +VEFYAPWCGHC++LTP + KAA  LK     + +G VDA     L  ++G+ G+PT+KIF S  + P DY   R+  AIV+                        K G  D    K  V+ LT ++F + +++S    +VEF+APWCGHCK+L PE+A AA ++       ++LA VDATV   LA  Y + G+PT+K+F+     VDY G R+   IV
Sbjct:   10 FFLAVNGLYSSSDDVIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKD---VVKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRSD-SSSKKDVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIV 259          

HSP 2 Score: 98.9821 bits (245), Expect = 2.258e-21
Identity = 52/117 (44.44%), Postives = 74/117 (63.25%), Query Frame = 3
Query:  171 NVYVLNSENFDE-FINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLK-KNNPPILLGKVDATVESELASRFGISGYPTLKIF-KSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPK 512
            +V  L  ++FD+  +++ ++ MVEFYAPWCGHCK L P +  AA ++K +    + L  VDATV   LASR+GI G+PT+KIF K   P DYD  R+ S IV+    + S +  PP+
Sbjct:  158 DVIELTDDSFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAASEVKEQTKGKVKLAAVDATVNQVLASRYGIRGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPE 274          

HSP 3 Score: 92.8189 bits (229), Expect = 2.418e-19
Identity = 46/102 (45.10%), Postives = 64/102 (62.75%), Query Frame = 3
Query:  519 VLTLTKENFT-EIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRSSDGIVD 818
            V+ LT  NF  E+++S    LVEF+APWCGHC+ L PE+ KAA  L ++   +++  VDA     L  +Y V G+PT+K+F  NKN   DY G R+ + IVD
Sbjct:   24 VIELTPSNFNREVIQSDSLWLVEFYAPWCGHCQRLTPEWKKAATALKDV---VKVGAVDADKHHSLGGQYGVQGFPTIKIFGSNKNRPEDYQGGRTGEAIVD 122          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Celegans
Match: C14B9.2 (Probable protein disulfide-isomerase A4 [Source:UniProtKB/Swiss-Prot;Acc:P34329])

HSP 1 Score: 355.91 bits (912), Expect = 1.434e-113
Identity = 223/613 (36.38%), Postives = 337/613 (54.98%), Query Frame = 3
Query:  162 IDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSI-PYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRL-LYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNY-KDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDS---EHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRN--IXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKN---SKVLKDEL 1967
            +D  V VL  +NFD F+  N  V+V+FYAPWCGHCK L P Y KA+ ++      I L KVDATVE+EL  RF I GYPTLK +K    P DYD  R E+ IV +++    P+++PP   V+TLT ENF + + ++  +LVEF+APWCGHCK LAPE+ KAA+ L      ++L  VDAT+E DL  +Y VSGYPT+K+ +N   F DY+GPR + GI+ +M    + AAK +  + D     +   V ++G F++E+   F  F D+  + RE+F ++   SD      +DA  +D    II+  P    + +EP    +    +  T  ++++F  ++  P+V +     K    +  KK L + ++  DFS+ ++  ++ W  K+  IA  Y KD+ +FA+AD+E  + +L EL L DSG E NV   G +  KY M+  DEFD    E++  F+  I +GK    +KSAP PK      + TVVG  + +++ND   + L+  Y   C  C+S  +  +  + +   +  ++    MD + ND P  S    E F PT+ F      S+P        IK+ G++  E ++K F+ K+   S   KDEL
Sbjct:   34 MDEGVVVLTDKNFDAFLKKNPSVLVKFYAPWCGHCKHLAPEYEKASSKVS-----IPLAKVDATVETELGKRFEIQGYPTLKFWKDGKGPNDYDGGRDEAGIVEWVESRVDPNYKPPPEEVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRRF-DYNGPREAAGIIKYMTDQSKPAAKKLPKLKDVERFMSKDDVTIIGFFATEDSTAFEAFSDSAEMLREEFKTMGHTSDPAAFKKWDAKPND----IIIFYPSLFHSKFEPKSRTYN--KAAATSEDLLAFFREHSAPLVGK--MTKKNAATRYTKKPLVVVYYNADFSVQYREGSEYWRSKVLNIAQKYQKDKYKFAVADEEEFAKELEELGLGDSGLEHNVVVFGYDGKKYPMNP-DEFDGELDENLEAFMKQISSGKAKAHVKSAPAPKDDKGP-VKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDATINDAP--SQFAVEGF-PTIYFAPAGKKSEP--------IKYSGNRDLE-DLKKFMTKHGVKSFQKKDEL 618          

HSP 2 Score: 127.872 bits (320), Expect = 1.507e-30
Identity = 54/112 (48.21%), Postives = 76/112 (67.86%), Query Frame = 3
Query:  159 PIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSP 494
            P    V  L +ENFD+FI+ N +V+VEFYAPWCGHCK+L P Y KAA +LK     + LGKVDAT+E +L +++G+SGYPT+KI ++   +DY+  R  + I+ +M     P
Sbjct:  144 PPPEEVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRRFDYNGPREAAGIIKYMTDQSKP 255          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Celegans
Match: pdi-3 (pep chromosome:WBcel235:I:7015912:7021743:-1 gene:WBGene00003964.1 transcript:H06O01.1.3 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pdi-3)

HSP 1 Score: 202.216 bits (513), Expect = 3.932e-57
Identity = 132/448 (29.46%), Postives = 237/448 (52.90%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGE-EINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDP 1859
            VL  T  NF +++++    LV+F+APWCGHCK +APE+ +AA  L++ +PP+ L  VD T E  +  ++ V G+PTLK+F+N     DY GPR +DGIV +M      ++K + ++ +F         +++G F SE+ L   +++   +  R+ FS  ++ + +I  +  A   D    +++  P+ L N +  D  +F++ + N    ++ +F+   +   V     RT+  L + E+K + I ++ VD+ +     +  W  ++ K+A NYK ++QFA+++ E  S ++    L +  + +  +  I  N+ KY M    EF  +++++F+D +LAG   P +KS PIP       +   VG  +KELI D   + L+  Y   C  C+SL      L+   + + +    MD + ND+PP+   E   F PT+ ++  +  S+P
Sbjct:   22 VLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKELKTVAEFEKFTGGDENVVIGFFESESKLK-DSYLKVADTERDRFSFAHTSNKDI--IKKAGYSD---DVVVFVPKKLHNKF--DTNEFKY-DGNYDTDKIKNFL---VHETVGFAGIRTQGNLFQFEQKPIVIVYYNVDY-VKDPKGSNYWRNRVLKVAQNYKRKVQFAVSNKEEFSSEIETNGLGERKDSDKPIVAILTNEGKYPMD--QEFSVDNLQQFVDEVLAGNAEPYMKSEPIPDE--QGDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDVIIAKMDATANDVPPM--FEVRGF-PTLFWLPKNAKSNP 449          

HSP 2 Score: 117.472 bits (293), Expect = 1.450e-27
Identity = 49/101 (48.51%), Postives = 68/101 (67.33%), Query Frame = 3
Query:  195 NFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIP-YDYDDSRSESAIVNFMKKVGSP 494
            NFD+ I  ++I +V+FYAPWCGHCK++ P Y +AA +L  N+PP+ L KVD T E  +  +FG+ G+PTLKIF++ +P  DYD  R    IV FM+    P
Sbjct:   29 NFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGP 129          

HSP 3 Score: 71.2478 bits (173), Expect = 1.096e-12
Identity = 43/110 (39.09%), Postives = 65/110 (59.09%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFI-NANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL----KIFKSSIPYDYDDSRSESAIVNFMKK 482
             +V V   +NF E I +A+  V++EFYAPWCGHCK L P Y + A +L K +  +++ K+DAT  +++   F + G+PTL    K  KS+ P  Y+  R     V+F+ K
Sbjct:  362 GDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKED--VIIAKMDATA-NDVPPMFEVRGFPTLFWLPKNAKSN-PIPYNGGREVKDFVSFISK 467          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Celegans
Match: pdi-3 (pep chromosome:WBcel235:I:7015912:7020790:-1 gene:WBGene00003964.1 transcript:H06O01.1.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pdi-3)

HSP 1 Score: 202.216 bits (513), Expect = 3.932e-57
Identity = 132/448 (29.46%), Postives = 237/448 (52.90%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGE-EINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDP 1859
            VL  T  NF +++++    LV+F+APWCGHCK +APE+ +AA  L++ +PP+ L  VD T E  +  ++ V G+PTLK+F+N     DY GPR +DGIV +M      ++K + ++ +F         +++G F SE+ L   +++   +  R+ FS  ++ + +I  +  A   D    +++  P+ L N +  D  +F++ + N    ++ +F+   +   V     RT+  L + E+K + I ++ VD+ +     +  W  ++ K+A NYK ++QFA+++ E  S ++    L +  + +  +  I  N+ KY M    EF  +++++F+D +LAG   P +KS PIP       +   VG  +KELI D   + L+  Y   C  C+SL      L+   + + +    MD + ND+PP+   E   F PT+ ++  +  S+P
Sbjct:   22 VLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKELKTVAEFEKFTGGDENVVIGFFESESKLK-DSYLKVADTERDRFSFAHTSNKDI--IKKAGYSD---DVVVFVPKKLHNKF--DTNEFKY-DGNYDTDKIKNFL---VHETVGFAGIRTQGNLFQFEQKPIVIVYYNVDY-VKDPKGSNYWRNRVLKVAQNYKRKVQFAVSNKEEFSSEIETNGLGERKDSDKPIVAILTNEGKYPMD--QEFSVDNLQQFVDEVLAGNAEPYMKSEPIPDE--QGDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDVIIAKMDATANDVPPM--FEVRGF-PTLFWLPKNAKSNP 449          

HSP 2 Score: 117.472 bits (293), Expect = 1.450e-27
Identity = 49/101 (48.51%), Postives = 68/101 (67.33%), Query Frame = 3
Query:  195 NFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIP-YDYDDSRSESAIVNFMKKVGSP 494
            NFD+ I  ++I +V+FYAPWCGHCK++ P Y +AA +L  N+PP+ L KVD T E  +  +FG+ G+PTLKIF++ +P  DYD  R    IV FM+    P
Sbjct:   29 NFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGP 129          

HSP 3 Score: 71.2478 bits (173), Expect = 1.096e-12
Identity = 43/110 (39.09%), Postives = 65/110 (59.09%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFI-NANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL----KIFKSSIPYDYDDSRSESAIVNFMKK 482
             +V V   +NF E I +A+  V++EFYAPWCGHCK L P Y + A +L K +  +++ K+DAT  +++   F + G+PTL    K  KS+ P  Y+  R     V+F+ K
Sbjct:  362 GDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKED--VIIAKMDATA-NDVPPMFEVRGFPTLFWLPKNAKSN-PIPYNGGREVKDFVSFISK 467          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Celegans
Match: pdi-3 (pep chromosome:WBcel235:I:7015912:7020797:-1 gene:WBGene00003964.1 transcript:H06O01.1.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:pdi-3)

HSP 1 Score: 202.216 bits (513), Expect = 3.932e-57
Identity = 132/448 (29.46%), Postives = 237/448 (52.90%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGE-EINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDP 1859
            VL  T  NF +++++    LV+F+APWCGHCK +APE+ +AA  L++ +PP+ L  VD T E  +  ++ V G+PTLK+F+N     DY GPR +DGIV +M      ++K + ++ +F         +++G F SE+ L   +++   +  R+ FS  ++ + +I  +  A   D    +++  P+ L N +  D  +F++ + N    ++ +F+   +   V     RT+  L + E+K + I ++ VD+ +     +  W  ++ K+A NYK ++QFA+++ E  S ++    L +  + +  +  I  N+ KY M    EF  +++++F+D +LAG   P +KS PIP       +   VG  +KELI D   + L+  Y   C  C+SL      L+   + + +    MD + ND+PP+   E   F PT+ ++  +  S+P
Sbjct:   22 VLEYTDGNFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGPSSKELKTVAEFEKFTGGDENVVIGFFESESKLK-DSYLKVADTERDRFSFAHTSNKDI--IKKAGYSD---DVVVFVPKKLHNKF--DTNEFKY-DGNYDTDKIKNFL---VHETVGFAGIRTQGNLFQFEQKPIVIVYYNVDY-VKDPKGSNYWRNRVLKVAQNYKRKVQFAVSNKEEFSSEIETNGLGERKDSDKPIVAILTNEGKYPMD--QEFSVDNLQQFVDEVLAGNAEPYMKSEPIPDE--QGDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKEDVIIAKMDATANDVPPM--FEVRGF-PTLFWLPKNAKSNP 449          

HSP 2 Score: 117.472 bits (293), Expect = 1.450e-27
Identity = 49/101 (48.51%), Postives = 68/101 (67.33%), Query Frame = 3
Query:  195 NFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIP-YDYDDSRSESAIVNFMKKVGSP 494
            NFD+ I  ++I +V+FYAPWCGHCK++ P Y +AA +L  N+PP+ L KVD T E  +  +FG+ G+PTLKIF++ +P  DYD  R    IV FM+    P
Sbjct:   29 NFDDLIQTHDIALVKFYAPWCGHCKKIAPEYERAAPKLASNDPPVALVKVDCTTEKTVCDKFGVKGFPTLKIFRNGVPAQDYDGPRDADGIVKFMRGQSGP 129          

HSP 3 Score: 71.2478 bits (173), Expect = 1.096e-12
Identity = 43/110 (39.09%), Postives = 65/110 (59.09%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFI-NANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL----KIFKSSIPYDYDDSRSESAIVNFMKK 482
             +V V   +NF E I +A+  V++EFYAPWCGHCK L P Y + A +L K +  +++ K+DAT  +++   F + G+PTL    K  KS+ P  Y+  R     V+F+ K
Sbjct:  362 GDVKVAVGKNFKELIMDADKDVLIEFYAPWCGHCKSLAPKYEELAEKLNKED--VIIAKMDATA-NDVPPMFEVRGFPTLFWLPKNAKSN-PIPYNGGREVKDFVSFISK 467          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Celegans
Match: pdi-6 (Protein disulfide-isomerase A6 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q11067])

HSP 1 Score: 147.132 bits (370), Expect = 5.782e-38
Identity = 102/285 (35.79%), Postives = 142/285 (49.82%), Query Frame = 3
Query:   87 MHFISILFSACINFGFFKNILGEIPIDSNVYVLNSENFD-EFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKS--SIPYDYDDSRSESAIVNFM----KKVGSPDW---------------------QPPKNYVLTLTKENFTEIVESSGYI-LVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF---KNKNFFVDYSGPRSSDGIVDWM-IKNREN 842
            M  I +L ++        ++ G      +V  L   NF  + IN+++I +VEFYAPWCGHCK L P Y KAA  LK       +G VD T    +   + + G+PTLKIF +    P DY+  R+  AI + +    KK  S                            N V+ LT  NF ++V +S  I LVEFFAPWCGHCKSL P++  AA   S L   ++L  +DATV T +A ++ + G+PT+K F    + +   DY G R S  IV W   + +EN
Sbjct:    1 MALIKLLLASLA----ITSVCGMYSKKDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKKAASALKGVAK---VGAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQAIADSVLAEAKKAVSARLGGKSSGSSSSGSGSGSGKRGGGGSGNEVVELTDANFEDLVLNSKDIWLVEFFAPWCGHCKSLEPQWKAAA---SELKGKVRLGALDATVHTVVANKFAIRGFPTIKYFAPGSDVSDAQDYDGGRQSSDIVAWASARAQEN 275          

HSP 2 Score: 88.9669 bits (219), Expect = 1.638e-18
Identity = 50/122 (40.98%), Postives = 74/122 (60.66%), Query Frame = 3
Query:  510 KNYVLTLTKENF-TEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSIL 869
            K+ V+ LT+ NF ++++ S    +VEF+APWCGHCKSL PE+ KAA  L  +    ++  VD T    +   Y+V G+PTLK+F  +K    DY+G R++  I D ++     A KAVS+ L
Sbjct:   23 KDDVVELTEANFQSKVINSDDIWIVEFYAPWCGHCKSLVPEYKKAASALKGV---AKVGAVDMTQHQSVGGPYNVQGFPTLKIFGADKKKPTDYNGQRTAQAIADSVL---AEAKKAVSARL 138          

HSP 3 Score: 87.0409 bits (214), Expect = 6.952e-18
Identity = 70/227 (30.84%), Postives = 102/227 (44.93%), Query Frame = 3
Query:  174 VYVLNSENFDEFI-NANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKS----SIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKS------LAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVS--GYPTLKLFK-NKNFFVDYSGPRSSDGI 812
            V  L   NF++ + N+ +I +VEF+APWCGHCK L P +  AA +LK     + LG +DATV + +A++F I G+PT+K F      S   DYD  R  S IV +       +   P+  V     +   E       + +  F P    C+S      LA    ++ K   NL   I    V+   +  L + + V   GYP +      KN +    G    DGI
Sbjct:  166 VVELTDANFEDLVLNSKDIWLVEFFAPWCGHCKSLEPQWKAAASELKGK---VRLGALDATVHTVVANKFAIRGFPTIKYFAPGSDVSDAQDYDGGRQSSDIVAWASARAQENMPAPE--VFEGINQQVVEDACKEKQLCIFAFLPHILDCQSECRNNYLAMLKEQSEKFKKNLWGWIW---VEGAAQPALEESFEVGGFGYPAMTALNFRKNKYAVLKGSFGKDGI 384          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Fly
Match: ERp60 (gene:FBgn0033663 transcript:FBtr0088058)

HSP 1 Score: 192.586 bits (488), Expect = 1.542e-53
Identity = 126/424 (29.72%), Postives = 218/424 (51.42%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDAT-VETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXXXXXMDLSQNDMPP 1787
            VL L  ++F   ++     LV F+APWCGHCK L PE+AKAA+I+ + +PPI+LA VD T    +   +Y VSGYPTLK+F+      DY+GPR + GI  +M      A+K V ++ + +   + +   L G FS  +  L   F+   +  RE +   +  S E  +L      D    I+L+R  +L N +E    KF+  + +    ++ +F+++N   +V     RT+  ++  +   +   +++VD+  + K  T  W  ++ K+A  +  QI FAIA  +    +L E   D  G++  V    E ++KY +   DEF  E+++ F++ +LA ++ P +KS PIP++  +  +   V   + +L+ +   ++L+  Y   C  C+ L  I   L+     + +    MD + ND+PP
Sbjct:   24 VLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGPASKTVRTVAELKKFLDTKDTTLFGYFSDSDSKLAKIFLKFADKNREKYR--FGHSSEKEVLDKQGETD---KIVLIRAPHLSNKFESSSIKFEGSSES----DLSTFVKENFHGLVGH---RTQDSVKDFQNPLITA-YYSVDYQKNPK-GTNYWRNRVLKVAKEFVGQINFAIASKDDFQHELNEYGYDFVGDKPVVLARDEKNLKYALK--DEFSVENLQDFVEKLLANELEPYIKSEPIPESNDAP-VKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIVKMDATANDVPP 430          

HSP 2 Score: 99.3673 bits (246), Expect = 1.226e-21
Identity = 52/123 (42.28%), Postives = 71/123 (57.72%), Query Frame = 3
Query:  144 ILGEIPIDS----NVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDAT-VESELASRFGISGYPTLKIFKS-SIPYDYDDSRSESAIVNFMKKVGSP 494
            +LG I I S    +V  L  ++F   +  +   +V FYAPWCGHCK+L P Y KAA  +K ++PPI L KVD T    E  S++ +SGYPTLKIF+   +  DY+  R  S I  +M+    P
Sbjct:   10 LLGFIAISSGAEQDVLELGDDDFATTLKQHETTLVMFYAPWCGHCKRLKPEYAKAAEIVKDDDPPIKLAKVDCTEAGKETCSKYSVSGYPTLKIFRQDEVSQDYNGPREASGIAKYMRAQVGP 132          

HSP 3 Score: 70.4774 bits (171), Expect = 2.199e-12
Identity = 35/81 (43.21%), Postives = 54/81 (66.67%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEF-INANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL 404
            D+ V V  ++NFD+  IN     ++EFYAPWCGHCK+L+PIY + A +L+  +  I+  K+DAT  +++   F + G+PTL
Sbjct:  363 DAPVKVAVAKNFDDLVINNGKDTLIEFYAPWCGHCKKLSPIYEELAEKLQDEDVAIV--KMDATA-NDVPPEFNVRGFPTL 440          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0346644)

HSP 1 Score: 156.762 bits (395), Expect = 1.125e-40
Identity = 120/404 (29.70%), Postives = 201/404 (49.75%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLF---SSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRP-EYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFR--TKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQF-AIADDERQSDKLRELRLDDSGEEINVGCIG-ENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI 1706
            VL  T +NF +++  + ++LVEF+APWCGHCK+LAPE+AKAA+ L+    PI+LA VDATVE +LA++Y V GYPTLK F++ +  V+YSG R +  I+ W+ K     AK ++S+ D         + ++G F    SE    FT   +A + F    SS    + ++   Y+A  D+G   ++L +P +  ++++E +      LN       +  F +    P++ +++    +K++   ++   L   FF      H     +K+++ + +IA  Y+D I F  I+ DE    ++ E    +  E   +  I  E DM       D+  +E I  FL   L GK+   L S  +P+      +  +V   ++ +  D     L+  Y   C  C+ L  I
Sbjct:   29 VLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGS-PVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSS----NADVIAKYEAK-DNG---VVLFKPFDDKKSVFEGE------LNEE----NLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLL---FFVSREGGH----IEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPI 406          

HSP 2 Score: 125.561 bits (314), Expect = 3.691e-30
Identity = 59/132 (44.70%), Postives = 76/132 (57.58%), Query Frame = 3
Query:  150 GEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENF 545
             E+ ++  V V   +NF + I  N  V+VEFYAPWCGHCK L P Y KAA QL +   PI L KVDATVE ELA ++ + GYPTLK F+S  P +Y   R  + I+ ++ K   P   P K+       E F
Sbjct:   21 AEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGP---PAKDLTSVADAEQF 149          

HSP 3 Score: 73.9442 bits (180), Expect = 1.803e-13
Identity = 43/92 (46.74%), Postives = 61/92 (66.30%), Query Frame = 3
Query:  153 EIPIDSN---VYVLNSENFDEF-INANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFK 416
            E+P D +   V VL S NF+   ++ +  V+VEFYAPWCGHCKQL PIY + A +  K+N  I++ K+D+T  +EL S   IS +PT+K F+
Sbjct:  359 ELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKY-KDNEDIVIAKMDSTA-NELES-IKISSFPTIKYFR 447          

HSP 4 Score: 69.3218 bits (168), Expect = 4.963e-12
Identity = 44/119 (36.97%), Postives = 67/119 (56.30%), Query Frame = 3
Query:  495 DWQPPKNYVLTLTKENFTEI-VESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRSSDGIVDWMIKNRENA 845
            DW   KN V  L   NF  + ++ S  +LVEF+APWCGHCK LAP + + A+   + N  I +A +D+T   +  +   +S +PT+K F K  N  +D++  R+ D  V ++  N E A
Sbjct:  363 DWD--KNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKD-NEDIVIAKMDST--ANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVA 476          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Fly
Match: Pdi (gene:FBgn0286818 transcript:FBtr0075648)

HSP 1 Score: 156.762 bits (395), Expect = 1.125e-40
Identity = 120/404 (29.70%), Postives = 201/404 (49.75%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLF---SSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRP-EYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFR--TKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQF-AIADDERQSDKLRELRLDDSGEEINVGCIG-ENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI 1706
            VL  T +NF +++  + ++LVEF+APWCGHCK+LAPE+AKAA+ L+    PI+LA VDATVE +LA++Y V GYPTLK F++ +  V+YSG R +  I+ W+ K     AK ++S+ D         + ++G F    SE    FT   +A + F    SS    + ++   Y+A  D+G   ++L +P +  ++++E +      LN       +  F +    P++ +++    +K++   ++   L   FF      H     +K+++ + +IA  Y+D I F  I+ DE    ++ E    +  E   +  I  E DM       D+  +E I  FL   L GK+   L S  +P+      +  +V   ++ +  D     L+  Y   C  C+ L  I
Sbjct:   29 VLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGS-PVEYSGGRQAADIIAWVTKKTGPPAKDLTSVADAEQFLKDNEIAIIGFFKDLESEEAKTFTKVANALDSFVFGVSS----NADVIAKYEAK-DNG---VVLFKPFDDKKSVFEGE------LNEE----NLKKFAQVQSLPLIVDFNHESASKIFGGSIKSHLL---FFVSREGGH----IEKYVDPLKEIAKKYRDDILFVTISSDEEDHTRIFEFFGMNKEEVPTIRLIKLEEDMAKYKPESDDLSAETIEAFLKKFLDGKLKQHLLSQELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPI 406          

HSP 2 Score: 125.561 bits (314), Expect = 3.691e-30
Identity = 59/132 (44.70%), Postives = 76/132 (57.58%), Query Frame = 3
Query:  150 GEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENF 545
             E+ ++  V V   +NF + I  N  V+VEFYAPWCGHCK L P Y KAA QL +   PI L KVDATVE ELA ++ + GYPTLK F+S  P +Y   R  + I+ ++ K   P   P K+       E F
Sbjct:   21 AEVKVEEGVLVATVDNFKQLIADNEFVLVEFYAPWCGHCKALAPEYAKAAQQLAEKESPIKLAKVDATVEGELAEQYAVRGYPTLKFFRSGSPVEYSGGRQAADIIAWVTKKTGP---PAKDLTSVADAEQF 149          

HSP 3 Score: 73.9442 bits (180), Expect = 1.803e-13
Identity = 43/92 (46.74%), Postives = 61/92 (66.30%), Query Frame = 3
Query:  153 EIPIDSN---VYVLNSENFDEF-INANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFK 416
            E+P D +   V VL S NF+   ++ +  V+VEFYAPWCGHCKQL PIY + A +  K+N  I++ K+D+T  +EL S   IS +PT+K F+
Sbjct:  359 ELPEDWDKNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKY-KDNEDIVIAKMDSTA-NELES-IKISSFPTIKYFR 447          

HSP 4 Score: 69.3218 bits (168), Expect = 4.963e-12
Identity = 44/119 (36.97%), Postives = 67/119 (56.30%), Query Frame = 3
Query:  495 DWQPPKNYVLTLTKENFTEI-VESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRSSDGIVDWMIKNRENA 845
            DW   KN V  L   NF  + ++ S  +LVEF+APWCGHCK LAP + + A+   + N  I +A +D+T   +  +   +S +PT+K F K  N  +D++  R+ D  V ++  N E A
Sbjct:  363 DWD--KNPVKVLVSSNFESVALDKSKSVLVEFYAPWCGHCKQLAPIYDQLAEKYKD-NEDIVIAKMDST--ANELESIKISSFPTIKYFRKEDNKVIDFNLDRTLDDFVKFLDANGEVA 476          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Fly
Match: CaBP1 (gene:FBgn0025678 transcript:FBtr0345544)

HSP 1 Score: 154.836 bits (390), Expect = 1.466e-40
Identity = 94/241 (39.00%), Postives = 131/241 (54.36%), Query Frame = 3
Query:  171 NVYVLNSENFD-EFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSS--IPYDYDDSRS----------------ESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYI-LVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF----KNKNFFVDYSGPRSSDGIVDW 821
             V  L   NFD E +  + I +VEFYAPWCGHC+ L P Y K A  LK     + +G V+A  +S L+ +FG+ G+PT+KIF ++   P DY+  R+                +  +                + V+ LT++NF ++V +S  I LVEFFAPWCGHCK+LAPE+AKAAK    L   ++L  +DAT     A EY+V GYPT+K F    K  +   +Y G R++  IV W
Sbjct:   26 GVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKG---VVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAK---ELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSW 260          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Fly
Match: CaBP1 (gene:FBgn0025678 transcript:FBtr0080837)

HSP 1 Score: 154.836 bits (390), Expect = 1.466e-40
Identity = 94/241 (39.00%), Postives = 131/241 (54.36%), Query Frame = 3
Query:  171 NVYVLNSENFD-EFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSS--IPYDYDDSRS----------------ESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYI-LVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF----KNKNFFVDYSGPRSSDGIVDW 821
             V  L   NFD E +  + I +VEFYAPWCGHC+ L P Y K A  LK     + +G V+A  +S L+ +FG+ G+PT+KIF ++   P DY+  R+                +  +                + V+ LT++NF ++V +S  I LVEFFAPWCGHCK+LAPE+AKAAK    L   ++L  +DAT     A EY+V GYPT+K F    K  +   +Y G R++  IV W
Sbjct:   26 GVVELTPSNFDREVLKDDAIWVVEFYAPWCGHCQSLVPEYKKLAKALKG---VVKVGSVNADADSTLSGQFGVRGFPTIKIFGANKKSPTDYNGQRTAKAIAEAALAEVKKKVQGVLGGGGGSSSGGSGSSSGDDVIELTEDNFDKLVLNSDDIWLVEFFAPWCGHCKNLAPEWAKAAK---ELKGKVKLGALDATAHQSKAAEYNVRGYPTIKFFPAGSKRASDAQEYDGGRTASDIVSW 260          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Zebrafish
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 427.557 bits (1098), Expect = 1.268e-140
Identity = 245/607 (40.36%), Postives = 360/607 (59.31%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL---KDEL 1967
            ++ V VL   NFD FI   + V+VEFYAPWCGHCKQ  P Y K A  LK+N+PPI + KVDAT  S L SRF +SGYPT+KI K   P DYD  RSE AIV  +K+V  PDW+PP    L LTK+NF ++V ++  ILVEF+APWCGHCK LAPE+ KAAK LSN  PPI LA VDAT E+DLA  + VSGYPTLK+F+    F DY+GPR   GIVD+M       +K V ++   +  +++    +++G+FSS+ D  +  + +A N  RED+  +++F++++     A+     G +++L+PE  R+ YE        +  +    EV  F +K++ P+V     +     ++  K+ L + ++ VDFS  ++ AT+ W  K+ ++A ++  +  FAIAD+E  +D+L+ L L +SGEE+NVG +GE   KY M   +EFDS+ +R F+ +   GK+ PI+KS P+PK   ++G +  VVG T+ E++ D   + L+  Y   C  C+ L  + +S      + K+L    MD + ND+P  S  + E F PT+ F   +   +P        IKF G + +  E   F+ K++  L   KDEL
Sbjct:   58 ENGVLVLTDANFDTFIEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLKENDPPIPVAKVDATKASGLGSRFEVSGYPTIKILKKGEPLDYDGDRSEHAIVERVKEVAQPDWKPPPEATLVLTKDNFDDVVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPIPLAKVDATAESDLATRFGVSGYPTLKIFRKGKAF-DYNGPREKFGIVDYMSDQAGPPSKQVQTLKQVQELLRDGDDAVIVGVFSSDEDAAYEIYQEACNSLREDYKFMHTFNNDVTKFLKASP----GQVVMLQPEKFRSKYESASHSLT-IKDSTPASEVQDFFKKHILPLVGHR--KQSNDAKRYTKRPLVVVYYGVDFSFDYRVATQFWRSKVLEVAKDFP-EYTFAIADEEDYADELKSLGLSESGEEVNVGIVGEGGKKYAMEP-EEFDSDVLRSFVMAFKKGKLKPIVKSQPLPKN--NKGPVKVVVGKTFDEIVMDSKKDVLIEFYAPWCGHCKKLEPDYISLGKKYKNEKNLVIAKMDATANDVPHDS-YKVEGF-PTIYFAPSNNKQNP--------IKFEGGKRDVEEFSKFVEKHATKLSHKKDEL 642          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Zebrafish
Match: pdia8 (protein disulfide isomerase family A, member 8 [Source:ZFIN;Acc:ZDB-GENE-040801-20])

HSP 1 Score: 183.341 bits (464), Expect = 5.889e-50
Identity = 144/483 (29.81%), Postives = 227/483 (47.00%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ-IQFAIADDERQSDKLRE---LRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGIT-TVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSK 1949
            VL LT  +F  +      +LV+F+APWCGHCK LAPEF  AA   S L   + LA VD T  T++ K Y V+GYPTLK+F+N +    Y GPRS+DGIVD+M K     +  + S LD     N     ++GLFS  +      F+   +L RE F   ++   ++   Y    +    SI+L R   L + +E       H  S ++   +  FI  N+F +       TK   E L K+ L   ++ +D+ +H+   +  W  ++ K+A  +  Q + F++A+     ++L E   L   D  E   V        KY M      D + +  FL+   AG++   +KS P+P   ++ G+   VV DT++E++ND   + L+  Y   C  C+ L     +     +S  ++    MD + ND+P  +G + + F PT+ F      S+P      + +K   + L     K  IL   K
Sbjct:   28 VLKLTDADFDYLAPEHETLLVKFYAPWCGHCKKLAPEFESAA---SRLKGTVTLAKVDCTANTEICKHYGVNGYPTLKIFRNGHESSSYDGPRSADGIVDYMKKQAGPDSVLLHSELDLEKFINHFDASVVGLFSGTDSSQLAEFLKGASLMRESFRFAHTTDLQLGQKYGVTHE----SILLFRAPRLSSKFEESVV--PHTGS-LSVTGLRRFIRDNIFGLCPHM---TKDNKEVLRKRDLLTAYYDLDY-LHNPKGSNYWRNRVLKVATKFSSQGMLFSVANRNDFMEELEEEFGLSASDGNELPFVTIRTRTGDKYSMREEFTRDGKSLESFLEDYFAGRLKRYVKSEPVP--AINNGVVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTALGEMLYSDPNIVIAKMDATVNDVP--AGYDVQGF-PTIYFAAAGRKSEPKRYEGAREVKDFVNFLKREATKPLILNGVK 491          

HSP 2 Score: 100.523 bits (249), Expect = 8.594e-22
Identity = 48/111 (43.24%), Postives = 67/111 (60.36%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSI-PYDYDDSRSESAIVNFMKKVGSPD 497
            S+V  L   +FD     +  ++V+FYAPWCGHCK+L P +  AA +LK     + L KVD T  +E+   +G++GYPTLKIF++      YD  RS   IV++MKK   PD
Sbjct:   26 SDVLKLTDADFDYLAPEHETLLVKFYAPWCGHCKKLAPEFESAASRLKGT---VTLAKVDCTANTEICKHYGVNGYPTLKIFRNGHESSSYDGPRSADGIVDYMKKQAGPD 133          

HSP 3 Score: 77.0258 bits (188), Expect = 2.872e-14
Identity = 40/107 (37.38%), Postives = 68/107 (63.55%), Query Frame = 3
Query:  174 VYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL---KIFKSSIPYDYDDSRSESAIVNFMKK 482
            V V+ ++ F+E +N     V++EFYAPWCGHCK+L P YT A  ++  ++P I++ K+DATV +++ + + + G+PT+      + S P  Y+ +R     VNF+K+
Sbjct:  375 VKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYT-ALGEMLYSDPNIVIAKMDATV-NDVPAGYDVQGFPTIYFAAAGRKSEPKRYEGAREVKDFVNFLKR 479          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Zebrafish
Match: pdia8 (protein disulfide isomerase family A, member 8 [Source:ZFIN;Acc:ZDB-GENE-040801-20])

HSP 1 Score: 183.341 bits (464), Expect = 5.889e-50
Identity = 144/483 (29.81%), Postives = 227/483 (47.00%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ-IQFAIADDERQSDKLRE---LRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGIT-TVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSK 1949
            VL LT  +F  +      +LV+F+APWCGHCK LAPEF  AA   S L   + LA VD T  T++ K Y V+GYPTLK+F+N +    Y GPRS+DGIVD+M K     +  + S LD     N     ++GLFS  +      F+   +L RE F   ++   ++   Y    +    SI+L R   L + +E       H  S ++   +  FI  N+F +       TK   E L K+ L   ++ +D+ +H+   +  W  ++ K+A  +  Q + F++A+     ++L E   L   D  E   V        KY M      D + +  FL+   AG++   +KS P+P   ++ G+   VV DT++E++ND   + L+  Y   C  C+ L     +     +S  ++    MD + ND+P  +G + + F PT+ F      S+P      + +K   + L     K  IL   K
Sbjct:   28 VLKLTDADFDYLAPEHETLLVKFYAPWCGHCKKLAPEFESAA---SRLKGTVTLAKVDCTANTEICKHYGVNGYPTLKIFRNGHESSSYDGPRSADGIVDYMKKQAGPDSVLLHSELDLEKFINHFDASVVGLFSGTDSSQLAEFLKGASLMRESFRFAHTTDLQLGQKYGVTHE----SILLFRAPRLSSKFEESVV--PHTGS-LSVTGLRRFIRDNIFGLCPHM---TKDNKEVLRKRDLLTAYYDLDY-LHNPKGSNYWRNRVLKVATKFSSQGMLFSVANRNDFMEELEEEFGLSASDGNELPFVTIRTRTGDKYSMREEFTRDGKSLESFLEDYFAGRLKRYVKSEPVP--AINNGVVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTALGEMLYSDPNIVIAKMDATVNDVP--AGYDVQGF-PTIYFAAAGRKSEPKRYEGAREVKDFVNFLKREATKPLILNGVK 491          

HSP 2 Score: 100.523 bits (249), Expect = 8.594e-22
Identity = 48/111 (43.24%), Postives = 67/111 (60.36%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSI-PYDYDDSRSESAIVNFMKKVGSPD 497
            S+V  L   +FD     +  ++V+FYAPWCGHCK+L P +  AA +LK     + L KVD T  +E+   +G++GYPTLKIF++      YD  RS   IV++MKK   PD
Sbjct:   26 SDVLKLTDADFDYLAPEHETLLVKFYAPWCGHCKKLAPEFESAASRLKGT---VTLAKVDCTANTEICKHYGVNGYPTLKIFRNGHESSSYDGPRSADGIVDYMKKQAGPD 133          

HSP 3 Score: 77.0258 bits (188), Expect = 2.872e-14
Identity = 40/107 (37.38%), Postives = 68/107 (63.55%), Query Frame = 3
Query:  174 VYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL---KIFKSSIPYDYDDSRSESAIVNFMKK 482
            V V+ ++ F+E +N     V++EFYAPWCGHCK+L P YT A  ++  ++P I++ K+DATV +++ + + + G+PT+      + S P  Y+ +R     VNF+K+
Sbjct:  375 VKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYT-ALGEMLYSDPNIVIAKMDATV-NDVPAGYDVQGFPTIYFAAAGRKSEPKRYEGAREVKDFVNFLKR 479          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Zebrafish
Match: pdia3 (protein disulfide isomerase family A, member 3 [Source:ZFIN;Acc:ZDB-GENE-031002-9])

HSP 1 Score: 173.711 bits (439), Expect = 6.216e-47
Identity = 131/426 (30.75%), Postives = 203/426 (47.65%), Query Frame = 3
Query:  573 ILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ---IQFAIADDERQSDKLRELRLDDSGEEIN-VGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPP---ISGLEYERFQPT 1823
            ILVEFFAPWCGHCK LAPE+  AA  L  + P   LA VD T  + +  +Y VSGYPTLK+F++      Y GPR++DGIV  + K    A+  + +  DF      +   ++G F+         F+ A +  RE +   ++ ++   LL    + DG G IIL R   L N +E     F       T  ++  FI+ N+F I A     T+   ++L+ K L + ++ VD+  + K  +  W  ++ K+A  + DQ   + FA+A+  R S  + EL LD S  E+  VG       KY M      D + + +FL     G +   LKS P+P+   ++G +  +V + +  ++ND   + L+  Y   C  C+SL               ++    MD + ND+P    +SG     F P 
Sbjct:    3 ILVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANSKVCGKYGVSGYPTLKIFRDGEDSGGYDGPRTADGIVSHLKKQAGPASVELKNEADFEKYIGDRDASVVGFFADGGSAAQGEFLKAASALRESYR--FAHTNNEDLLKKHGI-DGEG-IILFRSPQLSNKFEDSSVLFTE--DKFTSAKIKKFIQDNIFGICAHM---TEDNKDQLKGKDLLVAYYDVDYEKNPK-GSNYWRNRVMKVAKGFLDQGKKLSFAVANKNRFSHDVSELGLDGSSGELPLVGIRTAKGDKYVMKEEFSRDGKALERFLQDYFDGNLKRYLKSEPVPEN--NDGPVKVLVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKLSEDPNIVIAKMDATANDVPSPYEVSGFPTIYFSPA 413          

HSP 2 Score: 95.1301 bits (235), Expect = 3.256e-20
Identity = 63/173 (36.42%), Postives = 89/173 (51.45%), Query Frame = 3
Query:  222 NIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFK-SSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSG 737
            ++++VEF+APWCGHCK+L P Y  AA +LK   P   L KVD T  S++  ++G+SGYPTLKIF+       YD  R+   IV+ +KK   P     KN      + +F + +      +V FFA      +    EF KAA   S L    + A    T   DL K++ + G
Sbjct:    1 DLILVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANSKVCGKYGVSGYPTLKIFRDGEDSGGYDGPRTADGIVSHLKKQAGPASVELKN------EADFEKYIGDRDASVVGFFADGGSAAQG---EFLKAA---SALRESYRFAH---TNNEDLLKKHGIDG 155          

HSP 3 Score: 78.1814 bits (191), Expect = 9.586e-15
Identity = 45/126 (35.71%), Postives = 73/126 (57.94%), Query Frame = 3
Query:  129 GFFKNILGEIPI----DSNVYVLNSENFDEFINANNI-VMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL---KIFKSSIPYDYDDSRSESAIVNFMKK 482
            G  K  L   P+    D  V VL +ENFD  +N ++  V++EFYAPWCGHCK L P Y +   +L + +P I++ K+DAT  +++ S + +SG+PT+      +   P  Y+  R  S  ++++K+
Sbjct:  314 GNLKRYLKSEPVPENNDGPVKVLVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKLSE-DPNIVIAKMDATA-NDVPSPYEVSGFPTIYFSPAGRKQNPKKYEGGREVSDFISYLKR 437          

HSP 4 Score: 71.633 bits (174), Expect = 1.134e-12
Identity = 37/78 (47.44%), Postives = 51/78 (65.38%), Query Frame = 3
Query:  519 VLTLTKENFTEIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTL 749
            V  L  ENF  IV + S  +L+EF+APWCGHCKSL P++ +  + LS  +P I +A +DAT   D+   Y VSG+PT+
Sbjct:  333 VKVLVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKLSE-DPNIVIAKMDATA-NDVPSPYEVSGFPTI 408          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Zebrafish
Match: pdia7 (protein disulfide isomerase family A, member 7 [Source:ZFIN;Acc:ZDB-GENE-040426-2238])

HSP 1 Score: 174.481 bits (441), Expect = 6.542e-47
Identity = 126/464 (27.16%), Postives = 217/464 (46.77%), Query Frame = 3
Query:  498 WQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKF-QHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ-IQFAIADDERQSDKLRE---LRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPP---ISGLEYERFQPTVNFIMDSTDSDP 1859
            W    + VL L   +F         +LVEFFAPWCGHC+ LAPE+  AA   + L   + LA VD TV ++  + + V+GYPTLK+F+N      Y GPR++DGIV +M K    ++ A+    D     +     ++G FS E+      F+ A++  R+ +   +S      L Y  + +     ++L RP  L + +E +  K+ +HL+ +     +  F++ N+  +        +   + + +  L   FF VD+ + +   T  W  +I K+A  ++D+ + FA+AD +   D+L E   +   + G+   V        KY M      D + + KFL+   A ++   +KS PIP++  ++G +  +V DT+  ++ND   + L+  Y   C  C++L               ++    MD + ND+PP   + G       PT+ F+       P
Sbjct:   15 WLVEGSDVLELGDSDFDRSAGMHDTLLVEFFAPWCGHCQRLAPEYEAAA---TKLKGTLALAKVDCTVNSETCERFGVNGYPTLKIFRNGEESGAYDGPRTADGIVSYMKKQAGPSSVALLKEADLDGFVDNYEASVVGFFSGEDSAQLAEFLKASSALRDSYRFAHSTDVGAGLKYGVDGE----CVLLFRPPRLSSKFEDNVVKYTEHLSVS----SLHKFVKDNILGLCPHMTMENR---DTVRESDLLTAFFNVDY-LRNPKGTNYWRNRIMKVATQFQDRGLTFAVADRQEFQDELEEEFGVSSSEGGDVPLVTIRTRAGQKYSMQEEFTRDGKSLEKFLEDYFAKRLKRYVKSEPIPES--NDGPVKVLVADTFDAIVNDPEKDVLVEFYAPWCGHCKNLEPKYKELGEKLSGNPNIVIAKMDATANDVPPNYDVQGF------PTIYFVPSGQKDQP 455          

HSP 2 Score: 107.071 bits (266), Expect = 6.642e-24
Identity = 62/165 (37.58%), Postives = 90/165 (54.55%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYD-YDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSN 659
            S+V  L   +FD     ++ ++VEF+APWCGHC++L P Y  AA +LK     + L KVD TV SE   RFG++GYPTLKIF++      YD  R+   IV++MKK   P      + V  L + +    V++    +V FF+   G   +   EF KA+  L +
Sbjct:   20 SDVLELGDSDFDRSAGMHDTLLVEFFAPWCGHCQRLAPEYEAAATKLKGT---LALAKVDCTVNSETCERFGVNGYPTLKIFRNGEESGAYDGPRTADGIVSYMKKQAGP------SSVALLKEADLDGFVDNYEASVVGFFS---GEDSAQLAEFLKASSALRD 172          

HSP 3 Score: 73.559 bits (179), Expect = 3.203e-13
Identity = 40/110 (36.36%), Postives = 61/110 (55.45%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSS---IPYDYDDSRSESAIVNFMKK 482
            D  V VL ++ FD  +N     V+VEFYAPWCGHCK L P Y +   +L   NP I++ K+DAT  +++   + + G+PT+    S     P  Y+  R  +  + ++KK
Sbjct:  366 DGPVKVLVADTFDAIVNDPEKDVLVEFYAPWCGHCKNLEPKYKELGEKL-SGNPNIVIAKMDATA-NDVPPNYDVQGFPTIYFVPSGQKDQPRRYEGGREVNDFITYLKK 473          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Xenopus
Match: chst13 (carbohydrate (chondroitin 4) sulfotransferase 13 [Source:Xenbase;Acc:XB-GENE-945720])

HSP 1 Score: 394.045 bits (1011), Expect = 6.961e-128
Identity = 229/612 (37.42%), Postives = 353/612 (57.68%), Query Frame = 3
Query:  153 EIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXX-XXXXXXXXXXXXXXMDLSQNDMPPISGLEY--ERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL--KDEL 1967
            E+  ++ V VL  +NFD FI   +IV++EFYAPWCGHCKQ  P Y K A  L +N+PPI + K+DAT  +++A R+ ISGYPT+KI K   P DYD +R++ AIV  +K++  PDW+PP    + LTK+NF E+V  +  ILVEF+APWCGHCK LAPE+ KAA+ LS  +PPI LA VDATVE+ L  +Y V+G+PTLK+F+    F DY+GPR   GIVD+M +     +K + ++       ++   V +LG+FS E D  +  + DA N  RED+   ++FS EI      +     G +++++PE  ++ YE           + T  ++   I ++  P+V     +     ++  K+ + + +++VDF   ++TAT+ W  KI ++A ++  +  FAIA+++  + +L++L L DSGEE+NV     +  KY     +EFDS+ +R+F+ +   GK+ PI+KS P+PK   ++G +  VVG T+ +++ D   + L+  Y   C  C+SL  I +       S + L    MD + ND   I+  +Y  E F PT+ F   +   +P        IKF G   +   +  FI ++S  L  KDEL
Sbjct:   45 EVKDENGVLVLTDKNFDTFITDKDIVLLEFYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEATDVAGRYDISGYPTIKILKKGQPIDYDGARTQEAIVTKVKEIAQPDWKPPPEATIVLTKDNFDEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFRKGKVF-DYNGPREKYGIVDYMTEQAGPPSKQIQAVKQVHEFFRDGDDVGILGVFSDEKDRAYHLYQDAANNLREDYKFYHTFSSEIFNFLKVSP----GQLVVMQPEKFQSKYE----------DSTTAADIKQHISEHSLPLVGHR--KNSNEAKRYSKRPIVVVYYSVDFGFDYRTATQYWRSKILEVAKDFS-EYTFAIANEDDYATELKDLGLSDSGEEVNVAIFDASGKKYAKEP-EEFDSDGLREFVMAFKKGKLTPIIKSQPVPKN--NKGPVKVVVGKTFDQIVMDPKSDVLIEFYAPWCGHCKSLEPIYNDLGKKYRSAEGLIIAKMDATAND---ITSDKYKAEGF-PTIYFAPRNNKQNP--------IKFSGGNRDLESLSKFIEEHSVNLKKKDEL 623          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Xenopus
Match: chst13 (carbohydrate (chondroitin 4) sulfotransferase 13 [Source:Xenbase;Acc:XB-GENE-945720])

HSP 1 Score: 393.66 bits (1010), Expect = 9.026e-128
Identity = 228/612 (37.25%), Postives = 352/612 (57.52%), Query Frame = 3
Query:  153 EIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXX-XXXMDLSQNDMPPISGLEY--ERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL--KDEL 1967
            E+  ++ V VL  +NFD FI   +IV++EFYAPWCGHCKQ  P Y K A  L +N+PPI + K+DAT  +++A R+ ISGYPT+KI K   P DYD +R++ AIV  +K++  PDW+PP    + LTK+NF E+V  +  ILVEF+APWCGHCK LAPE+ KAA+ LS  +PPI LA VDATVE+ L  +Y V+G+PTLK+F+    F DY+GPR   GIVD+M +     +K + ++       ++   V +LG+FS E D  +  + DA N  RED+   ++FS EI      +     G +++++PE  ++ YE           + T  ++   I ++  P+V     +     ++  K+ + + +++VDF   ++TAT+ W  KI ++A ++  +  FAIA+++  + +L++L L DSGEE+NV     +  KY     +EFDS+ +R+F+ +   GK+ PI+KS P+PK   ++G +  VVG T+ +++ D   + L+  Y   C  C+SL  I + L   +          MD + ND   I+  +Y  E F PT+ F   +   +P        IKF G   +   +  FI ++S  L  KDEL
Sbjct:   23 EVKDENGVLVLTDKNFDTFITDKDIVLLEFYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEATDVAGRYDISGYPTIKILKKGQPIDYDGARTQEAIVTKVKEIAQPDWKPPPEATIVLTKDNFDEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFRKGKVF-DYNGPREKYGIVDYMTEQAGPPSKQIQAVKQVHEFFRDGDDVGILGVFSDEKDRAYHLYQDAANNLREDYKFYHTFSSEIFNFLKVSP----GQLVVMQPEKFQSKYEAK-KYILSFKDSTTAADIKQHISEHSLPLVGHR--KNSNEAKRYSKRPIVVVYYSVDFGFDYRTATQYWRSKILEVAKDFS-EYTFAIANEDDYATELKDLGLSDSGEEVNVAIFDASGKKYAKEP-EEFDSDGLREFVMAFKKGKLTPIIKSQPVPKN--NKGPVKVVVGKTFDQIVMDPKSDVLIEFYAPWCGHCKSLEPIYNDLGKKYRSAEGLIIAKMDATAND---ITSDKYKAEGF-PTIYFAPRNNKQNP--------IKFSGGNRDLESLSKFIEEHSVNLKKKDEL 610          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Xenopus
Match: chst13 (carbohydrate (chondroitin 4) sulfotransferase 13 [Source:Xenbase;Acc:XB-GENE-945720])

HSP 1 Score: 392.889 bits (1008), Expect = 1.550e-127
Identity = 228/612 (37.25%), Postives = 352/612 (57.52%), Query Frame = 3
Query:  153 EIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXX-XXXMDLSQNDMPPISGLEY--ERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL--KDEL 1967
            E+  ++ V VL  +NFD FI   +IV++EFYAPWCGHCKQ  P Y K A  L +N+PPI + K+DAT  +++A R+ ISGYPT+KI K   P DYD +R++ AIV  +K++  PDW+PP    + LTK+NF E+V  +  ILVEF+APWCGHCK LAPE+ KAA+ LS  +PPI LA VDATVE+ L  +Y V+G+PTLK+F+    F DY+GPR   GIVD+M +     +K + ++       ++   V +LG+FS E D  +  + DA N  RED+   ++FS EI      +     G +++++PE  ++ YE           + T  ++   I ++  P+V     +     ++  K+ + + +++VDF   ++TAT+ W  KI ++A ++  +  FAIA+++  + +L++L L DSGEE+NV     +  KY     +EFDS+ +R+F+ +   GK+ PI+KS P+PK   ++G +  VVG T+ +++ D   + L+  Y   C  C+SL  I + L   +          MD + ND   I+  +Y  E F PT+ F   +   +P        IKF G   +   +  FI ++S  L  KDEL
Sbjct:   25 EVKDENGVLVLTDKNFDTFITDKDIVLLEFYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEATDVAGRYDISGYPTIKILKKGQPIDYDGARTQEAIVTKVKEIAQPDWKPPPEATIVLTKDNFDEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFRKGKVF-DYNGPREKYGIVDYMTEQAGPPSKQIQAVKQVHEFFRDGDDVGILGVFSDEKDRAYHLYQDAANNLREDYKFYHTFSSEIFNFLKVSP----GQLVVMQPEKFQSKYEAK-KYILSFKDSTTAADIKQHISEHSLPLVGHR--KNSNEAKRYSKRPIVVVYYSVDFGFDYRTATQYWRSKILEVAKDFS-EYTFAIANEDDYATELKDLGLSDSGEEVNVAIFDASGKKYAKEP-EEFDSDGLREFVMAFKKGKLTPIIKSQPVPKN--NKGPVKVVVGKTFDQIVMDPKSDVLIEFYAPWCGHCKSLEPIYNDLGKKYRSAEGLIIAKMDATAND---ITSDKYKAEGF-PTIYFAPRNNKQNP--------IKFSGGNRDLESLSKFIEEHSVNLKKKDEL 612          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Xenopus
Match: chst13 (carbohydrate (chondroitin 4) sulfotransferase 13 [Source:Xenbase;Acc:XB-GENE-945720])

HSP 1 Score: 393.275 bits (1009), Expect = 1.974e-127
Identity = 228/612 (37.25%), Postives = 352/612 (57.52%), Query Frame = 3
Query:  153 EIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXX-XXXMDLSQNDMPPISGLEY--ERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL--KDEL 1967
            E+  ++ V VL  +NFD FI   +IV++EFYAPWCGHCKQ  P Y K A  L +N+PPI + K+DAT  +++A R+ ISGYPT+KI K   P DYD +R++ AIV  +K++  PDW+PP    + LTK+NF E+V  +  ILVEF+APWCGHCK LAPE+ KAA+ LS  +PPI LA VDATVE+ L  +Y V+G+PTLK+F+    F DY+GPR   GIVD+M +     +K + ++       ++   V +LG+FS E D  +  + DA N  RED+   ++FS EI      +     G +++++PE  ++ YE           + T  ++   I ++  P+V     +     ++  K+ + + +++VDF   ++TAT+ W  KI ++A ++  +  FAIA+++  + +L++L L DSGEE+NV     +  KY     +EFDS+ +R+F+ +   GK+ PI+KS P+PK   ++G +  VVG T+ +++ D   + L+  Y   C  C+SL  I + L   +          MD + ND   I+  +Y  E F PT+ F   +   +P        IKF G   +   +  FI ++S  L  KDEL
Sbjct:   42 EVKDENGVLVLTDKNFDTFITDKDIVLLEFYAPWCGHCKQFVPEYEKIASALNQNDPPIPVAKIDATEATDVAGRYDISGYPTIKILKKGQPIDYDGARTQEAIVTKVKEIAQPDWKPPPEATIVLTKDNFDEVVSDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKRSPPIPLAKVDATVESSLGSKYGVTGFPTLKIFRKGKVF-DYNGPREKYGIVDYMTEQAGPPSKQIQAVKQVHEFFRDGDDVGILGVFSDEKDRAYHLYQDAANNLREDYKFYHTFSSEIFNFLKVSP----GQLVVMQPEKFQSKYEAK-KYILSFKDSTTAADIKQHISEHSLPLVGHR--KNSNEAKRYSKRPIVVVYYSVDFGFDYRTATQYWRSKILEVAKDFS-EYTFAIANEDDYATELKDLGLSDSGEEVNVAIFDASGKKYAKEP-EEFDSDGLREFVMAFKKGKLTPIIKSQPVPKN--NKGPVKVVVGKTFDQIVMDPKSDVLIEFYAPWCGHCKSLEPIYNDLGKKYRSAEGLIIAKMDATAND---ITSDKYKAEGF-PTIYFAPRNNKQNP--------IKFSGGNRDLESLSKFIEEHSVNLKKKDEL 629          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Xenopus
Match: pdia3 (protein disulfide isomerase family A member 3 [Source:NCBI gene;Acc:394954])

HSP 1 Score: 184.496 bits (467), Expect = 7.570e-51
Identity = 122/403 (30.27%), Postives = 206/403 (51.12%), Query Frame = 3
Query:  504 PPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKD---QIQFAIADDERQSDKLRELRLD-DSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSL 1697
            P ++ VL LT +NF   V     +LVEFFAPWCGHCK LAPE+  AA   + L   + LA VD T  ++   +Y VSGYPTLK+F++      Y GPR++DGIV  M K    A+  + S+ +F    + +   ++G F        + F+ A N  R+++   ++   E+   YD+N +      +L RP++L N +E     F   +  +T  ++  FI+ N+F +       T+   + ++ K L + ++ VD+  + K  T  W  ++ K+A ++ D   ++ FA+A+ +    ++ E  LD  +GE   VG       KY M      D + + +FL     GK+   +KS  IP++  ++G +  VV + + E++ND   + L+  Y   C  C++L
Sbjct:   10 PARSDVLDLTDDNFESTVSQHSILLVEFFAPWCGHCKKLAPEYEIAA---TKLKGTLSLAKVDCTANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRTADGIVSTMKKQAGPASVDLRSVGEFEKFISDKDASVVGFFRDLYSGPHSEFLKAANTLRDNYRFAHTDEKELVDKYDSNGE----GFVLFRPQHLANKFEDSSVTFP-ADEKITSSKIKKFIQDNIFGLCPHL---TEDNKDLIQGKDLLVAYYDVDYEKNVK-GTNYWRNRVMKVAKSFVDAGKKLNFAVANRKAFGHEVTEFGLDAGTGELPVVGIKTAKGEKYAMQEEFSRDGKALERFLQDYFDGKLKRYMKSEAIPES--NDGPVKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNL 398          

HSP 2 Score: 102.449 bits (254), Expect = 1.817e-22
Identity = 50/114 (43.86%), Postives = 71/114 (62.28%), Query Frame = 3
Query:  156 IPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFK-SSIPYDYDDSRSESAIVNFMKKVGSP 494
            +P  S+V  L  +NF+  ++ ++I++VEF+APWCGHCK+L P Y  AA +LK     + L KVD T  S   +++G+SGYPTLKIF+       YD  R+   IV+ MKK   P
Sbjct:    9 LPARSDVLDLTDDNFESTVSQHSILLVEFFAPWCGHCKKLAPEYEIAATKLKGT---LSLAKVDCTANSNTCNKYGVSGYPTLKIFRDGEDSGSYDGPRTADGIVSTMKKQAGP 119          

HSP 3 Score: 68.1662 bits (165), Expect = 2.005e-11
Identity = 33/77 (42.86%), Postives = 53/77 (68.83%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFINANNI-VMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISG 392
            D  V V+ +ENFDE +N ++  V++EFYAPWCGHCK L P Y +   +L  ++P I++ K+DAT  +++ S++ + G
Sbjct:  361 DGPVKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNLEPKYKELGEKL-GDDPNIVIAKMDATA-NDVPSQYEVRG 435          

HSP 4 Score: 63.929 bits (154), Expect = 4.791e-10
Identity = 32/74 (43.24%), Postives = 48/74 (64.86%), Query Frame = 3
Query:  519 VLTLTKENFTEIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSG 737
            V  +  ENF EIV + S  +L+EF+APWCGHCK+L P++ +  + L + +P I +A +DAT   D+  +Y V G
Sbjct:  364 VKVVVAENFDEIVNDDSKDVLIEFYAPWCGHCKNLEPKYKELGEKLGD-DPNIVIAKMDATA-NDVPSQYEVRG 435          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Mouse
Match: Pdia4 (protein disulfide isomerase associated 4 [Source:MGI Symbol;Acc:MGI:104864])

HSP 1 Score: 401.749 bits (1031), Expect = 1.233e-130
Identity = 231/597 (38.69%), Postives = 346/597 (57.96%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQ----NPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXXX-XXMDLSQNDMPPISGLEY--ERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFI 1934
            + V+VLN  NFD F+   + V++EFYAPWCGHCKQ  P Y K A  LK N+PPI + K+DAT  S LAS+F +SGYPT+KI K     DYD SR++  IV  +++V  PDW PP    L+LTK+NF ++V ++  ILVEF+APWCGHCK LAPE+ KAAK LS  +PPI LA VDAT +TDLAK + VSGYPTLK+F+    F DY+GPR   GIVD+MI   E +      IL  + VQ    +   V+++GLF  + D  +  + DA N  RED+   ++FS EI      +    +G ++L  PE  ++ YEP F     +  +     +  ++ K+  P+V     +T    ++  K+ L + +++VDFS  ++ AT+ W  K+ ++A ++  +  FAIAD+E  + ++++L L +SGE++N   + E+  K+ M   +EFDS+ +R+F+ +   GK+ P++KS P+PK   ++G +  VVG T+  ++ D   + L+  Y   C  C+ L  I +SL   + G+       MD + ND   I+  +Y  E F PT+ F       +P        IKF G   +   +  FI
Sbjct:   58 NGVWVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTLSLTKDNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGRPF-DYNGPREKYGIVDYMI---EQSGPPSKEILTLKQVQEFLKDGDDVVIIGLFQGDGDPAYLQYQDAANNLREDYKFHHTFSPEIAKFLKVS----LGKLVLTHPEKFQSKYEPRF-HVMDVQGSTEASAIKDYVVKHALPLVGHR--KTSNDAKRYSKRPLVVVYYSVDFSFDYRAATQFWRNKVLEVAKDFP-EYTFAIADEEDYATEVKDLGLSESGEDVNAAILDESGKKFAMEP-EEFDSDTLREFVTAFKKGKLKPVIKSQPVPKN--NKGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATAND---ITNDQYKVEGF-PTIYFAPSGDKKNP--------IKFEGGNRDLEHLSKFI 627          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Mouse
Match: Pdia3 (protein disulfide isomerase associated 3 [Source:MGI Symbol;Acc:MGI:95834])

HSP 1 Score: 161.77 bits (408), Expect = 2.952e-42
Identity = 131/450 (29.11%), Postives = 221/450 (49.11%), Query Frame = 3
Query:  519 VLTLTKENFTEIVE---SSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKD---QIQFAIADDERQSDKLRELRLDDSGEEINVGCI----GENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNF 1832
            VL LT ENF   V    S+G +LVEFFAPWCGHCK LAPE+  AA  L  + P   LA VD T  T+   +Y VSGYPTLK+F++      Y GPR++DGIV  + K    A+  + +  +F+   + +   ++G F        + F+ A +  R+++   ++  + +   YD   D+G G I + RP +L N +E     +      +T  ++  FI+ ++F +       T+   + ++ K L   ++ VD+  + K  +  W  ++  +A  + D   ++ FA+A  +  S +L +  L+ +  E+ V  I    GE   K+ M      D + + +FL     G +   LKS PIP++  +EG +  VV + + +++N+   + L+  Y   C  C++L               ++    MD + ND+P  S  E + F PT+ F
Sbjct:   27 VLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLRTEEEFKKFISDKDASVVGFFRDLFSDGHSEFLKAASNLRDNYRFAHTNIESLVKEYD---DNGEG-ITIFRPLHLANKFEDKTVAYTE--KKMTSGKIKKFIQDSIFGLCPHM---TEDNKDLIQGKDLLTAYYDVDYEKNAK-GSNYWRNRVMMVAKKFLDAGHKLNFAVASRKTFSHELSDFGLESTTGEVPVVAIRTAKGE---KFVMQEEFSRDGKALEQFLQEYFDGNLKRYLKSEPIPES--NEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSKDPNIVIAKMDATANDVP--SPYEVKGF-PTIYF 455          

HSP 2 Score: 98.9821 bits (245), Expect = 2.812e-21
Identity = 70/193 (36.27%), Postives = 100/193 (51.81%), Query Frame = 3
Query:  171 NVYVLNSENFDEFIN---ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYD-YDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSG 737
            +V  L  ENF+  ++   +  +++VEF+APWCGHCK+L P Y  AA +LK   P   L KVD T  +   +++G+SGYPTLKIF+       YD  R+   IV+ +KK   P   P +      T+E F + +      +V FF        S   EF KAA   SNL    + A  +  +E+ L KEY  +G
Sbjct:   26 DVLELTDENFESRVSDTGSAGLMLVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LAKVDCTANTNTCNKYGVSGYPTLKIFRDGEEAGAYDGPRTADGIVSHLKKQAGPASVPLR------TEEEFKKFISDKDASVVGFFRDLFSDGHS---EFLKAA---SNLRDNYRFAHTN--IES-LVKEYDDNG 200          

HSP 3 Score: 75.0998 bits (183), Expect = 1.294e-13
Identity = 45/126 (35.71%), Postives = 74/126 (58.73%), Query Frame = 3
Query:  129 GFFKNILGEIPI-DSN---VYVLNSENFDEFINANNI-VMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIF---KSSIPYDYDDSRSESAIVNFMKK 482
            G  K  L   PI +SN   V V+ +ENFD+ +N  +  V++EFYAPWCGHCK L P Y +   +L K +P I++ K+DAT  +++ S + + G+PT+      K   P  Y+  R  +  ++++++
Sbjct:  359 GNLKRYLKSEPIPESNEGPVKVVVAENFDDIVNEEDKDVLIEFYAPWCGHCKNLEPKYKELGEKLSK-DPNIVIAKMDATA-NDVPSPYEVKGFPTIYFSPANKKLTPKKYEGGRELNDFISYLQR 482          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Mouse
Match: Pdia6 (protein disulfide isomerase associated 6 [Source:MGI Symbol;Acc:MGI:1919103])

HSP 1 Score: 159.844 bits (403), Expect = 4.895e-42
Identity = 94/266 (35.34%), Postives = 142/266 (53.38%), Query Frame = 3
Query:   96 ISILFSACINFGFFKNILGEIPIDSNVYVLNSENFD-EFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKS--SIPYDYDDSRSESAIVN---------------------FMKKVGSPDWQPPKNYVLTLTKENFTE-IVESSGYILVEFFAPWCGHCKSLAPEFAKAA-KILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIV 815
            ++ L    ++  FF  + G      +V  L   NF+ E I ++ + +VEFYAPWCGHC++LTP + KAA  LK     + +G V+A     L  ++G+ G+PT+KIF +  + P DY   R+  AIV+                        K G  D    K+ V+ LT + F + +++S    +VEF+APWCGHCK+L PE+A AA ++       ++LA VDAT+   LA  Y + G+PT+K+F+     VDY G R+   IV
Sbjct:    6 MARLVLGLVSCTFFLAVSGLYSSSDDVIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKD---VVKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVDAALSALRQLVKDRLGGRSGGYSSGKQGRGDSSSKKD-VVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATMNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIV 267          

HSP 2 Score: 98.5969 bits (244), Expect = 2.207e-21
Identity = 53/128 (41.41%), Postives = 76/128 (59.38%), Query Frame = 3
Query:  138 KNILGEIPIDSNVYVLNSENFDE-FINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLK-KNNPPILLGKVDATVESELASRFGISGYPTLKIF-KSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPK 512
            K   G+     +V  L  + FD+  +++ ++ MVEFYAPWCGHCK L P +  AA ++K +    + L  VDAT+   LASR+GI G+PT+KIF K   P DYD  R+ S IV+    + S +  PP+
Sbjct:  155 KQGRGDSSSKKDVVELTDDTFDKNVLDSEDVWMVEFYAPWCGHCKNLEPEWAAAATEVKEQTKGKVKLAAVDATMNQVLASRYGIKGFPTIKIFQKGESPVDYDGGRTRSDIVSRALDLFSDNAPPPE 282          

HSP 3 Score: 93.9745 bits (232), Expect = 7.639e-20
Identity = 46/102 (45.10%), Postives = 65/102 (63.73%), Query Frame = 3
Query:  519 VLTLTKENFT-EIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFK-NKNFFVDYSGPRSSDGIVD 818
            V+ LT  NF  E+++S G  LVEF+APWCGHC+ L PE+ KAA  L ++   +++  V+A     L  +Y V G+PT+K+F  NKN   DY G R+ + IVD
Sbjct:   32 VIELTPSNFNREVIQSDGLWLVEFYAPWCGHCQRLTPEWKKAATALKDV---VKVGAVNADKHQSLGGQYGVQGFPTIKIFGANKNKPEDYQGGRTGEAIVD 130          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Mouse
Match: P4hb (prolyl 4-hydroxylase, beta polypeptide [Source:MGI Symbol;Acc:MGI:97464])

HSP 1 Score: 147.132 bits (370), Expect = 3.154e-37
Identity = 126/421 (29.93%), Postives = 197/421 (46.79%), Query Frame = 3
Query:  480 KVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFV--DYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLF------SSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEE----INVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI 1706
            +VG+   +   N VL L K NF E + +  Y+LVEF+APWCGHCK+LAPE+AKAA  L      I+LA VDAT E+DLA++Y V GYPT+K FKN +     +Y+  R +D IV+W+ K    AA  +S      ++ +   V ++G F      S++  LL    ID         S ++S        Y  + D   G ++  + +  RN +E + TK +          ++ FI+ N  P+V E+  +T   +   E K   + F     S +        L    + A  +K +I F   D +  +D  R L      +E    + +  + E   KY+  + DE  +E I +F    L GK+ P L S  +P+    + +  +VG  ++E+  D      +  Y   C  C+ L  I
Sbjct:   16 RVGADALEEEDN-VLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGPAATTLSDTAAAESLVDSSEVTVIGFFKDVESDSAKQFLLAAEAIDDIPFGITSNSGVFS-------KYQLDKD---GVVLFKKFDEGRNNFEGEITKEK----------LLDFIKHNQLPLVIEFTEQTAPKIFGGEIKTHILLFLPKSVSDYDGK-----LSSFKRAAEGFKGKILFIFIDSD-HTDNQRILEFFGLKKEECPAVRLITLEEEMTKYKPES-DELTAEKITEFCHRFLEGKIKPHLMSQEVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPI 408          

HSP 2 Score: 108.612 bits (270), Expect = 2.563e-24
Identity = 64/146 (43.84%), Postives = 86/146 (58.90%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFK---SSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTE-IVESSGYILVEFF 590
            + NV VL   NF+E + A+  ++VEFYAPWCGHCK L P Y KAA +LK     I L KVDAT ES+LA ++G+ GYPT+K FK   ++ P +Y   R    IVN++KK   P          TL+     E +V+SS   ++ FF
Sbjct:   25 EDNVLVLKKSNFEEALAAHKYLLVEFYAPWCGHCKALAPEYAKAAAKLKAEGSEIRLAKVDATEESDLAQQYGVRGYPTIKFFKNGDTASPKEYTAGREADDIVNWLKKRTGP-------AATTLSDTAAAESLVDSSEVTVIGFF 163          

HSP 3 Score: 71.2478 bits (173), Expect = 1.866e-12
Identity = 44/120 (36.67%), Postives = 64/120 (53.33%), Query Frame = 3
Query:  153 EIPIDSN---VYVLNSENFDEF-INANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPY---DYDDSRSESAIVNFMKKVGS 491
            E+P D +   V VL   NF+E   +    V VEFYAPWCGHCKQL PI+ K   +  K++  I++ K+D+T     A +  +  +PTLK F +S      DY+  R+      F++  G 
Sbjct:  361 EVPEDWDKQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLG-ETYKDHENIIIAKMDSTANEVEAVK--VHSFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQ 477          

HSP 4 Score: 64.6994 bits (156), Expect = 2.098e-10
Identity = 42/130 (32.31%), Postives = 64/130 (49.23%), Query Frame = 3
Query:  468 NFMKKVGSPDWQPPKNYVLTLTKENFTEIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF--KNKNFFVDYSGPRSSDGIVDWMIKNRENAA 848
            + M +    DW   K  V  L   NF E+  +    + VEF+APWCGHCK LAP + K  +   + +  I +A +D+T     A + H   +PTLK F        +DY+G R+ DG   ++    ++ A
Sbjct:  356 HLMSQEVPEDWD--KQPVKVLVGANFEEVAFDEKKNVFVEFYAPWCGHCKQLAPIWDKLGETYKD-HENIIIAKMDSTANEVEAVKVH--SFPTLKFFPASADRTVIDYNGERTLDGFKKFLESGGQDGA 480          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Mouse
Match: Txndc5 (thioredoxin domain containing 5 [Source:MGI Symbol;Acc:MGI:2145316])

HSP 1 Score: 127.102 bits (318), Expect = 1.008e-31
Identity = 73/246 (29.67%), Postives = 129/246 (52.44%), Query Frame = 3
Query:  162 IDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYD-YDDSRSESAIVNFMKKV-----GSPDWQPP-------------KNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNREN 842
            +   +Y L++ NF+  ++  N   ++F+APWCGHCK L P + + A+ L+ +   + +GKVD T    + S   + GYPTL  F+     D Y   R   ++ ++++        +P+   P             K  VL LT+++F + + + G   V+F+APWCGHCK+LAP + + +K        + +A VD T E ++  +Y V GYPTL LF+      +++G R  D +  ++++  ++
Sbjct:   79 LKQGLYELSANNFELHVSQGNH-FIKFFAPWCGHCKALAPTWEQLALGLEHSET-VKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETVEPSEAPVMAAEPTGDKGTVLALTEKSFEDTI-AQGITFVKFYAPWCGHCKNLAPTWEELSKKEFPGLSDVTIAEVDCTAERNVCSKYSVRGYPTLLLFRGGEKVGEHNGGRDLDSLHSFVLRQAKD 321          

HSP 2 Score: 97.8265 bits (242), Expect = 1.036e-21
Identity = 60/193 (31.09%), Postives = 96/193 (49.74%), Query Frame = 3
Query:  327 ILLGKVDATVESELASRFGISGYPTLKIFK-SSIPYDYDDSRSESAIVNFMKKV-------GSPDWQPP-----KNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSI 866
            + + KVD T +S++ S  G+ GYPTLK FK       Y   R    + N+M +          P+ +PP     K  +  L+  NF E+  S G   ++FFAPWCGHCK+LAP + + A  L + +  +++  VD T    +  E+ V GYPTL  F++      Y G R  + + D++    + +  A  ++
Sbjct:    6 VYVAKVDCTADSDVCSAQGVRGYPTLKFFKPGQEAVKYQGPRDFETLENWMLQTLNEEPATPEPEAEPPRAPELKQGLYELSANNF-ELHVSQGNHFIKFFAPWCGHCKALAPTWEQLALGLEH-SETVKIGKVDCTQHYAVCSEHQVRGYPTLLWFRDGKKVDQYKGKRDLESLRDYVQSQLQGSEAAPETV 196          
BLAST of Protein disulfide-isomerase A4 vs. UniProt/SwissProt
Match: sp|P38659|PDIA4_RAT (Protein disulfide-isomerase A4 OS=Rattus norvegicus OX=10116 GN=Pdia4 PE=1 SV=2)

HSP 1 Score: 401.749 bits (1031), Expect = 7.227e-130
Identity = 210/518 (40.54%), Postives = 317/518 (61.20%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQ----NPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI 1706
            + V+VLN ENFD F+   + V++EFYAPWCGHCKQ  P Y K A  LK N+PPI + K+DAT  S LAS+F +SGYPT+KI K     DYD SR++  IV  +++V  PDW PP    LTLTKENF ++V ++  ILVEF+APWCGHCK LAPE+ KAAK LS  +PPI LA VDAT +TDLAK + VSGYPTLK+F+    F DY+GPR   GIVD+M+   E +      IL  + VQ    +   V++LG+F    D  +  + DA N  RED+   ++FS EI      +    +G ++L++PE  ++ YEP       +  +     +  ++ K+  P+V     +T    ++  K+ L + +++VDFS  ++TAT+ W  K+ ++A ++  +  FAIAD+E  + ++++L L +SGE++N   + E+  K+ M   +EFDS+ +++F+ +   GK+ P++KS P+PK   ++G +  VVG T+  ++ D   + L+  Y   C  C+ L  +
Sbjct:   60 NGVWVLNDENFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTLTLTKENFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGRPF-DYNGPREKYGIVDYMV---EQSGPPSKEILTLKQVQEFLKDGDDVVILGVFQGVGDPGYLQYQDAANTLREDYKFHHTFSTEIAKFLKVS----LGKLVLMQPEKFQSKYEPRM-HVMDVQGSTEASAIKDYVVKHALPLVGHR--KTSNDAKRYSKRPLVVVYYSVDFSFDYRTATQFWRNKVLEVAKDFP-EYTFAIADEEDYATEVKDLGLSESGEDVNAAILDESGKKFAMEP-EEFDSDALQEFVMAFKKGKLKPVIKSQPVPKN--NKGPVRVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPV 562          
BLAST of Protein disulfide-isomerase A4 vs. UniProt/SwissProt
Match: sp|P08003|PDIA4_MOUSE (Protein disulfide-isomerase A4 OS=Mus musculus OX=10090 GN=Pdia4 PE=1 SV=3)

HSP 1 Score: 401.749 bits (1031), Expect = 7.904e-130
Identity = 231/597 (38.69%), Postives = 346/597 (57.96%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQ----NPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXXX-XXMDLSQNDMPPISGLEY--ERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFI 1934
            + V+VLN  NFD F+   + V++EFYAPWCGHCKQ  P Y K A  LK N+PPI + K+DAT  S LAS+F +SGYPT+KI K     DYD SR++  IV  +++V  PDW PP    L+LTK+NF ++V ++  ILVEF+APWCGHCK LAPE+ KAAK LS  +PPI LA VDAT +TDLAK + VSGYPTLK+F+    F DY+GPR   GIVD+MI   E +      IL  + VQ    +   V+++GLF  + D  +  + DA N  RED+   ++FS EI      +    +G ++L  PE  ++ YEP F     +  +     +  ++ K+  P+V     +T    ++  K+ L + +++VDFS  ++ AT+ W  K+ ++A ++  +  FAIAD+E  + ++++L L +SGE++N   + E+  K+ M   +EFDS+ +R+F+ +   GK+ P++KS P+PK   ++G +  VVG T+  ++ D   + L+  Y   C  C+ L  I +SL   + G+       MD + ND   I+  +Y  E F PT+ F       +P        IKF G   +   +  FI
Sbjct:   55 NGVWVLNDGNFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIASTLKDNDPPIAVAKIDATSASMLASKFDVSGYPTIKILKKGQAVDYDGSRTQEEIVAKVREVSQPDWTPPPEVTLSLTKDNFDDVVNNADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATEQTDLAKRFDVSGYPTLKIFRKGRPF-DYNGPREKYGIVDYMI---EQSGPPSKEILTLKQVQEFLKDGDDVVIIGLFQGDGDPAYLQYQDAANNLREDYKFHHTFSPEIAKFLKVS----LGKLVLTHPEKFQSKYEPRF-HVMDVQGSTEASAIKDYVVKHALPLVGHR--KTSNDAKRYSKRPLVVVYYSVDFSFDYRAATQFWRNKVLEVAKDFP-EYTFAIADEEDYATEVKDLGLSESGEDVNAAILDESGKKFAMEP-EEFDSDTLREFVTAFKKGKLKPVIKSQPVPKN--NKGPVKVVVGKTFDAIVMDPKKDVLIEFYAPWCGHCKQLEPIYTSLGKKYKGQKDLVIAKMDATAND---ITNDQYKVEGF-PTIYFAPSGDKKNP--------IKFEGGNRDLEHLSKFI 624          
BLAST of Protein disulfide-isomerase A4 vs. UniProt/SwissProt
Match: sp|P13667|PDIA4_HUMAN (Protein disulfide-isomerase A4 OS=Homo sapiens OX=9606 GN=PDIA4 PE=1 SV=2)

HSP 1 Score: 397.127 bits (1019), Expect = 4.426e-128
Identity = 230/609 (37.77%), Postives = 349/609 (57.31%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQ----NPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXXX-XXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL---KDEL 1967
            + V VLN  NFD F+   + V++EFYAPWCGHCKQ  P Y K A  LK  +PPI + K+DAT  S LASRF +SGYPT+KI K     DY+ SR++  IV  +++V  PDW PP    L LTKENF E+V  +  ILVEF+APWCGHCK LAPE+ KAAK LS  +PPI LA VDAT ETDLAK + VSGYPTLK+F+    + DY+GPR   GIVD+MI   E +      IL  + VQ    +   V+++G+F  E+D  +  + DA N  RED+   ++FS EI      +     G +++++PE  ++ YEP  +    +  +     +  F+ K   P+V           ++  ++ L + +++VDFS  ++ AT+ W  K+ ++A ++  +  FAIAD+E  + ++++L L +SGE++N   + E+  K+ M   +EFDS+ +R+F+ +   GK+ P++KS P+PK   ++G +  VVG T+  ++ D   + L+  Y   C  C+ L  + +SL+  + G+       MD + ND+P     + E F PT+ F       +P        +KF G   +   +  FI +++  L   K+EL
Sbjct:   62 NGVLVLNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANILKDKDPPIPVAKIDATSASVLASRFDVSGYPTIKILKKGQAVDYEGSRTQEEIVAKVREVSQPDWTPPPEVTLVLTKENFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKRSPPIPLAKVDATAETDLAKRFDVSGYPTLKIFRKGRPY-DYNGPREKYGIVDYMI---EQSGPPSKEILTLKQVQEFLKDGDDVIIIGVFKGESDPAYQQYQDAANNLREDYKFHHTFSTEIAKFLKVSQ----GQLVVMQPEKFQSKYEPR-SHMMDVQGSTQDSAIKDFVLKYALPLVGHRKVSNDA--KRYTRRPLVVVYYSVDFSFDYRAATQFWRSKVLEVAKDFP-EYTFAIADEEDYAGEVKDLGLSESGEDVNAAILDESGKKFAMEP-EEFDSDTLREFVTAFKKGKLKPVIKSQPVPKN--NKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPVYNSLAKKYKGQKGLVIAKMDATANDVPS-DRYKVEGF-PTIYFAPSGDKKNP--------VKFEGGDRDLEHLSKFIEEHATKLSRTKEEL 645          
BLAST of Protein disulfide-isomerase A4 vs. UniProt/SwissProt
Match: sp|Q29RV1|PDIA4_BOVIN (Protein disulfide-isomerase A4 OS=Bos taurus OX=9913 GN=PDIA4 PE=2 SV=1)

HSP 1 Score: 394.045 bits (1011), Expect = 6.889e-127
Identity = 204/518 (39.38%), Postives = 311/518 (60.04%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQ----NPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI 1706
            + V +LN  NFD F+   + V++EFYAPWCGHCKQ  P Y K A  LK+N+PPI + K+DAT ES LASRF +SGYPT+KI K     DY+ SR++  IV  +K+V  P+W PP    L LTK+NF E+V  +  ILVEF+APWCGHCK LAPE+ KAAK LS  +PPI LA VDA  ETDLAK + VS YPTLK+F+    F  Y+GPR   GIVD+M+   E +      IL  + VQ    +   V+++G+F SE+D  +  + DA N  RED+   ++FS EI      +    +G +++++PE  ++ YEP  +    +  +     +   + K+  P+V     R     ++  ++ L + +++VDFS  ++ AT+ W  K+ ++A ++  +  FA+AD+E  + +L++L L +SGEE+N   + E   ++ M   D+FD++ +R F+ +   GK+ P++KS P+PK   ++G +  VVG T+  ++ D   + L+  Y   C  C+ L  +
Sbjct:   61 NGVLILNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIAATLKENDPPIPVAKIDATSESALASRFDVSGYPTIKILKKGQEVDYEGSRTQEEIVAKVKEVSQPNWTPPPEVTLVLTKDNFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSKSSPPIPLAKVDAIAETDLAKRFDVSSYPTLKIFRKGKAF-SYNGPREKYGIVDYMM---EQSGPPSKQILALKQVQEFLKDGDDVIIIGVFKSESDPAYQLYQDAANSLREDYKFHHTFSTEIAKFLKVS----LGKLVVMQPEKFQSKYEPK-SYVMDIKDSTEAAAITEHVVKHTLPLVGH---RKAADAKRYTRRPLVVVYYSVDFSFDYRAATQFWRNKVLEVAKDFP-EYTFAVADEEDFATELKDLGLSESGEEVNAAILDEGGRRFAMEP-DDFDADALRDFVTAFKKGKLKPVIKSQPVPKN--NKGPVKVVVGKTFDSIVMDPKKDVLIEFYAPWCGHCKQLEPV 562          
BLAST of Protein disulfide-isomerase A4 vs. UniProt/SwissProt
Match: sp|P34329|PDIA4_CAEEL (Probable protein disulfide-isomerase A4 OS=Caenorhabditis elegans OX=6239 GN=C14B9.2 PE=3 SV=2)

HSP 1 Score: 355.91 bits (912), Expect = 1.824e-112
Identity = 223/613 (36.38%), Postives = 337/613 (54.98%), Query Frame = 3
Query:  162 IDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSI-PYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRL-LYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNY-KDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDS---EHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRN--IXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKN---SKVLKDEL 1967
            +D  V VL  +NFD F+  N  V+V+FYAPWCGHCK L P Y KA+ ++      I L KVDATVE+EL  RF I GYPTLK +K    P DYD  R E+ IV +++    P+++PP   V+TLT ENF + + ++  +LVEF+APWCGHCK LAPE+ KAA+ L      ++L  VDAT+E DL  +Y VSGYPT+K+ +N   F DY+GPR + GI+ +M    + AAK +  + D     +   V ++G F++E+   F  F D+  + RE+F ++   SD      +DA  +D    II+  P    + +EP    +    +  T  ++++F  ++  P+V +     K    +  KK L + ++  DFS+ ++  ++ W  K+  IA  Y KD+ +FA+AD+E  + +L EL L DSG E NV   G +  KY M+  DEFD    E++  F+  I +GK    +KSAP PK      + TVVG  + +++ND   + L+  Y   C  C+S  +  +  + +   +  ++    MD + ND P  S    E F PT+ F      S+P        IK+ G++  E ++K F+ K+   S   KDEL
Sbjct:   34 MDEGVVVLTDKNFDAFLKKNPSVLVKFYAPWCGHCKHLAPEYEKASSKVS-----IPLAKVDATVETELGKRFEIQGYPTLKFWKDGKGPNDYDGGRDEAGIVEWVESRVDPNYKPPPEEVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRRF-DYNGPREAAGIIKYMTDQSKPAAKKLPKLKDVERFMSKDDVTIIGFFATEDSTAFEAFSDSAEMLREEFKTMGHTSDPAAFKKWDAKPND----IIIFYPSLFHSKFEPKSRTYN--KAAATSEDLLAFFREHSAPLVGK--MTKKNAATRYTKKPLVVVYYNADFSVQYREGSEYWRSKVLNIAQKYQKDKYKFAVADEEEFAKELEELGLGDSGLEHNVVVFGYDGKKYPMNP-DEFDGELDENLEAFMKQISSGKAKAHVKSAPAPKDDKGP-VKTVVGSNFDKIVNDESKDVLIEFYAPWCGHCKSFESKYVELAQALKKTQPNVVLAKMDATINDAP--SQFAVEGF-PTIYFAPAGKKSEP--------IKYSGNRDLE-DLKKFMTKHGVKSFQKKDEL 618          

HSP 2 Score: 127.872 bits (320), Expect = 1.917e-29
Identity = 54/112 (48.21%), Postives = 76/112 (67.86%), Query Frame = 3
Query:  159 PIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSP 494
            P    V  L +ENFD+FI+ N +V+VEFYAPWCGHCK+L P Y KAA +LK     + LGKVDAT+E +L +++G+SGYPT+KI ++   +DY+  R  + I+ +M     P
Sbjct:  144 PPPEEVVTLTTENFDDFISNNELVLVEFYAPWCGHCKKLAPEYEKAAQKLKAQGSKVKLGKVDATIEKDLGTKYGVSGYPTMKIIRNGRRFDYNGPREAAGIIKYMTDQSKP 255          
BLAST of Protein disulfide-isomerase A4 vs. TrEMBL
Match: V4B1I8 (Protein disulfide-isomerase OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_139785 PE=3 SV=1)

HSP 1 Score: 444.121 bits (1141), Expect = 2.334e-144
Identity = 246/604 (40.73%), Postives = 365/604 (60.43%), Query Frame = 3
Query:  150 GEIPIDSN-VYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLN-SNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI-XXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKV 1952
            G+ P + + V +LN ENFDE IN+ + V+VEFYAPWCGHCK L P Y  AA +LK+  PPI+L KVDAT+E  LA+RF ++GYPTLK FK+  P+DYD  R ++ IV++MK+ G+P W+PP   V+TL  +NF + + +   +LVEF+APWCGHCK LAP + KAA+ L    P I LA VDAT  T+LAKEY V+GYPTLK+F+ K    DY G R   GIV++M+     AA+ + ++   +  +  Q + ++G F SE D     ++DA N  R+DF+  Y   D IR  Y  NV    GS+I+L PE     +EP   K+  LN ++++  ++  F++ +  P+V EY   T+ +      K LC+ F+TVD+S  H+ AT+ W  KI  IA +YK  + FA+AD+E     L+E  L+DS E+IN+G IG+++ +YRM  M++F+S+ +R+FLDS +AGK+   +KS P+PK   S  +  VVG T+K+++ D   + L+  Y   C  C+ L  +           K+L    +D + ND+P     + + F PT+ F   +T  D     +K  IKF G Q    + + F+ +++ V
Sbjct:    7 GDSPTEEDDVLLLNQENFDEVINSRDTVLVEFYAPWCGHCKSLAPEYALAAKELKQLAPPIILAKVDATIEETLATRFSVTGYPTLKFFKNGNPHDYDGPRQKNGIVSYMKERGNPSWKPPPEAVITLNTDNFADTINNEELMLVEFYAPWCGHCKQLAPVYEKAAQELKKATPAIPLAKVDATQNTELAKEYGVTGYPTLKIFR-KGRPKDYGGSRDQRGIVNYMLSQAGEAARLLPTLSALKRFKQLQFITVIGFFDSEEDPNLRIYMDAANDMRDDFTFGYVLDDSIRNDYKVNV----GSVIVLNPERFFTKFEP---KWHVLNKADLSVSDITEFVKNHQIPLVGEYSTSTQKFYGDF--KPLCLVFYTVDWSHDHREATQLWRNKIASIAKDYK-SVTFAVADEESHDHLLKEFNLEDSPEDINIGIIGKDNKRYRMEPMEDFESDEVREFLDSFIAGKLTYEVKSQPVPKK-QSGPLKVVVGKTFKDIVLDKSKDVLIEFYAPWCGHCKKLEPVFNKLAKQVKDQKNLIVAKLDATANDVP--DEFKVQGF-PTIYF---ATAKD-----KKNPIKFDGGQREIADFEKFMREHATV 587          
BLAST of Protein disulfide-isomerase A4 vs. TrEMBL
Match: A0A2T7P9K1 (Protein disulfide-isomerase OS=Pomacea canaliculata OX=400727 GN=C0Q70_09358 PE=3 SV=1)

HSP 1 Score: 440.654 bits (1132), Expect = 2.438e-142
Identity = 245/592 (41.39%), Postives = 346/592 (58.45%), Query Frame = 3
Query:  174 VYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI-XXXXXXXXXXXXXXXXXMDLSQNDMP---PISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFI 1934
            V VL  +NF +FI   +  +VEFYAPWCGHCK L P+Y  AA +LK ++PP++L KVDATVE++LA ++ ++GYPTLK FK    YDYD  R ++ IVNFMK + SPDW+P    V+ LT+ENFTE+V     +LVEF+APWCGHCK LAP++ KAAK L     PI LA VDATVETDLA +Y V+GYPTLK+F+    F DY G R +  I+ +M   R + AK V  +   +       + +LG+F SE D    TF D+    RE++ S ++  + I+  Y AN     GS++++ PE     YEP +  F+ +  +  P E+  FI  N FP+V   D   +    K  +  LC+FF+ VD+   H+ AT+ W +KI  IA ++++ I FA+AD+E+    L+EL L+DS EEIN+G +  N  KY M  M+EFD + +R+FL+  L GKV P +KS P+PK    EG +T VVG ++ +++ D   + L+ LY   C  C+ L  +         S K+L    MD + ND+P   P  G     F PT N              + K +K+ G +    E+K FI
Sbjct:   48 VLVLTKDNFSDFIKDTDTALVEFYAPWCGHCKSLAPVYAAAAKELKVSDPPVILAKVDATVETDLAQQYDVTGYPTLKFFKRGSSYDYDGGRDKTGIVNFMKVIASPDWKPEPEAVVVLTQENFTEVVSREELMLVEFYAPWCGHCKQLAPKYEKAAKQLRQSEYPIILAKVDATVETDLAAQYGVNGYPTLKVFRKGRQF-DYKGQRETYDIISYMESQRGDPAKPVVGLKALKAFLKEDDINVLGIFDSETDPRLQTFQDSLQDIREEYRSGFTTDETIKNHYKANS----GSVLVIIPERYYTSYEPKWKVFE-IKEDTKPDEITKFIVDNEFPLVGSMDSNNQARYAK--RSPLCLFFYDVDWGFDHREATQMWRKKIASIAKDFRN-ITFAVADEEKNMQMLKELGLEDSSEEINIGILA-NGKKYPMEPMEEFDPDEVREFLNQFLKGKVEPHIKSQPVPKK--QEGPVTIVVGKSFDKIVKDTSKDVLIELYAPWCGHCKKLEPVYKDLAKKLKSVKNLVIAKMDATANDVPYNYPAEGFPTIYFAPTNN--------------KDKPLKYEGGR----ELKDFI 609          

HSP 2 Score: 126.331 bits (316), Expect = 2.030e-26
Identity = 56/113 (49.56%), Postives = 80/113 (70.80%), Query Frame = 3
Query:  159 PIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMK-KVGSP 494
            P    V VL  ENF E ++   +++VEFYAPWCGHCKQL P Y KAA QL+++  PI+L KVDATVE++LA+++G++GYPTLK+F+    +DY   R    I+++M+ + G P
Sbjct:  158 PEPEAVVVLTQENFTEVVSREELMLVEFYAPWCGHCKQLAPKYEKAAKQLRQSEYPIILAKVDATVETDLAAQYGVNGYPTLKVFRKGRQFDYKGQRETYDIISYMESQRGDP 270          
BLAST of Protein disulfide-isomerase A4 vs. TrEMBL
Match: A0A3Q3NC75 (Protein disulfide-isomerase A4 OS=Mastacembelus armatus OX=205130 PE=3 SV=1)

HSP 1 Score: 432.565 bits (1111), Expect = 2.950e-139
Identity = 245/612 (40.03%), Postives = 359/612 (58.66%), Query Frame = 3
Query:  150 GEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL---KDEL 1967
             E+  ++ V +L   N+D FI   + V+VEFYAPWCGHCKQ  P Y + A  LK N+PPI + KVDATV SELA RF +SGYPT+KI K   P DYD  R+E AIV+ MK+V  PDW+PP    L LTK+NF E V  +  ILVEF+APWCGHCK LAPE+ KAAK LS  +PPI LA VDATVE D+A  + V+GYPTLK+F+    F DY+GPR   GIVD+M +      K V ++   +  +++    +++G+FSSE D  +  F++A N  REDF+  +SFS E+  L  A      G +++++PE   + YEP       +  + +  EV  F +K++ P+V +         ++  K+ L + ++ VDFS  +K AT+ W  K+ ++A ++  +  FAIAD+E  S++L+ L L +SGEE+NVG + E + K+ M   +EF SE +  F+ +   GK+ PI+KS P+PK+  ++G +  VVG T+ E++ D   + L+  Y   C  C+ L  + L+        K+L    MD + ND+P  S  + E F PT+ F   ++   P        +KF G       +  F+ K++  L   +DEL
Sbjct:   53 AEVKEENGVLILTDSNYDTFIEGKDTVLVEFYAPWCGHCKQFAPEYERIAQTLKDNDPPIPVAKVDATVASELAKRFEVSGYPTIKILKKGEPVDYDGERTEKAIVDRMKEVAQPDWKPPPEVTLVLTKDNFDETVNKADIILVEFYAPWCGHCKRLAPEYEKAAKELSQRSPPIPLAKVDATVENDIATRFGVTGYPTLKIFRKGKVF-DYNGPREKYGIVDYMSEQAGPPTKQVQAVKQVQELIKDGDDAIIVGIFSSEQDAAYEIFLEACNTLREDFTFRHSFSSEVAKLLKAKP----GQVVIVQPEKFHSKYEPASHTLT-VKDSTSVSEVQEFFKKHVIPLVGQRKPSNDA--KRYTKRPLVVVYYGVDFSFDYKKATQYWRSKVLEVAKDFP-EYTFAIADEEDYSEELKSLGLSESGEEVNVGLLAEGNKKFAMEP-EEFQSEVLHDFVMAFKKGKLKPIIKSQPVPKS--NKGPVKVVVGKTFDEIVMDTQKDVLIEFYAPWCGHCKKLEPDYLALGKKYKGEKNLVIAKMDSTANDVPNES-YKVEGF-PTIYFAPSNSKQSP--------VKFEGGDRTVEGLSKFLEKHATKLSQKRDEL 642          
BLAST of Protein disulfide-isomerase A4 vs. TrEMBL
Match: A0A3Q1IHZ9 (Protein disulfide-isomerase A4 OS=Anabas testudineus OX=64144 PE=3 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 2.211e-138
Identity = 241/602 (40.03%), Postives = 357/602 (59.30%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVLKDE 1964
            + V VLN +NFD FI   + V+VEFYAPWCGHCKQ  P Y K A  LK+N+PPI + KVDATV +++AS+F +SGYPT+KI K   P DYD  R+E AIV  +K+V  PDW+PP    L LT +NF E V ++  ILVEF+APWCGHCK LAPE+ KAAK LS  +PPI LA VDATVE ++A  + V+GYPTLK+F+    F DY+GPR   GIVD+M +     +K V ++   +  +++    +++G+FSSE D  + ++I+A N  REDF+  +SFS E+  L  A+     G I++++PE  R+ YEP       +  + +  EV  F +K+  P+V     +     ++  K+ L + ++ VDFS  ++ AT+ W  K+ ++A  +  +  FAIAD+E  +D+L+ L L +SGEE+NVG + +   K+ M   +EFDSE +R F+ +   GK+ PI+KS P+PK   ++G +  VVG T+ E++ D   + L+  Y   C  C+ L  + L+        K+L    MD + ND+ P    + E F PT+ F   ++   P        +KF G       +  F+ K++  L  E
Sbjct:   34 NGVLVLNDKNFDTFIEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQALKENDPPIPVAKVDATVATQVASKFDVSGYPTIKILKKGEPVDYDGDRTEKAIVERVKEVAQPDWKPPPEATLVLTTDNFDETVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSERSPPIPLAKVDATVENEIASRFGVTGYPTLKIFRKGKVF-DYNGPREKYGIVDYMAEQAGPPSKQVQAVKQVQELIKDGDDAVIVGVFSSEEDPAYESYIEACNALREDFTFRHSFSSEVAKLLKASP----GQIVIVQPEKFRSKYEPALHTLT-VKDSTSVSEVQEFFKKHAIPLVGHR--KPSNDAKRYTKRPLVVAYYGVDFSFDYRKATQFWRSKVLEVAKEFP-EYTFAIADEEDYADELKSLGLSESGEEVNVGILADGGKKFAMEP-EEFDSEVLRDFVIAFKKGKLKPIIKSQPVPKN--NKGPVKVVVGKTFDEIVMDTQKDVLIEFYAPWCGHCKKLEPDYLALGKKYKGEKNLVIAKMDTTANDV-PNENYKVEGF-PTIYFAPSNSKQSP--------VKFEGGDRTVEGLSKFLEKHATKLSQE 613          
BLAST of Protein disulfide-isomerase A4 vs. TrEMBL
Match: A0A060XVD8 (Protein disulfide-isomerase A4 OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00023731001 PE=3 SV=1)

HSP 1 Score: 429.483 bits (1103), Expect = 3.630e-138
Identity = 244/613 (39.80%), Postives = 363/613 (59.22%), Query Frame = 3
Query:  147 LGEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL---KDEL 1967
            L E+  ++ V VLN +NFD F+   + V+VEFYAPWCGHCKQ    Y K A+ LK+N+PPI + KVDAT  S L SRF +SGYPT KI K   P +YD +R+E  IV  + +V  PDW+PP    L LTK+NF E+V S+  ILVEF+APWCGHCK LAPE+ KAAK LS  +PPI LA VDAT E D+A  + VSGYPTLK+F+    F DY+GPR   GIVD+M +     +K V ++   +  +++    +++G+FSSE D+ +  +++A N+ REDF  +++FS ++  L  A+       ++++ PE  R+ YE D      +  +    EV +F +K++ P+V     +     ++  K+ L + ++ VDFS  ++ AT+ W  K+ ++A ++  +  FAIAD+E  SD+L+ L L DSGEE+NVG +G+   K+ M   DEFDSE +R F+ +   GK+ PI+KS P+PK   ++G +T VVG T+ +++ D   + L+  Y   C  C+ L  +  +      S K+L    MD + ND+P  S  + E F PT+ F   ++   P        IKF G          F+ +++  L   +DEL
Sbjct:   49 LTEVKDENGVLVLNDDNFDMFMEGKDTVLVEFYAPWCGHCKQFASEYEKIALTLKENDPPIPVAKVDATKSSSLGSRFEVSGYPTFKIMKKGEPVEYDGARNEQDIVARVMEVAQPDWKPPPEATLVLTKDNFDEVVNSADIILVEFYAPWCGHCKQLAPEYEKAAKALSQRSPPISLAKVDATQENDIANRFGVSGYPTLKIFRKGKAF-DYNGPREKIGIVDYMSEQAGPPSKQVQTVKQVQELIKDGDDAVIVGVFSSEQDMTYDLYLEACNILREDFKFLHTFSSDVAKLLKASP----SQVVMVHPEKFRSKYERDSYTLT-IKDSTEMSEVQAFFKKHILPLVGHR--KQSNDAKRYTKRPLVVVYYGVDFSFDYRKATQFWRSKVLEVAKDFP-EYTFAIADEEDYSDELKSLGLSDSGEEVNVGILGDGGKKFAMEP-DEFDSEVLRDFIMAFKKGKLKPIVKSQPVPKN--NQGPVTVVVGKTFDDIVMDTKKDVLIEFYAPWCGHCKKLEPDYTALGKKYKSEKNLVIAKMDATANDVPHDS-YKTEGF-PTIYFAPSNSKQSP--------IKFEGGDRTIEGFSKFLEQHATKLSQSRDEL 639          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Cavefish
Match: pdia4 (protein disulfide isomerase family A member 4 [Source:NCBI gene;Acc:103026638])

HSP 1 Score: 426.787 bits (1096), Expect = 1.978e-140
Identity = 242/610 (39.67%), Postives = 360/610 (59.02%), Query Frame = 3
Query:  153 EIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL---KDEL 1967
            E+  ++ V VL   NFD F+   + V+VEFYAPWCGHCKQ  P Y K A  LK+++PPI + KVDAT  + L SRF +SGYPT+KI K   P +YD  RSE AIV  +K+V  PDW+PP    L LTK+NF ++V ++  ILVEF+APWCGHCK LAPE+ KAAK LSN  PPI LA VDATVE DLA  + V+GYPTLK+F+    F DY+GPR   GIVD+M +     +K V ++   +  +++    L++G+FSSE D ++  + +A N  R+D+   ++FS EI     A+     G +++L+PE  R+ +EP    F  +  + +  E+  F +K+  P+V           ++  K+ L + ++ VDFS  ++ AT+ W  K+ ++A+++  +  FAIAD+E  +D+L+ L L +SGEE+NV  +GE   KY M   +EFD+E +R+F+ +   GK+ PI+KS P+PK      +  +VG T+ E++ D   + L+  Y   C  C+ L  + L+      + K+L    MD + ND+P  S  + E F PT+ F   +   +P        IKF G + N      FI +++  L   +DEL
Sbjct:   56 EVKEENGVLVLTDANFDTFMEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQVLKESDPPIPVAKVDATKATALGSRFEVSGYPTIKILKKGEPVEYDGDRSEKAIVERVKEVAQPDWKPPPEATLVLTKDNFDDVVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSNRTPPILLAKVDATVENDLASRFDVTGYPTLKMFRKGKVF-DYNGPREKIGIVDYMSEQAGPPSKQVQALKQIQELLKDGDDALIVGVFSSEEDAVYEIYQEACNTLRDDYKFRHTFSSEIVKFLKASP----GQVVMLQPEKFRSKHEPSSYSFT-IKDSTSASELQDFFKKHTLPLVGHRKQSNDA--KRYTKRPLVVVYYGVDFSFDYRVATQFWRSKVLEVAMDFP-EYTFAIADEEDYADELKSLGLSESGEEVNVAILGEGGKKYAMEP-EEFDTEVLREFVVAFKKGKLKPIIKSQPVPKN--KGPVKVIVGKTFDEIVLDKKKDVLIEFYAPWCGHCKKLEPDYLALAKKYKNEKNLVIAKMDATANDVPHDS-YKVEGF-PTIYFAPSNNKQNP--------IKFEGGERNVEGFSKFIEEHATKLSQTRDEL 643          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Cavefish
Match: pdia3 (protein disulfide isomerase family A member 3 [Source:NCBI gene;Acc:103022595])

HSP 1 Score: 182.956 bits (463), Expect = 5.459e-50
Identity = 128/428 (29.91%), Postives = 212/428 (49.53%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ---IQFAIADDERQSDKLRELRLDDSGEEIN-VGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMP 1784
            V+  T ++F   +     ILVEFFAPWCGHCK LAPE+  AA  L  +   + LA VD T  +++  +Y VSGYPTLK+F++      Y GPR++DGIV  + K    A+  + ++ DF      +   ++G F+       + F+ + +  RE +   ++ ++   LL  +++ DG G ++L RP  L N +E    KF       T  ++  FI+ N+F +       T+   + L+ K L + ++ VD+  + K  +  W  ++ K+A  + D+   + FA+A+    S  + EL LD SG E+  VG       KY M      D + + +FL     GK+   LKS PIP+   ++G +  VV + +  ++ND   + L+  Y   C  C+SL            +  ++    MD + ND+P
Sbjct:   19 VIEFTDDDFENKIGDHDLILVEFFAPWCGHCKRLAPEYEAAATRLKGI---VSLAKVDCTANSNVCSKYGVSGYPTLKIFRDGEESGAYDGPRTADGIVSHLKKQAGPASVELKTVADFEKFIGDRDASVVGFFADGGSAAQSEFLKSASALRESYR--FAHTNLEDLLKKSDI-DGEG-VVLFRPPRLNNKFEESSVKFSE--DKFTNAKIKRFIQDNIFGMCPHM---TEDNKDHLKGKDLLVAYYDVDYDKNPK-GSNYWRNRVMKVAKGFLDEGKKLSFAVANKNSFSHDVSELGLDASGGELPVVGIRTAKGDKYVMQEEFSRDGKALERFLQDYFDGKLKRYLKSEPIPEN--NDGPVKVVVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKLANDPNVVIAKMDATANDVP 431          

HSP 2 Score: 100.523 bits (249), Expect = 6.223e-22
Identity = 60/163 (36.81%), Postives = 87/163 (53.37%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYD-YDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKIL 653
            S+V     ++F+  I  +++++VEF+APWCGHCK+L P Y  AA +LK     + L KVD T  S + S++G+SGYPTLKIF+       YD  R+   IV+ +KK   P        V   T  +F + +      +V FFA      +S   EF K+A  L
Sbjct:   17 SDVIEFTDDDFENKIGDHDLILVEFFAPWCGHCKRLAPEYEAAATRLKG---IVSLAKVDCTANSNVCSKYGVSGYPTLKIFRDGEESGAYDGPRTADGIVSHLKKQAGP------ASVELKTVADFEKFIGDRDASVVGFFADGGSAAQS---EFLKSASAL 167          

HSP 3 Score: 79.337 bits (194), Expect = 4.792e-15
Identity = 46/129 (35.66%), Postives = 73/129 (56.59%), Query Frame = 3
Query:  129 GFFKNILGEIPI----DSNVYVLNSENFDEFINANNI-VMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL---KIFKSSIPYDYDDSRSESAIVNFMKKVGS 491
            G  K  L   PI    D  V V+ +ENFD  +N ++  V++EFYAPWCGHCK L P Y +   +L  N+P +++ K+DAT  +++ S + + G+PT+      +   P  Y+  R  S  ++++KK  S
Sbjct:  348 GKLKRYLKSEPIPENNDGPVKVVVAENFDSIVNDDSKDVLIEFYAPWCGHCKSLEPKYKELGEKL-ANDPNVVIAKMDATA-NDVPSSYDVRGFPTIYFSPAGQKQNPKRYEGGREVSDFISYLKKEAS 474          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Cavefish
Match: pdia8 (protein disulfide-isomerase A3-like [Source:NCBI gene;Acc:103028648])

HSP 1 Score: 181.415 bits (459), Expect = 1.886e-49
Identity = 138/485 (28.45%), Postives = 230/485 (47.42%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMS---FIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ-IQFAIADDERQSDKLRELRLDDSGEEINVGCIG-ENDMKYRMSAMDEF--DSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSK 1949
            V+ LT  +F  +      +LV+F+APWCGHCK LAPEF  AAK L  +   + LA VD T  T++   + V+GYPTLK+F+N      Y GPRS+ GIVD M K     +  + +  D     N     ++G+F S +      F+   NL RE F   ++   ++ L Y+   +     I+L RP  L + +E      + + S+  PF V +   FI  N+F I       TK  +++L K+ L   ++ +D+ +H+   +  W  ++ K+A  Y  + + F++A+ +   D+L E     S E   V  +     + ++ S  +EF  D + + +FL+   A  +   +KS P+P    +  +  VV DT++E++ND   + L+  Y   C  C+ L            S  ++    MD + ND+P   G +   F PT+ F+     ++P      + +K   + L      S +LK  K
Sbjct:   28 VVELTDVDFDYVAAEHETMLVKFYAPWCGHCKKLAPEFETAAKRLKGV---VTLAKVDCTSSTEVCGRFGVTGYPTLKIFRNGRESSSYDGPRSAVGIVDQMKKQAGPDSVPLHNEKDLETFVNHYDASVVGVFESSDSPQLVEFLKGANLMRESFRFAHTTDLQLGLKYNLTSE----GILLFRPPRLASKFE------ESVVSHTGPFSVTALRRFIRDNIFGICPHL---TKENIDQLRKRDLLTAYYDLDY-VHNPKGSNYWRNRVMKVASQYSSRGLLFSVANRKDFEDELEEDYGLGSTEGSEVPFVTIRTRLGHKYSMREEFTRDGKSLERFLEDYYANSLKRYIKSEPVPAKN-NGPVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTELGQELSSDPNIVIAKMDATANDVP--EGYDVHGF-PTIYFVPAGRKAEPKRYEGAREVKDFLNFLKREATSSLVLKGVK 491          

HSP 2 Score: 102.449 bits (254), Expect = 1.640e-22
Identity = 53/123 (43.09%), Postives = 71/123 (57.72%), Query Frame = 3
Query:  150 GEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSI-PYDYDDSRSESAIVNFMKKVGSPDWQPPKN 515
            G +   S+V  L   +FD     +  ++V+FYAPWCGHCK+L P +  AA +LK     + L KVD T  +E+  RFG++GYPTLKIF++      YD  RS   IV+ MKK   PD  P  N
Sbjct:   20 GSVSARSDVVELTDVDFDYVAAEHETMLVKFYAPWCGHCKKLAPEFETAAKRLKG---VVTLAKVDCTSSTEVCGRFGVTGYPTLKIFRNGRESSSYDGPRSAVGIVDQMKKQAGPDSVPLHN 139          

HSP 3 Score: 74.7146 bits (182), Expect = 1.383e-13
Identity = 39/115 (33.91%), Postives = 70/115 (60.87%), Query Frame = 3
Query:  156 IPIDSN--VYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIF---KSSIPYDYDDSRSESAIVNFMKK 482
            +P  +N  V V+ ++ F+E +N     V++EFYAPWCGHCK+L P YT+   +L  ++P I++ K+DAT  +++   + + G+PT+      + + P  Y+ +R     +NF+K+
Sbjct:  367 VPAKNNGPVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTELGQEL-SSDPNIVIAKMDATA-NDVPEGYDVHGFPTIYFVPAGRKAEPKRYEGAREVKDFLNFLKR 479          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Cavefish
Match: pdia7 (protein disulfide-isomerase A3-like [Source:NCBI gene;Acc:103024123])

HSP 1 Score: 176.407 bits (446), Expect = 1.228e-47
Identity = 126/426 (29.58%), Postives = 209/426 (49.06%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ-IQFAIADDERQSDKL-RELRLDDSGEEINVGCI-GENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMP 1784
            VL L   +F   +E    +LVEFFAPWCGHC+ LAPE+  AA   + L   + LA VD TV +   + + V+GYPTLK+F+N      Y GPR++DGIV +M K    ++  + S  D  +  N     ++G FS  + L    F+ A++  R+ +   ++   +I L +  N +    S++L RP +L + +E    KF     +V+   + +FI  N+F +        K   E L  + L   ++ VD+ + +   T  W  ++ K+A  ++ + + FA+AD     D+L  E  L  SG E+ V  I      KY M      D + + KFL+   A ++ P +KS   P++     +  VV +T++E++N+   + L+  Y   C  C++L            S  ++    MD + ND+P
Sbjct:   22 VLELGDADFQVGLEEHDTLLVEFFAPWCGHCQRLAPEYEAAA---TRLKGTVSLAKVDCTVNSKTCETFVVNGYPTLKIFQNGEEASSYDGPRTADGIVSYMKKQAGPSSVPLHSEADLDSFINTFDASVVGFFSGPDSLQLAEFLKASSALRDSYRFAHATDLKIGLKHGVNSE----SVLLFRPPHLNSKFEESVVKF---TESVSTAALRTFIRDNIFGLCPHLTSENK---EVLWARDLLTAYYDVDY-VRNPKGTNYWRNRVMKVATQFQSRGLSFAVADQVDFLDELEEEFGLGLSGGELPVITIRTRAGQKYTMQEEFTRDGKSLEKFLEDYFAKRLKPYVKSEAAPESNGGP-VKVVVANTFEEIVNNPEKDVLVEFYAPWCGHCKNLEPKYTELGKKLSSDPNIVIAKMDATANDVP 432          

HSP 2 Score: 92.8189 bits (229), Expect = 2.316e-19
Identity = 47/114 (41.23%), Postives = 66/114 (57.89%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSS-IPYDYDDSRSESAIVNFMKKVGSPDWQP 506
            S V  L   +F   +  ++ ++VEF+APWCGHC++L P Y  AA +LK     + L KVD TV S+    F ++GYPTLKIF++      YD  R+   IV++MKK   P   P
Sbjct:   20 SEVLELGDADFQVGLEEHDTLLVEFFAPWCGHCQRLAPEYEAAATRLKGT---VSLAKVDCTVNSKTCETFVVNGYPTLKIFQNGEEASSYDGPRTADGIVSYMKKQAGPSSVP 130          

HSP 3 Score: 71.633 bits (174), Expect = 1.071e-12
Identity = 39/107 (36.45%), Postives = 63/107 (58.88%), Query Frame = 3
Query:  174 VYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL---KIFKSSIPYDYDDSRSESAIVNFMKK 482
            V V+ +  F+E +N     V+VEFYAPWCGHCK L P YT+   +L  ++P I++ K+DAT  +++   + + G+PT+      +   P  Y+  R  S  ++F+KK
Sbjct:  368 VKVVVANTFEEIVNNPEKDVLVEFYAPWCGHCKNLEPKYTELGKKL-SSDPNIVIAKMDATA-NDVPLDYDVQGFPTIYFAPAGQKEQPRRYEGGREVSDFISFLKK 472          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Cavefish
Match: pdia8 (protein disulfide-isomerase A3-like [Source:NCBI gene;Acc:103028648])

HSP 1 Score: 175.252 bits (443), Expect = 2.851e-47
Identity = 126/430 (29.30%), Postives = 209/430 (48.60%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMS---FIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ-IQFAIADDERQSDKLRELRLDDSGEEINVGCIG-ENDMKYRMSAMDEF--DSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMP 1784
            V+ LT  +F  +      +LV+F+APWCGHCK LAPEF  AAK L  +   + LA VD T  T++   + V+GYPTLK+F+N      Y GPRS+ GIVD M K     +  + +  D     N     ++G+F S +      F+   NL RE F   ++   ++ L Y+   +     I+L RP  L + +E      + + S+  PF V +   FI  N+F I       TK  +++L K+ L   ++ +D+ +H+   +  W  ++ K+A  Y  + + F++A+ +   D+L E     S E   V  +     + ++ S  +EF  D + + +FL+   A  +   +KS P+P    +  +  VV DT++E++ND   + L+  Y   C  C+ L            S  ++    MD + ND+P
Sbjct:   28 VVELTDVDFDYVAAEHETMLVKFYAPWCGHCKKLAPEFETAAKRLKGV---VTLAKVDCTSSTEVCGRFGVTGYPTLKIFRNGRESSSYDGPRSAVGIVDQMKKQAGPDSVPLHNEKDLETFVNHYDASVVGVFESSDSPQLVEFLKGANLMRESFRFAHTTDLQLGLKYNLTSE----GILLFRPPRLASKFE------ESVVSHTGPFSVTALRRFIRDNIFGICPHL---TKENIDQLRKRDLLTAYYDLDY-VHNPKGSNYWRNRVMKVASQYSSRGLLFSVANRKDFEDELEEDYGLGSTEGSEVPFVTIRTRLGHKYSMREEFTRDGKSLERFLEDYYANSLKRYIKSEPVPAKN-NGPVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTELGQELSSDPNIVIAKMDATANDVP 439          

HSP 2 Score: 102.449 bits (254), Expect = 1.631e-22
Identity = 53/123 (43.09%), Postives = 71/123 (57.72%), Query Frame = 3
Query:  150 GEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSI-PYDYDDSRSESAIVNFMKKVGSPDWQPPKN 515
            G +   S+V  L   +FD     +  ++V+FYAPWCGHCK+L P +  AA +LK     + L KVD T  +E+  RFG++GYPTLKIF++      YD  RS   IV+ MKK   PD  P  N
Sbjct:   20 GSVSARSDVVELTDVDFDYVAAEHETMLVKFYAPWCGHCKKLAPEFETAAKRLKG---VVTLAKVDCTSSTEVCGRFGVTGYPTLKIFRNGRESSSYDGPRSAVGIVDQMKKQAGPDSVPLHN 139          

HSP 3 Score: 64.3142 bits (155), Expect = 2.295e-10
Identity = 32/83 (38.55%), Postives = 54/83 (65.06%), Query Frame = 3
Query:  156 IPIDSN--VYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGY 395
            +P  +N  V V+ ++ F+E +N     V++EFYAPWCGHCK+L P YT+   +L  ++P I++ K+DAT  +++   + + GY
Sbjct:  367 VPAKNNGPVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTELGQEL-SSDPNIVIAKMDATA-NDVPEGYDVHGY 447          

HSP 4 Score: 61.2326 bits (147), Expect = 2.061e-9
Identity = 37/99 (37.37%), Postives = 56/99 (56.57%), Query Frame = 3
Query:  453 ESAIVNFMKKVGSPDWQPPKNY--VLTLTKENFTEIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGY 740
            E    N +K+    +  P KN   V  +  + F EIV +    +L+EF+APWCGHCK L P++ +  + LS+ +P I +A +DAT   D+ + Y V GY
Sbjct:  351 EDYYANSLKRYIKSEPVPAKNNGPVKVVVADTFEEIVNDPEKDVLIEFYAPWCGHCKKLEPKYTELGQELSS-DPNIVIAKMDATA-NDVPEGYDVHGY 447          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Sea Lamprey
Match: pdia4 (protein disulfide isomerase family A, member 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5493])

HSP 1 Score: 395.971 bits (1016), Expect = 2.719e-129
Identity = 240/608 (39.47%), Postives = 352/608 (57.89%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEY--DFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI-XXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL--KDEL 1967
            ++ V +L   NFD F+   + V++EFYAPWCGHCK+    Y K A +L +N+PPI + KVDATV   LA RF +SGYPT+KI K     DYD  R++ AI+  +K+V SPDW+PP   VLTLT+ NF EIV  +  ILVEF+APWCGHCK LAPE+ KAA+ LS   PPI LA VDATVE++L K + VSGYPTLKLF+    + DY+GPR   GIV  MI+    A++ + S+      VQN   V++LG+F +E D+    F +  N  RE+F   ++F + I+    A VD   G +++L PE  ++ YEP    F  + ++ T  ++ +F+EK+  P+V +       K Y     ++ L + F+ VDFS  ++TAT+ W  K+ ++A ++  +  FAIA ++  S +L +L L +SGEE+N   +  +  KY M A +EFD++ +R F+ S   GK+  ++KS P+PK+  ++G +  VVG T+++++ D   + L+  Y   C  C+SL  I           K L    MD + ND+P  S  + E F PT+ F        P        IKF     +   +  FI K++  L  KDEL
Sbjct:   55 ENGVLILKDLNFDFFVAGKDTVLLEFYAPWCGHCKEFASEYEKIAKELAENDPPIPVAKVDATVAVHLAERFSVSGYPTIKILKKGQAVDYDGDRTQDAIIAKVKEVASPDWKPPPEAVLTLTESNFDEIVNDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKNTPPIPLAKVDATVESELGKRFGVSGYPTLKLFRKGKAY-DYNGPREQYGIVSHMIEQAGPASQELKSMKQLNGFVQNGDDVVILGVFKNEQDVALQLFQETGNNVREEFKFYHTFEENIKNHLKA-VD---GQVVVLHPERFQSKYEPKQFTFD-IQADSTDSDLKAFVEKHSVPLVGQRKPSNEAKRY---ASRRPLVVVFYGVDFSFDYRTATQFWRSKVLEVAKDFP-KFTFAIASEDDYSKELSDLGLAESGEEVNAAILDASGKKYAM-APEEFDADVLRDFVISFEKGKLKAVVKSQPLPKS--NKGPVKVVVGRTFEQMVLDNSKDVLIEFYAPWCGHCKSLEPIYKDLGKKYKGHKGLVIAKMDATVNDIPHDS-YKAEGF-PTIYFSPSGAKDRP--------IKFADGSRDLESLSKFIEKHATKLSIKDEL 639          

HSP 2 Score: 140.584 bits (353), Expect = 3.032e-35
Identity = 64/115 (55.65%), Postives = 77/115 (66.96%), Query Frame = 3
Query:  159 PIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQ 503
            P    V  L   NFDE +N  +I++VEFYAPWCGHCK+L P Y KAA +L KN PPI L KVDATVESEL  RFG+SGYPTLK+F+    YDY+  R +  IV+ M +   P  Q
Sbjct:  168 PPPEAVLTLTESNFDEIVNDADIILVEFYAPWCGHCKKLAPEYEKAAQELSKNTPPIPLAKVDATVESELGKRFGVSGYPTLKLFRKGKAYDYNGPREQYGIVSHMIEQAGPASQ 282          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Sea Lamprey
Match: pdia3 (protein disulfide isomerase family A, member 3 [Source:ZFIN;Acc:ZDB-GENE-031002-9])

HSP 1 Score: 162.54 bits (410), Expect = 2.332e-43
Identity = 128/453 (28.26%), Postives = 222/453 (49.01%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ---IQFAIADDERQSDKLRELRLDDSGEEINVGCIGE-NDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYE-RFQPTVNFI-MDSTDS 1853
            VL LT  +F   V     +LVEFFAPWCGHCK LAPE+ KAA  L N    + LA VD T  T+   ++ VSGYPTLK+F++     DY GPR++DGIV ++ K    ++  + ++ D           ++G F   +    T F+   +  R+++   +S    ++ + D    +   +I++ RP  L + +E   T+  +   + +  ++ +FI+ N+  I        K   +  + K L + ++ VD++ + K  +  W  ++ K+A  + ++   + +AIA+ +    +L +  L+    ++ V  I + N  KY +      D + +  FL     GK+   LKS PIP+   ++G +  VV + + EL+ND   + L+  Y   C  C++L    L       +  ++    MD + ND+P     +Y+ R  PT+ F  M S DS
Sbjct:   27 VLDLTDADFASKVAGHDMVLVEFFAPWCGHCKRLAPEYEKAATKLKNT---VALAKVDCTANTETCNKFGVSGYPTLKIFRDGELSSDYDGPRTADGIVGFLKKQAGPSSVELKTVEDLEKFVGDNDPSIVGFFKDASSDAQTEFMKVASSQRDNYRFAHS---NVQAVLDKQGAE--EAIVVFRPLRLASKFEE--TQVTYAEDSYSSAKIKAFIQDNILGICPHLTDDNK---DLFKGKDLLVAYYDVDYTKNPK-GSNYWRNRVMKVAKKFIEEGHTLSYAIANHKDFGQQLSDYGLEHVSGDVPVVAIKKSNGDKYILREEFTRDGKSLENFLQDYFDGKLKKHLKSEPIPED--NDGPVKVVVAEIFDELVNDESKDVLIEFYAPWCGHCKNLEPKYLELADKLKNDPNILIAKMDATANDVP----AQYDVRGFPTIYFSPMGSKDS 459          

HSP 2 Score: 107.457 bits (267), Expect = 9.232e-25
Identity = 61/159 (38.36%), Postives = 87/159 (54.72%), Query Frame = 3
Query:  171 NVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFK-SSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAA 644
            +V  L   +F   +  +++V+VEF+APWCGHCK+L P Y KAA +LK     + L KVD T  +E  ++FG+SGYPTLKIF+   +  DYD  R+   IV F+KK   P      + V   T E+  + V  +   +V FF       ++   EF K A
Sbjct:   26 DVLDLTDADFASKVAGHDMVLVEFFAPWCGHCKRLAPEYEKAATKLKNT---VALAKVDCTANTETCNKFGVSGYPTLKIFRDGELSSDYDGPRTADGIVGFLKKQAGP------SSVELKTVEDLEKFVGDNDPSIVGFFKDASSDAQT---EFMKVA 172          

HSP 3 Score: 80.8777 bits (198), Expect = 2.580e-16
Identity = 47/126 (37.30%), Postives = 74/126 (58.73%), Query Frame = 3
Query:  129 GFFKNILGEIPI----DSNVYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL---KIFKSSIPYDYDDSRSESAIVNFMKK 482
            G  K  L   PI    D  V V+ +E FDE +N  +  V++EFYAPWCGHCK L P Y + A +L KN+P IL+ K+DAT  +++ +++ + G+PT+    +     P  Y+  R  S  ++++K+
Sbjct:  355 GKLKKHLKSEPIPEDNDGPVKVVVAEIFDELVNDESKDVLIEFYAPWCGHCKNLEPKYLELADKL-KNDPNILIAKMDATA-NDVPAQYDVRGFPTIYFSPMGSKDSPKKYEGGREVSDFISYLKR 478          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006474.1 (pep scaffold:Pmarinus_7.0:GL478000:14574:47610:1 gene:ENSPMAG00000005827.1 transcript:ENSPMAT00000006474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 147.517 bits (371), Expect = 5.032e-38
Identity = 83/234 (35.47%), Postives = 125/234 (53.42%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQL--KKNNPPILLGKVDATVESELASRFGISGYPTLKIFK-SSIPYDYDDSRSESAIVNFMK-----KVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVE--TDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNR 836
            DS V+ L  E+F +F++ +  V+V FYAPWCGHCK+L P Y +AA  L  ++ N P +L  VDAT+   LA RF I G+PT+K F+     Y   D RS+  I+++++           W   +N V  L+   F E ++   + L+ F+APWC HCK   P F  AA  L   +  + LA VD T +   +L  +  V GYPT+  +    F   Y+G R     +++++  R
Sbjct:  277 DSAVFHLTDEDFQDFVDKHPNVLVMFYAPWCGHCKKLKPDYDEAAKILNNEEENSPGVLAAVDATIHRALAERFAIKGFPTMKFFQDGEEKYTVSDLRSKDKILSWIRDPQPPPPPEVPWDEQENDVAHLSVATFREFLKKKRHALLMFYAPWCFHCKQAKPHFTAAAAQLRE-DHKVALAAVDCTKQDNNELCSQEGVRGYPTMNHYTYGKFVGPYTGGRQEADFINFLLSLR 509          

HSP 2 Score: 135.191 bits (339), Expect = 6.749e-34
Identity = 77/211 (36.49%), Postives = 117/211 (55.45%), Query Frame = 3
Query:  228 VMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLG-KVDATVESELASRFGISGYPTLKIF-KSSIPYDYDDSRSESA-IVNFMKKVGSPD-------WQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSN--LNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWM 824
            +++ FYAPWCG CK++ P++ +AA   KK    +L G  V       + S + ++GYPT   F K    ++Y    +++  IV ++K   SP        W    + V  LT E+F + V+    +LV F+APWCGHCK L P++ +AAKIL+N   N P  LA VDAT+   LA+ + + G+PT+K F++       S  RS D I+ W+
Sbjct:  175 ILMMFYAPWCGVCKRMKPVFQEAATMAKKTY--VLAGMNVHPAEFDGIKSDYNVTGYPTFCYFEKGKFRFNYQSYGAQAKDIVEWLKNPESPKPTVPEVAWSETDSAVFHLTDEDFQDFVDKHPNVLVMFYAPWCGHCKKLKPDYDEAAKILNNEEENSPGVLAAVDATIHRALAERFAIKGFPTMKFFQDGEEKYTVSDLRSKDKILSWI 383          

HSP 3 Score: 60.4622 bits (145), Expect = 7.447e-10
Identity = 47/158 (29.75%), Postives = 79/158 (50.00%), Query Frame = 3
Query:  432 DYDDSRSESAIVNFM-KKVGSPDWQP---PKNYVLTLTKENFTEIVESSGY-ILVEFFAPWCGHCKSLAPEFAKAAK------ILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYS--GPRSSDGIVDWMIKNRENAAKAVSSI 866
            +YD + +  ++V FM    G P W+     K+ V   + + F  +++     IL+ F+APWCG CK + P F +AA       +L+ +N  +  A  D      +  +Y+V+GYPT   F+   F  +Y   G ++ D IV+W+ KN E+    V  +
Sbjct:  123 EYDRAETFKSLVAFMYDPTGDPLWEEEPDAKDVVHVHSDKEFRLLLKKEERPILMMFYAPWCGVCKRMKPVFQEAATMAKKTYVLAGMN--VHPAEFDG-----IKSDYNVTGYPTFCYFEKGKFRFNYQSYGAQAKD-IVEWL-KNPESPKPTVPEV 271          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Sea Lamprey
Match: pdia6 (protein disulfide isomerase family A, member 6 [Source:ZFIN;Acc:ZDB-GENE-030131-879])

HSP 1 Score: 142.51 bits (358), Expect = 7.117e-37
Identity = 88/253 (34.78%), Postives = 132/253 (52.17%), Query Frame = 3
Query:  171 NVYVLNSENFD-EFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFK--SSIPYDYDDSRSESAIV----------------------------NFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAA-KILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRSSDGIVDWMIK 830
            +V  L + NF+ E + +N++ +VEFYAPWCGHC++L P + KAA  LK     + LG VDA     L S + + G+PT+KIF    + P D++  R+   IV                            N     G    +P    ++T  K  FT     S   +VEFFAPWCGHCK L PE+A AA ++ +  N  ++LA VDATV  +L+  + + G+PT+K+F K ++   +Y G R+   IV + ++
Sbjct:   26 DVIELTASNFNREVVQSNDLWLVEFYAPWCGHCQRLIPEWKKAATALKG---IVKLGAVDADEHKGLGSTYNVRGFPTIKIFGINKNKPEDFNGGRTTQGIVDGALGALRSLVKDRLGGKGGSDSGKQNINTFSGNGFCKRKPVSFSIITTNKITFT----PSETWIVEFFAPWCGHCKKLEPEWAAAATEVKAQTNGRVKLAAVDATVNQELSNRFGIRGFPTIKVFRKGEDEPQEYQGGRTKSDIVAYALE 271          

HSP 2 Score: 95.9005 bits (237), Expect = 3.504e-21
Identity = 49/106 (46.23%), Postives = 68/106 (64.15%), Query Frame = 3
Query:  507 PKNYVLTLTKENFT-EIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFK-NKNFFVDYSGPRSSDGIVD 818
            P + V+ LT  NF  E+V+S+   LVEF+APWCGHC+ L PE+ KAA  L  +   ++L  VDA     L   Y+V G+PT+K+F  NKN   D++G R++ GIVD
Sbjct:   23 PSDDVIELTASNFNREVVQSNDLWLVEFYAPWCGHCQRLIPEWKKAATALKGI---VKLGAVDADEHKGLGSTYNVRGFPTIKIFGINKNKPEDFNGGRTTQGIVD 125          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Sea Lamprey
Match: txndc5 (thioredoxin domain containing 5 [Source:ZFIN;Acc:ZDB-GENE-040426-1951])

HSP 1 Score: 128.642 bits (322), Expect = 2.391e-32
Identity = 76/208 (36.54%), Postives = 108/208 (51.92%), Query Frame = 3
Query:  234 VEFYAPWCGHCKQLTPIYTKAAVQLKK-NNPPILLGKVDATVESELASRFGISGYPTLKIFK---SSIPY----DYDDSRS-------ESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGI 812
            + F+APWCGHC++L   +     +  +   PP  + KVD T+ ++  S  G+ GYPTLK+FK    SI Y    D D   S       E A V+   +  SPD   P++ +  LT  +F E V + GY  ++FFAPWCGHCK+L P + + A      +  +++A VD T   D+  E  V GYPTL  FK+      Y G R  D +
Sbjct:   62 IMFFAPWCGHCQKLQSTWNTLGDKYNEMPEPPAYVAKVDCTMHAQTCSDHGVKGYPTLKLFKPGQKSILYQGQRDLDTLESWMLQTLNEDAGVHEESERPSPDIPEPQHGLYELTSGSFKEHV-AEGYHFIKFFAPWCGHCKALIPAWEQLASTF-EYSGKVKIAKVDCTAHQDICNENQVRGYPTLLWFKDGEKVDQYRGKRDLDSL 267          

HSP 2 Score: 115.931 bits (289), Expect = 5.100e-28
Identity = 72/234 (30.77%), Postives = 114/234 (48.72%), Query Frame = 3
Query:  171 NVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYD-YDDSRSESAIVNFM--------------KKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMI 827
             +Y L S +F E + A     ++F+APWCGHCK L P + + A   + +   + + KVD T   ++ +   + GYPTL  FK     D Y   R   ++  F+              ++ G    +   + VL L + NF   V + G   V+F+APWCGHCK+LAP +   AK   +    + +A VD T E  L  + HV GYPTL L+       ++ G R+ + +  +++
Sbjct:  171 GLYELTSGSFKEHV-AEGYHFIKFFAPWCGHCKALIPAWEQLASTFEYSGK-VKIAKVDCTAHQDICNENQVRGYPTLLWFKDGEKVDQYRGKRDLDSLKVFVDTQIQIEPEDEVVTQQAGD---EEEASSVLVLNENNFDATV-ADGITFVKFYAPWCGHCKNLAPTWEDLAKKEFSGLSKVTIAKVDCTSEAQLCSKQHVRGYPTLLLYVGGKQVGEHEGTRNLEALHSYVL 398          

HSP 3 Score: 76.2554 bits (186), Expect = 5.372e-15
Identity = 36/82 (43.90%), Postives = 50/82 (60.98%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIF 413
            S+V VLN  NFD  + A+ I  V+FYAPWCGHCK L P +   A +       + + KVD T E++L S+  + GYPTL ++
Sbjct:  295 SSVLVLNENNFDATV-ADGITFVKFYAPWCGHCKNLAPTWEDLAKKEFSGLSKVTIAKVDCTSEAQLCSKQHVRGYPTLLLY 375          

HSP 4 Score: 71.2478 bits (173), Expect = 2.121e-13
Identity = 38/111 (34.23%), Postives = 54/111 (48.65%), Query Frame = 3
Query:  579 VEFFAPWCGHCKSLAPEFAKAAKILSNL-NPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKN-RENAAKAVSSILDFRNVQNPQRVL 905
            + FFAPWCGHC+ L   +       + +  PP  +A VD T+      ++ V GYPTLKLFK     + Y G R  D +  WM++   E+A     S     ++  PQ  L
Sbjct:   62 IMFFAPWCGHCQKLQSTWNTLGDKYNEMPEPPAYVAKVDCTMHAQTCSDHGVKGYPTLKLFKPGQKSILYQGQRDLDTLESWMLQTLNEDAGVHEESERPSPDIPEPQHGL 172          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Yeast
Match: PDI1 (Protein disulfide isomerase; multifunctional oxidoreductase of the ER lumen, essential for disulfide bond formation in secretory and cell-surface proteins, processing of non-native disulfide bonds; Ero1p activator; complexes with exomannosidase, Mnl1p to facilitate the recognition of misfolded glycoproteins and the trimming of glycan Man8GlcNAc2 to Man7GlcNAc2 on substrates, thereby accelerating ERAD; PDI1 has a paralog, EUG1, that arose from the whole genome duplication [Source:SGD;Acc:S000000548])

HSP 1 Score: 115.161 bits (287), Expect = 1.705e-27
Identity = 54/123 (43.90%), Postives = 80/123 (65.04%), Query Frame = 3
Query:  504 PPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNK--NFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSI 866
            P  + V+ L  ++F E ++S   +L EFFAPWCGHCK++APE+ KAA+ L   N  I LA +D T   DL  E+++ G+P+LK+FKN   N  +DY GPR+++ IV +MIK  + A   V+ +
Sbjct:   29 PEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKN--ITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADL 149          

HSP 2 Score: 102.834 bits (255), Expect = 2.092e-23
Identity = 59/149 (39.60%), Postives = 84/149 (56.38%), Query Frame = 3
Query:  159 PIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSI---PYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENF-TEIVESSGYILVEFFA 593
            P DS V  L +++F+E+I ++++V+ EF+APWCGHCK + P Y KAA  L + N  I L ++D T   +L     I G+P+LKIFK+S      DY+  R+  AIV FM K   P      +    L  E F T ++  SG I  +F A
Sbjct:   29 PEDSAVVKLATDSFNEYIQSHDLVLAEFFAPWCGHCKNMAPEYVKAAETLVEKN--ITLAQIDCTENQDLCMEHNIPGFPSLKIFKNSDVNNSIDYEGPRTAEAIVQFMIKQSQPAVAVVADLPAYLANETFVTPVIVQSGKIDADFNA 175          

HSP 3 Score: 70.8626 bits (172), Expect = 2.922e-13
Identity = 43/115 (37.39%), Postives = 65/115 (56.52%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIF---KSSIPYDYDDSRSESAIVNFMKKVGSPD 497
            DS+V+ L  +N DE +N     V+V +YAPWCGHCK+L P Y + A         +L+ K+D T E+++     I GYPT+ ++   K S    Y  SRS  ++ +F+K+ G  D
Sbjct:  375 DSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHT-ENDVRGVV-IEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFIKENGHFD 487          

HSP 4 Score: 69.3218 bits (168), Expect = 9.067e-13
Identity = 46/136 (33.82%), Postives = 73/136 (53.68%), Query Frame = 3
Query:  453 ESAIVNFMKKVGSPD------WQPPKNYVLTLTKENFTEIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKN--KNFFVDYSGPRSSDGIVDWMIKN 833
            ES + +F+K   SP       ++   + V  L  +N  EIV +    +LV ++APWCGHCK LAP + + A   +N    + +A +D T E D+ +   + GYPT+ L+    K+  V Y G RS D + D++ +N
Sbjct:  350 ESLVKDFLKGDASPIVKSQEIFENQDSSVFQLVGKNHDEIVNDPKKDVLVLYYAPWCGHCKRLAPTYQELADTYANATSDVLIAKLDHT-ENDV-RGVVIEGYPTIVLYPGGKKSESVVYQGSRSLDSLFDFIKEN 483          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Yeast
Match: EUG1 (Protein disulfide isomerase of the endoplasmic reticulum lumen; EUG1 has a paralog, PDI1, that arose from the whole genome duplication; function overlaps with that of Pdi1p; may interact with nascent polypeptides in the ER [Source:SGD;Acc:S000002926])

HSP 1 Score: 85.8853 bits (211), Expect = 5.085e-18
Identity = 104/421 (24.70%), Postives = 179/421 (42.52%), Query Frame = 3
Query:  507 PKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVD--YSGPRSSDGIVDWMIKNRE------NAAKAVSSILDFRNVQNPQRVLLLGLFSS--------ENDLLFTTFIDATNLFREDFS-SIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGE--NDMKYRMSAMDE-----------FDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPC 1679
            P + +L LT++ F   +ES   +LVEFFAPWC H + L P   +AA IL   N P+    +D    + +  +  ++ YPTLK+FKN   F    Y G + +D I  +MI+  E      N+   +   L+   +       L GL  +          D +F + +D+     ED S SI+  +    +L+D NVD  +G+ + L  ++L+ +  P FT                 IE ++FP     +              L  FF+T +  +      + + +  T++    + QI F   +       +R L +    E+  +  I    N++KY +  + E            D + I + +     G   PI+KS  IPK   S  +  +VG T+ ++++D   + L+  Y + C
Sbjct:   31 PGSDLLVLTEKKFKSFIESHPLVLVEFFAPWCLHSQILRPHLEEAASILKEHNVPV--VQIDCEANSMVCLQQTINTYPTLKIFKNGRIFDGQVYRGVKITDEITQYMIQLYEASVIYLNSEDEIQPYLENATLPVVINRGLTGLNETYQEVALDLAEDYVFLSLLDS-----EDKSLSIHLPNTTEPILFDGNVDSLVGNSVALT-QWLKVVILPYFTD----------------IEPDLFPKYISSNLP------------LAYFFYTSEEEL------EDYTDLFTQLGKENRGQINFIALNSTMFPHHVRFLNM---REQFPLFAIHNMINNLKYGLPQLPEEEYAKLEKPQPLDRDMIVQLVKDYREGTAKPIVKSEEIPKEQKS-NVYKIVGKTHDDIVHDDDKDVLVKYYATWC 405          

HSP 2 Score: 72.7886 bits (177), Expect = 7.537e-14
Identity = 43/116 (37.07%), Postives = 68/116 (58.62%), Query Frame = 3
Query:   93 FISILFSACI--NFGFFKNILGEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYD 434
            FIS + S C+  +F   +N     P  S++ VL  + F  FI ++ +V+VEF+APWC H + L P   +AA  LK++N P++  ++D    S +  +  I+ YPTLKIFK+   +D
Sbjct:    7 FISAIVSFCLFASFTLAENSARATP-GSDLLVLTEKKFKSFIESHPLVLVEFFAPWCLHSQILRPHLEEAASILKEHNVPVV--QIDCEANSMVCLQQTINTYPTLKIFKNGRIFD 119          

HSP 3 Score: 48.9062 bits (115), Expect = 1.821e-6
Identity = 28/93 (30.11%), Postives = 51/93 (54.84%), Query Frame = 3
Query:  231 MVEFYAPWCGHCKQLTPIYTKAAVQLKKNNP---PILLGKVDATVESELASRFGISGYPTLKIFKS---SIPYDYDDSRSESAIVNFMKKVGS 491
            +V++YA WC H K+  PIY + A  L  +      IL+ +VD+     L+  F ++GYPT+ ++ +   S P  ++  R+   +  F+K+ G+
Sbjct:  397 LVKYYATWCIHSKRFAPIYEEIANVLASDESVRDKILIAEVDSGANDILS--FPVTGYPTIALYPAGNNSKPIIFNKIRNLEDVFEFIKESGT 487          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Yeast
Match: MPD1 (Member of the protein disulfide isomerase (PDI) family; interacts with and inhibits the chaperone activity of Cne1p; MPD1 overexpression in a pdi1 null mutant suppresses defects in Pdi1p functions such as carboxypeptidase Y maturation [Source:SGD;Acc:S000005814])

HSP 1 Score: 70.0922 bits (170), Expect = 1.788e-13
Identity = 51/175 (29.14%), Postives = 87/175 (49.71%), Query Frame = 3
Query:  474 MKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYI-LVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETD--LAKEYHVSGYPTLKLFK-------------NKNFFVD----YSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDL 938
            M +V + ++     ++  LT ++F + + ++ Y  LVEF+APWCGHCK L+  F KAAK L  +   +Q+A V+  +  +  L  +Y V+G+PTL +F+              K+F       YSG R+   IVD+ +    +  K    I    ++      L + LFS ++ +
Sbjct:   16 MNEVKAQNFYDSDPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRLDGV---VQVAAVNCDLNKNKALCAKYDVNGFPTLMVFRPPKIDLSKPIDNAKKSFSAHANEVYSGARTLAPIVDFSLSRIRSYVKKFVRIDTLGSLLRKSPKLSVVLFSKQDKI 187          

HSP 2 Score: 63.5438 bits (153), Expect = 2.443e-11
Identity = 32/87 (36.78%), Postives = 53/87 (60.92%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFI-NANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKV--DATVESELASRFGISGYPTLKIFK 416
            D ++  L  ++FD+ I N N   +VEFYAPWCGHCK+L+  + KAA +L   +  + +  V  D      L +++ ++G+PTL +F+
Sbjct:   28 DPHISELTPKSFDKAIHNTNYTSLVEFYAPWCGHCKKLSSTFRKAAKRL---DGVVQVAAVNCDLNKNKALCAKYDVNGFPTLMVFR 111          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Yeast
Match: TRX1 (Cytoplasmic thioredoxin isoenzyme; part of thioredoxin system which protects cells against oxidative and reductive stress; forms LMA1 complex with Pbi2p; acts as a cofactor for Tsa1p; required for ER-Golgi transport and vacuole inheritance; with Trx2p, facilitates mitochondrial import of small Tims Tim9p, Tim10p, Tim13p by maintaining them in reduced form; abundance increases iunder DNA replication stress; TRX1 has a paralog, TRX2, that arose from the whole genome duplication [Source:SGD;Acc:S000004033])

HSP 1 Score: 50.0618 bits (118), Expect = 4.114e-8
Identity = 27/78 (34.62%), Postives = 37/78 (47.44%), Query Frame = 3
Query:  531 TKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKN 764
            T   F   +     ++V+F+A WCG CK +AP   K     S   P      +D     D+A++  VS  PTL LFKN
Sbjct:    7 TASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEK----FSEQYPQADFYKLDVDELGDVAQKNEVSAMPTLLLFKN 80          

HSP 2 Score: 49.6766 bits (117), Expect = 4.854e-8
Identity = 26/77 (33.77%), Postives = 41/77 (53.25%), Query Frame = 3
Query:  189 SENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKS 419
            +  FD  I  + +V+V+FYA WCG CK + P+  K + Q     P     K+D     ++A +  +S  PTL +FK+
Sbjct:    8 ASEFDSAIAQDKLVVVDFYATWCGPCKMIAPMIEKFSEQY----PQADFYKLDVDELGDVAQKNEVSAMPTLLLFKN 80          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Yeast
Match: EPS1 (ER protein with chaperone and co-chaperone activity; involved in retention of resident ER proteins; has a role in recognizing proteins targeted for ER-associated degradation (ERAD), member of the protein disulfide isomerase family [Source:SGD;Acc:S000001267])

HSP 1 Score: 53.1434 bits (126), Expect = 1.132e-7
Identity = 31/127 (24.41%), Postives = 63/127 (49.61%), Query Frame = 3
Query:  459 AIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAP-------EFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYS-GPRSSDGIV 815
            + + F+ K      +PP+ +   L   NF E + S G  +++F++P+C HCK LAP       EF + +K L+     I  + V+     DL  + ++  +P ++L+    +   ++  PR+ + ++
Sbjct:   14 SCITFLLKFTIAAAEPPEGFPEPLNPTNFKEEL-SKGLHIIDFYSPYCPHCKHLAPVWMETWEEFKEESKTLN-----ITFSQVNCIESADLCGDENIEYFPEIRLYNPSGYIKSFTETPRTKESLI 134          

HSP 2 Score: 48.521 bits (114), Expect = 3.285e-6
Identity = 30/131 (22.90%), Postives = 64/131 (48.85%), Query Frame = 3
Query:  102 ILFSACINFGFFKNILGEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPP--ILLGKVDATVESELASRFGISGYPTLKIFKSS--IPYDYDDSRSESAIVNFMKK 482
            + F +CI F     I    P +     LN  NF E + +  + +++FY+P+C HCK L P++ +   + K+ +    I   +V+    ++L     I  +P ++++  S  I    +  R++ +++ F ++
Sbjct:   10 VTFFSCITFLLKFTIAAAEPPEGFPEPLNPTNFKEEL-SKGLHIIDFYSPYCPHCKHLAPVWMETWEEFKEESKTLNITFSQVNCIESADLCGDENIEYFPEIRLYNPSGYIKSFTETPRTKESLIAFARR 139          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Nematostella
Match: EDO32930 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7STM8])

HSP 1 Score: 425.246 bits (1092), Expect = 2.630e-140
Identity = 241/615 (39.19%), Postives = 362/615 (58.86%), Query Frame = 3
Query:  153 EIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGI--GSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSA-MDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRG-----DQLNEYEIKSFILKNSKVLKDEL 1967
            E+  + +V VLNS+NFD  I  NNI++VEFYAPWCGHCK L P Y KAA ++K N+PP+   K+DATV S++A RF +SGYPTLKIF+   PY+Y+  R ES IV +MKK   P+W+PP    LTLTKENFTE+V     +LVEFFAPWCGHCK LAPE+ KAA+ L   +PPI LA VDAT+E++LA++Y V GYPTLK+F+ K    +Y G R   GI  +M      +++ +SS+   ++ ++    V ++G F  E+D +  ++++A N  R+D+   ++F    +  +      GI   SI+L +PE   + YEP    F +   +++P  +  F +    P+V  Y    K   +K   + LCI ++ VDF   ++ AT+ W  K+ ++A +++D I FAIA++E    +L++  L +SGEE+NVGC  +   K+RM    +EF  + +R+F++   AG + PI+KS P+PK+   E +T VVG T+ E++ND   + L+  Y   C  C++L            + K++    +D + ND+P  S    E F PT+ F   +T  D     +K  IKF G     D +   E K+ +  + +  KDEL
Sbjct:   56 EVKEEDDVLVLNSKNFDRVIEENNIILVEFYAPWCGHCKSLAPEYAKAAKKMKLNDPPVPFAKMDATVASDIAQRFDVSGYPTLKIFRKGTPYEYEGPREESGIVEYMKKQSDPNWKPPPVAALTLTKENFTEVVNRESLMLVEFFAPWCGHCKQLAPEYEKAAQELQKNDPPIPLAIVDATIESELAQKYEVQGYPTLKVFR-KGKATEYKGQRDQYGIASYMRSQVGPSSRILSSLKAVQDFMKEKDDVTIMGFFDGEDDKMLESYLEANNDVRDDYPFAHTFDAAAKKHF------GIKKSSIVLFQPERFLSKYEP--KHFVYEGKDLSPAALQGFYKDKRVPLVGLYTSYDKD--KKYAARPLCIVYYGVDFGFDNRVATQFWRSKVIEVAKDHRD-ITFAIANEEESEQELKDFGLAESGEEVNVGCFDKEGRKFRMDPDEEEFSEDSLREFVEEFKAGNLKPIIKSQPVPKSN-KEPVTVVVGKTFDEIVNDPKKDVLIEFYAPWCGHCKALEPTFKKLGKHFRNDKNIVIAKIDATANDVP--STYAVEGF-PTIYF---ATSKD-----KKNPIKFDGGRELKDLIKFVEEKATVSLSKEKAKDEL 646          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Nematostella
Match: EDO31634 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXD7])

HSP 1 Score: 188.734 bits (478), Expect = 1.466e-52
Identity = 133/428 (31.07%), Postives = 209/428 (48.83%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDAT-VETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDF-RNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ-IQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPP 1787
            VL L   NF   V     +LVEFFAPWCGHCK LAPE+  AA+ L   +PP+ LA VD T    D   +Y VSGYPTLK+F+N     DY GPR S GI+ +M K    ++  + S+    + + + +  +++G    ++DL    F+   N  R+ FS  ++   ++   Y+         I++ RP++L    EP F  +     +   F +  FI       V +   RT    E+  K  LC+ FF VD+  + K  +K W  ++ K+   + D+ + FAIA     SD  R L      ++ N   +  ND   +    ++F  +  ++FL+   AG + P +KS P+P++  ++G +  VVG+ +KE++ND   + L+  Y   C  C+SL              K +    MD + ND PP
Sbjct:   20 VLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKNDPPVPLAKVDCTEAGKDTCSKYGVSGYPTLKIFRNGEMSKDYDGPRDSSGIIRYMKKQAGPSSVEIKSVDHLEKKLDDAESNVVVGFLDGDDDLK-NAFMRTANEMRDSFSFAHASVTDVLEKYNYK-----NQIVVFRPKHLHTKLEPSFIAY---TGSPDDFYIKKFINAKAHGRVGQ---RTPDNEEQFPKP-LCVVFFDVDWKKNAK-GSKYWRNRVLKVTKFFDDKAMNFAIA---SFSDYERVLSDIGVTDKANPSAVVYNDAGDKFLMKEKFSVDSFKQFLEDYFAGSLKPHIKSEPLPES--NDGPVKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKLQDVKDIVIAKMDATANDAPP 428          

HSP 2 Score: 115.161 bits (287), Expect = 4.054e-27
Identity = 54/113 (47.79%), Postives = 73/113 (64.60%), Query Frame = 3
Query:  162 IDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDAT-VESELASRFGISGYPTLKIFKSS-IPYDYDDSRSESAIVNFMKKVGSP 494
            + S+V  L   NF   +   +I++VEF+APWCGHCK+L P Y  AA  LKKN+PP+ L KVD T    +  S++G+SGYPTLKIF++  +  DYD  R  S I+ +MKK   P
Sbjct:   16 LSSDVLDLGDSNFKSGVAGKDIMLVEFFAPWCGHCKRLAPEYETAAEALKKNDPPVPLAKVDCTEAGKDTCSKYGVSGYPTLKIFRNGEMSKDYDGPRDSSGIIRYMKKQAGP 128          

HSP 3 Score: 69.707 bits (169), Expect = 1.657e-12
Identity = 40/110 (36.36%), Postives = 62/110 (56.36%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSS---IPYDYDDSRSESAIVNFMKK 482
            D  V V+  ENF E +N     V++EFYAPWCGHCK L P Y +   +L ++   I++ K+DAT  ++    F + G+PT+    ++    P  Y+  R  S  V+F+K+
Sbjct:  360 DGPVKVVVGENFKEIVNDPTKDVLIEFYAPWCGHCKSLEPKYNELGEKL-QDVKDIVIAKMDATA-NDAPPNFSVQGFPTIYWAPANNKENPEKYEGGREVSDFVDFIKR 467          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Nematostella
Match: EDO47340 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMG9])

HSP 1 Score: 165.622 bits (418), Expect = 1.936e-45
Identity = 88/220 (40.00%), Postives = 127/220 (57.73%), Query Frame = 3
Query:  183 LNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIF--KSSIPYDYDDSRSESAIVNFMKKVGSPDWQPP--KNYVLTLTKENFTEIVES-SGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNF-FVDYSGPRSSDGIVDWM 824
            L  +NFDE +N     +VEFYAPWCGHCKQL P Y +      +++  +++ KVDA  + +L SRF + G+PT+K F   S+ P +Y+  R  +  + F+++      + P   + V  L + NF +IV++    +LVEFFAPWCGHCK+LAP + K  +   N  P   +A VDA   + L ++Y VSGYPTLK F   N    +YS  R     VD+M
Sbjct:   27 LTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTYEQLGEAYTQSS-DVIIAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIEEKTGVRGRVPVIPSAVADLDESNFDKIVKNPDNNVLVEFFAPWCGHCKNLAPVYEKVGEAFKN-EPNCVIAKVDADAHSALGQKYGVSGYPTLKFFSKTNKDGEEYSSGRDEQSFVDFM 244          

HSP 2 Score: 84.3445 bits (207), Expect = 1.742e-17
Identity = 49/145 (33.79%), Postives = 78/145 (53.79%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRSSDGIVDWM-----IKNRENAAKAVSSILDFRN----VQNPQRVLLLGLFS 923
            V+ LTK+NF E+V    + LVEF+APWCGHCK LAP + +  +  +  +  I +A VDA  + DL   + V G+PT+K F K      +Y+G R  +  + ++     ++ R     +  + LD  N    V+NP   +L+  F+
Sbjct:   24 VIDLTKDNFDEVVNGEKFALVEFYAPWCGHCKQLAPTYEQLGEAYTQSSDVI-IAKVDADGDRDLGSRFDVKGFPTIKYFPKGSTTPEEYNGGRDINDFIKFIEEKTGVRGRVPVIPSAVADLDESNFDKIVKNPDNNVLVEFFA 167          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Nematostella
Match: EDO37155 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGL1])

HSP 1 Score: 157.147 bits (396), Expect = 9.701e-42
Identity = 93/249 (37.35%), Postives = 130/249 (52.21%), Query Frame = 3
Query:  168 SNVYVLNSENFD-EFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSS--IPYDYDDSRSESAIVNFMKKVGSPDWQPP---------------------KNYVLTLTKENF-TEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF----KNKNFFVDYSGPRSSDGIVDWMI 827
            ++V  L + NF+   IN + + MVEFYAPWCGHCK L P + KAA  LK     + +G VD  V   +   + I G+PT+KIF ++   P DY+  R+   IV+   +                              K  V+ LT  NF  E++ S    LVEFFAPWCGHC+ LAPE+AKAA   + L   +++  +DATV T  A  Y V GYPT+K+F    KN +   DY G R++  I+ + +
Sbjct:   12 TDVVELTANNFNNRVINDDAVWMVEFYAPWCGHCKALAPEWMKAATALKG---VVKVGAVDMDVHQSVGGPYNIRGFPTIKIFGANKNSPQDYNGQRTAQGIVDAAMRAAQEAVSQRMSGGGRSSSGGGGRRGGSGGNKEDVVELTDTNFEKEVLNSKDLWLVEFFAPWCGHCQRLAPEWAKAA---TELKGKVKVGALDATVHTVTASRYQVQGYPTIKVFAAGIKNSHSVEDYQGGRTASDIIQYAL 254          

HSP 2 Score: 94.3597 bits (233), Expect = 1.721e-20
Identity = 46/115 (40.00%), Postives = 69/115 (60.00%), Query Frame = 3
Query:  507 PKNYVLTLTKENFT-EIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRSSDGIVDWMIKNRENA 845
            P   V+ LT  NF   ++      +VEF+APWCGHCK+LAPE+ KAA  L  +   +++  VD  V   +   Y++ G+PT+K+F  NKN   DY+G R++ GIVD  ++  + A
Sbjct:   10 PSTDVVELTANNFNNRVINDDAVWMVEFYAPWCGHCKALAPEWMKAATALKGV---VKVGAVDMDVHQSVGGPYNIRGFPTIKIFGANKNSPQDYNGQRTAQGIVDAAMRAAQEA 121          

HSP 3 Score: 92.0485 bits (227), Expect = 9.090e-20
Identity = 45/120 (37.50%), Postives = 72/120 (60.00%), Query Frame = 3
Query:  171 NVYVLNSENFD-EFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIP-----YDYDDSRSESAIVNFMKKVGSPDWQPPK 512
            +V  L   NF+ E +N+ ++ +VEF+APWCGHC++L P + KAA +LK     + +G +DATV +  ASR+ + GYPT+K+F + I       DY   R+ S I+ +     +   +PP+
Sbjct:  149 DVVELTDTNFEKEVLNSKDLWLVEFFAPWCGHCQRLAPEWAKAATELKGK---VKVGALDATVHTVTASRYQVQGYPTIKVFAAGIKNSHSVEDYQGGRTASDIIQYALDKAADSIEPPE 265          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Nematostella
Match: EDO41377 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S4E7])

HSP 1 Score: 149.828 bits (377), Expect = 7.700e-40
Identity = 77/225 (34.22%), Postives = 127/225 (56.44%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSS-IPYDYDDSRSESAIVNFMKKVG----SPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWM 824
            DS V  L  E+ DEFI ++  V+V ++APWCGHC ++ P Y KAA  L   +    L  VD T   ++A +  ++GYPT+K++K+  +  +Y+  RSE  +V FM+       +   +   + V  L   +F   + ++ ++LV F+APWCGHCK+  P++ KAA+   +  P    A +D T   D+  +  V+GYPTL+ +    F V+Y G R ++ ++ +M
Sbjct:  118 DSKVVFLTDESHDEFIKSHENVLVMYFAPWCGHCNEMKPNYYKAAQVLHDEDANCNLAAVDCTKHKDVAKKVALAGYPTVKLYKNGKVAKEYEGDRSEKDLVLFMRTASNTAKAASAEEDSSLVKQLDGSDFWGYLNNTEHVLVMFYAPWCGHCKNAKPKYEKAAETFKD-QPNRVFAKLDCTKFGDVCDKEEVNGYPTLRYYLYGKFVVEYDGDRVTEDLISFM 341          

HSP 2 Score: 134.806 bits (338), Expect = 1.419e-34
Identity = 79/214 (36.92%), Postives = 117/214 (54.67%), Query Frame = 3
Query:  255 CGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLK-IFKSSIPYDYDDSRSESAIVNFMKKVGSPD-------WQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILD 872
            C HC+++ P++ KAA QL K+    L   VD T      ++  I GYPTL+ I +    + Y   R+  A+V+FMK    P        W    + V+ LT E+  E ++S   +LV +FAPWCGHC  + P + KAA++L + +    LA VD T   D+AK+  ++GYPT+KL+KN     +Y G RS   +V +M +   N AKA S+  D
Sbjct:   26 CPHCQKMKPVFEKAAKQLGKDVKGALAA-VDCTESKNTCNQRDIKGYPTLQYIREGEFQFKYTGRRTAEALVSFMKDPKKPAPPPPPADWSKDDSKVVFLTDESHDEFIKSHENVLVMYFAPWCGHCNEMKPNYYKAAQVLHDEDANCNLAAVDCTKHKDVAKKVALAGYPTVKLYKNGKVAKEYEGDRSEKDLVLFM-RTASNTAKAASAEED 237          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Medaka
Match: pdia4 (protein disulfide isomerase family A member 4 [Source:NCBI gene;Acc:101168751])

HSP 1 Score: 422.165 bits (1084), Expect = 8.953e-139
Identity = 241/604 (39.90%), Postives = 356/604 (58.94%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRN-VQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVL--KDEL 1967
            + V VL   NFD F+   + V+VEFYAPWCGHCKQ  P Y K A  LK N+PPI + KVDAT  S+LAS+F +SGYPT+KI K+  P DYD +R+E AIV  +K+V  PDW+PP +  L LT+ENF + V ++  ILVEF+APWCGHCK LAPE+ KAAK LS   PPI LA VDATVET+LAK Y V+G+PTLK+F+    F +Y+GPR + GIV+ M +     +K V ++   +  +++    +++G+FS+E D  +  + +A N  REDFS  +SFS ++  L  A+     G I++++PE  R+ YEP       +  + +  E+  F +K+  P+V     +     ++  K+ + + ++ VDFS  +K AT+ W  K+ ++A ++  +  FAIAD+E  +D+L+ L L DSGEE+N G + E   K+ M   D+FDSE +R F+ +   GK+ PI+KS P+PK+     +  VVG T+ E++ D   + L+  Y   C  C+ L  + LS        K+L    MD + ND+ P    + E F PT+     +    P        +KF G       + +F+ K++  L  KDEL
Sbjct:   58 NGVLVLTDNNFDTFMEGKDTVLVEFYAPWCGHCKQFAPEYEKIAQTLKDNDPPIPVAKVDATQASQLASKFDVSGYPTIKILKNGEPVDYDGARTEKAIVERVKEVAHPDWKPPPDATLVLTQENFDDTVNNADIILVEFYAPWCGHCKRLAPEYEKAAKELSKRTPPIPLAKVDATVETELAKRYGVNGFPTLKIFRKGRAF-EYNGPRENYGIVEHMGEQAGPPSKQVQAVKQVQELIKDGDDAVIVGIFSNEQDSAYELYTEACNTLREDFSFRHSFSSDVAKLLKASP----GQIVIVQPEKFRSKYEPASHTLT-VKDSTSASEIQEFFKKHSIPLVGHR--KPSNDAKRYSKRPMVVVYYGVDFSFDYKKATQFWRSKVLEVAKDFP-EYTFAIADEEDYADELKSLGLSDSGEEVNAGIMAEGGKKFAMEP-DDFDSEVLRDFVMAFKKGKLKPIIKSQPVPKSNTGP-VKVVVGKTFDEIVMDTQKDVLIEFYAPWCGHCKKLEPDYLSLGKKYKKEKNLVIAKMDATANDI-PNDNYKAEGF-PTIYLAPANGKQSP--------VKFEGGDRTVEALSNFLEKHATKLQQKDEL 640          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Medaka
Match: pdia3 (protein disulfide isomerase family A member 3 [Source:NCBI gene;Acc:101164975])

HSP 1 Score: 176.792 bits (447), Expect = 1.018e-47
Identity = 130/444 (29.28%), Postives = 218/444 (49.10%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ---IQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDM-KYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEG-ITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPP---ISGLEYERFQPT 1823
            VL  T ++F   + +    LVEFFAPWCGHCK LAPE+  AA  L  + P   L  VD T  +++  +Y VSGYPTLK+F++      Y GPRS+DGIV ++ K    A+  + +  DF      Q   ++G F+ ++      F+ A +  R+D+   ++ ++   LL    +D+    ++L RP  L N +E +  KF       T  ++  FI++N+F I        K   ++L+ K L + ++ VD+  + K  +  W  ++ K+A ++ DQ   + FA+A+    S ++ E  L  S  E+ V  I  +   KY M+     D + + +FL     GK+   LKS PIP+   ++G +  +V + +  ++ND   + L+  Y   C  C++L            +  ++    MD + ND+P    +SG     F P 
Sbjct:   19 VLEYTDDDFESRIGNHDLALVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LVKVDCTANSNICSKYGVSGYPTLKIFRDGEESGPYDGPRSADGIVSFLKKQAGPASVELKTDADFEKFIGDQDASVVGFFADQSTSQ-AEFLKAASALRDDYR--FAHTNSEALLKSNGIDE--EGVVLFRPPRLNNKFEENSVKFTE--DKFTSNKIKKFIQENIFGICPHMTDDNK---DQLKGKDLLVAYYEVDYDKNPK-GSNYWRNRVMKVAKSFLDQGKKLNFAVANKNTFSHEVSEFGLSSSSGELPVVAIRTSKGDKYVMTEEFSRDGKALERFLQDYFDGKLKRYLKSEPIPED--NDGPVKVLVAENFDSIVNDDSKDVLIEFYAPWCGHCKNLEPKYNELGEKLANDPNVVIAKMDATANDVPSPYEVSGFPTIYFSPA 446          

HSP 2 Score: 102.449 bits (254), Expect = 1.453e-22
Identity = 65/167 (38.92%), Postives = 89/167 (53.29%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFK---SSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSN 659
            S+V     ++F+  I  +++ +VEF+APWCGHCK+L P Y  AA +LK   P   L KVD T  S + S++G+SGYPTLKIF+    S P  YD  RS   IV+F+KK   P        V   T  +F + +      +V FFA       +   EF KAA  L +
Sbjct:   17 SDVLEYTDDDFESRIGNHDLALVEFFAPWCGHCKRLAPEYEAAATRLKGIVP---LVKVDCTANSNICSKYGVSGYPTLKIFRDGEESGP--YDGPRSADGIVSFLKKQAGP------ASVELKTDADFEKFIGDQDASVVGFFADQS----TSQAEFLKAASALRD 168          

HSP 3 Score: 82.4185 bits (202), Expect = 4.919e-16
Identity = 47/129 (36.43%), Postives = 75/129 (58.14%), Query Frame = 3
Query:  129 GFFKNILGEIPI----DSNVYVLNSENFDEFINANNI-VMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTL---KIFKSSIPYDYDDSRSESAIVNFMKKVGS 491
            G  K  L   PI    D  V VL +ENFD  +N ++  V++EFYAPWCGHCK L P Y +   +L  N+P +++ K+DAT  +++ S + +SG+PT+      + + P  Y+  R  S  ++++K+  S
Sbjct:  347 GKLKRYLKSEPIPEDNDGPVKVLVAENFDSIVNDDSKDVLIEFYAPWCGHCKNLEPKYNELGEKL-ANDPNVVIAKMDATA-NDVPSPYEVSGFPTIYFSPAGRKTSPKKYEGGREVSDFISYLKREAS 473          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Medaka
Match: pdia8 (protein disulfide-isomerase A3 [Source:NCBI gene;Acc:101165241])

HSP 1 Score: 162.925 bits (411), Expect = 7.722e-43
Identity = 111/403 (27.54%), Postives = 195/403 (48.39%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ-IQFAIADDERQSDKLRELRLD------DSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI 1706
            V+ L   +F  +      +LV+F+APWCGHCK LAPEF KAAK L  +   ++LA VD T  ++    + V+GYPTLK+F+       Y GPR++DGI + M +     +  + S  D +   N     ++G+F S        F+ A  L R+ F   ++   ++++  D NVD     ++L RP  L + +E     F+     +T   +  F+  +++ +        +   ++L  + L   ++ +D+  H+   +  W  ++ K+A  Y  + + F++A+   + D L EL  D      D+G+   V    +   KY M      D + + +FL+   AG++   +KS PIP+   S  +  VV +++ E++ND   + L+  Y   C  C+ L  I
Sbjct:   28 VVELGDADFDYLATEHETMLVKFYAPWCGHCKKLAPEFEKAAKKLKGI---VKLAKVDCTANSETCGRFGVTGYPTLKIFRYGKDSASYDGPRTADGIYEVMRRQTGPDSVHLKSKEDLQAFVNNYDASIVGVFPSSEGSRLPEFLKAAGLLRDQFR--FAHITDLQVADDHNVDSEC--VLLFRPPRLASAFEDSVVVFKDY---LTISSLRRFLRDHLYGLCPHMTLENR---DRLRVRDLLTAYYDLDYQ-HNVRGSNYWRNRVMKVASKYAGRSLMFSVAN---KKDFLMELEEDYDLGTSDAGDMPFVTIRTKLGQKYVMREEFTRDGQSLERFLEDYFAGRLKQYIKSEPIPEKN-SAAVKVVVAESFNEIVNDPDKDVLIQFYSPSCPHCKKLEPI 412          

HSP 2 Score: 102.449 bits (254), Expect = 1.660e-22
Identity = 62/164 (37.80%), Postives = 84/164 (51.22%), Query Frame = 3
Query:  171 NVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFK-SSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSN 659
            +V  L   +FD     +  ++V+FYAPWCGHCK+L P + KAA +LK     + L KVD T  SE   RFG++GYPTLKIF+       YD  R+   I   M++   PD       V   +KE+    V +    +V  F    G   S  PEF KAA +L +
Sbjct:   27 DVVELGDADFDYLATEHETMLVKFYAPWCGHCKKLAPEFEKAAKKLKG---IVKLAKVDCTANSETCGRFGVTGYPTLKIFRYGKDSASYDGPRTADGIYEVMRRQTGPDS------VHLKSKEDLQAFVNNYDASIVGVFPSSEG---SRLPEFLKAAGLLRD 178          

HSP 3 Score: 61.6178 bits (148), Expect = 1.706e-9
Identity = 39/129 (30.23%), Postives = 71/129 (55.04%), Query Frame = 3
Query:  129 GFFKNILGEIPI----DSNVYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIF---KSSIPYDYDDSRSESAIVNFMKKVGS 491
            G  K  +   PI     + V V+ +E+F+E +N  +  V+++FY+P C HCK+L PIY + A  L  ++P  ++ K++A V++++   + + GYPT+ +    +   P  Y   R     +NF+K+  S
Sbjct:  356 GRLKQYIKSEPIPEKNSAAVKVVVAESFNEIVNDPDKDVLIQFYSPSCPHCKKLEPIYRELAETL-YSDPHTVIAKMNA-VDNDIPLGYDVQGYPTIYLAPAGRKDNPIRYQGPRELKEFLNFLKRESS 482          

HSP 4 Score: 58.151 bits (139), Expect = 2.269e-8
Identity = 42/125 (33.60%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  504 PPKN--YVLTLTKENFTEIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKL--FKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSS 863
            P KN   V  +  E+F EIV +    +L++F++P C HCK L P + + A+ L + +P   +A ++A V+ D+   Y V GYPT+ L     K+  + Y GPR     ++++   RE++ K +SS
Sbjct:  368 PEKNSAAVKVVVAESFNEIVNDPDKDVLIQFYSPSCPHCKKLEPIYRELAETLYS-DPHTVIAKMNA-VDNDIPLGYDVQGYPTIYLAPAGRKDNPIRYQGPRELKEFLNFL--KRESSHKLMSS 488          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Medaka
Match: pdia8 (protein disulfide-isomerase A3 [Source:NCBI gene;Acc:101165241])

HSP 1 Score: 160.999 bits (406), Expect = 1.410e-42
Identity = 108/385 (28.05%), Postives = 189/385 (49.09%), Query Frame = 3
Query:  573 ILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQ-IQFAIADDERQSDKLRELRLD------DSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI 1706
            +LV+F+APWCGHCK LAPEF KAAK L  +   ++LA VD T  ++    + V+GYPTLK+F+       Y GPR++DGI + M +     +  + S  D +   N     ++G+F S        F+ A  L R+ F   ++   ++++  D NVD     ++L RP  L + +E     F+     +T   +  F+  +++ +        +   ++L  + L   ++ +D+  H+   +  W  ++ K+A  Y  + + F++A+   + D L EL  D      D+G+   V    +   KY M      D + + +FL+   AG++   +KS PIP+   S  +  VV +++ E++ND   + L+  Y   C  C+ L  I
Sbjct:    1 MLVKFYAPWCGHCKKLAPEFEKAAKKLKGI---VKLAKVDCTANSETCGRFGVTGYPTLKIFRYGKDSASYDGPRTADGIYEVMRRQTGPDSVHLKSKEDLQAFVNNYDASIVGVFPSSEGSRLPEFLKAAGLLRDQFR--FAHITDLQVADDHNVDSEC--VLLFRPPRLASAFEDSVVVFKDY---LTISSLRRFLRDHLYGLCPHMTLENR---DRLRVRDLLTAYYDLDYQ-HNVRGSNYWRNRVMKVASKYAGRSLMFSVAN---KKDFLMELEEDYDLGTSDAGDMPFVTIRTKLGQKYVMREEFTRDGQSLERFLEDYFAGRLKQYIKSEPIPEKN-SAAVKVVVAESFNEIVNDPDKDVLIQFYSPSCPHCKKLEPI 367          

HSP 2 Score: 97.0561 bits (240), Expect = 7.510e-21
Identity = 58/145 (40.00%), Postives = 77/145 (53.10%), Query Frame = 3
Query:  228 VMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFK-SSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSN 659
            ++V+FYAPWCGHCK+L P + KAA +LK     + L KVD T  SE   RFG++GYPTLKIF+       YD  R+   I   M++   PD       V   +KE+    V +    +V  F    G   S  PEF KAA +L +
Sbjct:    1 MLVKFYAPWCGHCKKLAPEFEKAAKKLKG---IVKLAKVDCTANSETCGRFGVTGYPTLKIFRYGKDSASYDGPRTADGIYEVMRRQTGPDS------VHLKSKEDLQAFVNNYDASIVGVFPSSEG---SRLPEFLKAAGLLRD 133          

HSP 3 Score: 61.6178 bits (148), Expect = 1.639e-9
Identity = 39/129 (30.23%), Postives = 71/129 (55.04%), Query Frame = 3
Query:  129 GFFKNILGEIPI----DSNVYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIF---KSSIPYDYDDSRSESAIVNFMKKVGS 491
            G  K  +   PI     + V V+ +E+F+E +N  +  V+++FY+P C HCK+L PIY + A  L  ++P  ++ K++A V++++   + + GYPT+ +    +   P  Y   R     +NF+K+  S
Sbjct:  311 GRLKQYIKSEPIPEKNSAAVKVVVAESFNEIVNDPDKDVLIQFYSPSCPHCKKLEPIYRELAETL-YSDPHTVIAKMNA-VDNDIPLGYDVQGYPTIYLAPAGRKDNPIRYQGPRELKEFLNFLKRESS 437          

HSP 4 Score: 58.151 bits (139), Expect = 1.904e-8
Identity = 42/125 (33.60%), Postives = 70/125 (56.00%), Query Frame = 3
Query:  504 PPKN--YVLTLTKENFTEIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKL--FKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSS 863
            P KN   V  +  E+F EIV +    +L++F++P C HCK L P + + A+ L + +P   +A ++A V+ D+   Y V GYPT+ L     K+  + Y GPR     ++++   RE++ K +SS
Sbjct:  323 PEKNSAAVKVVVAESFNEIVNDPDKDVLIQFYSPSCPHCKKLEPIYRELAETLYS-DPHTVIAKMNA-VDNDIPLGYDVQGYPTIYLAPAGRKDNPIRYQGPRELKEFLNFL--KRESSHKLMSS 443          
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Medaka
Match: pdia6 (protein disulfide isomerase family A member 6 [Source:NCBI gene;Acc:101171545])

HSP 1 Score: 150.214 bits (378), Expect = 7.612e-39
Identity = 88/243 (36.21%), Postives = 133/243 (54.73%), Query Frame = 3
Query:  171 NVYVLNSENFD-EFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKS--SIPYDYDDSRSESAIVN----------------------FMKKVGSPDWQPPKNYVLTLTKENFTE-IVESSGYILVEFFAPWCGHCKSLAPEFAKAA-KILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVD 818
            +V  L   NF+ E + ++++ +VEFYAPWCGHC+ L P + KAA  LK     + +G VDA     L  ++G+ G+PT+KIF +  + P +Y  +RS  AIV+                      + ++  S      K+ V+ LT +NF + +++S    LVEFFAPWCGHCK+L PE+A AA  +       ++L  VDATV   L+  Y V G+PT+K+F+      DY G R+   I++
Sbjct:   26 DVVELTPSNFNREVMQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKG---IVKVGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGARSSQAIVDGAMNALRSLVKDRLSGKSGSSGYSRQSDSGSSGSSKD-VVELTDDNFDKTVLQSDDVWLVEFFAPWCGHCKNLEPEWAAAATAVKEQTKGKVRLGAVDATVHQVLSSRYGVRGFPTIKIFRKGEEPEDYQGGRTRGDIIE 264          

HSP 2 Score: 95.1301 bits (235), Expect = 2.827e-20
Identity = 48/106 (45.28%), Postives = 67/106 (63.21%), Query Frame = 3
Query:  507 PKNYVLTLTKENFT-EIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFK-NKNFFVDYSGPRSSDGIVD 818
            P + V+ LT  NF  E+++S    LVEF+APWCGHC++LAP++ KAA  L  +   +++  VDA     L  +Y V G+PT+K+F  NKN   +Y G RSS  IVD
Sbjct:   23 PSDDVVELTPSNFNREVMQSDSLWLVEFYAPWCGHCRNLAPDWKKAATALKGI---VKVGAVDADEHKSLGGQYGVRGFPTIKIFGANKNKPEEYQGARSSQAIVD 125          
BLAST of Protein disulfide-isomerase A4 vs. Planmine SMEST
Match: SMESG000010656.1 (SMESG000010656.1)

HSP 1 Score: 1236.86 bits (3199), Expect = 0.000e+0
Identity = 621/627 (99.04%), Postives = 624/627 (99.52%), Query Frame = 3
Query:   87 MHFISILFSACINFGFFKNILGEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVLKDEL 1967
            MHFISILFSACINFGFFKNILGEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELA+RFGISGYPTLK FKS IPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFT+IVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYP+LKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNL REDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNILSSLSSTFSGKSLKFFSMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVLKDEL
Sbjct:    1 MHFISILFSACINFGFFKNILGEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELATRFGISGYPTLKFFKSGIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTQIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPSLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLVREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNILSSLSSTFSGKSLKFFSMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAIKFRGDQLNEYEIKSFILKNSKVLKDEL 627          
BLAST of Protein disulfide-isomerase A4 vs. Planmine SMEST
Match: SMESG000041085.1 (SMESG000041085.1)

HSP 1 Score: 201.83 bits (512), Expect = 4.110e-57
Identity = 136/456 (29.82%), Postives = 228/456 (50.00%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEI--RLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKD---QIQFAIADDERQSDKLRELRLDDSG-EEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNS 1865
            VL     +F + V+    ILVEF+APWCGHCK LAPE+  AA  L   +PPI +A VD T ET   +++ VSGYPTLK+FKN  F  DYSG RS+DGI+ +M+     ++K + +  +F         +++G F+SE+  L+  F+       EDF   ++F + +  +L Y  N       I++   + + N +E    K++    + +  ++ +++E+N+  +      RT   ++   K+ L +  + VD+  + K  T  W  +I K+A  + D    I FAI++ +  + +L E  ++     ++ +    E + K++M  M +F  E++ KF++  L  KV   LKS  IP+    E +  VV   + E++ND   + L+  Y   C  C+SL            +   +    MD + ND+P  S  E   F PT+ F   ++   P S
Sbjct:    5 VLEFKDSSFEQSVKEHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN-------IVIFHSKKMANKFEDTQVKYK---GDASEHQMRTWVEENIMGLAGH---RTHSNVKYFAKRPLIVALYNVDYEKNPK-GTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKM--MADFSMENLEKFINDFLEEKVPVYLKSESIPEKN-DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVP--SPYEVSGF-PTIYFAPKNSKHSPKS 440          

HSP 2 Score: 123.635 bits (309), Expect = 1.146e-29
Identity = 76/226 (33.63%), Postives = 120/226 (53.10%), Query Frame = 3
Query:  168 SNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSS-IPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKA-AKILSNLNPPIQLA-TVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRSSDGIVDWMIKN 833
            S+V      +F++ +  +++++VEFYAPWCGHCK+L P Y  AA  LKK +PPI + KVD T E++   + G+SGYPTLK+FK+    +DY   RS   I+ +M     P  +  K      T+ENF +   S+  ++V FF        S + +  KA   +   LN   + A T D T+ T L  + ++  + + K+  K ++  V Y G  S   +  W+ +N
Sbjct:    3 SDVLEFKDSSFEQSVKEHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELK------TEENFNKFTASADPVVVGFFT-------SESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQMRTWVEEN 215          

HSP 3 Score: 72.4034 bits (176), Expect = 4.300e-13
Identity = 41/119 (34.45%), Postives = 67/119 (56.30%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNY 518
            D  V V+ ++NFDE +N     V++EFYAPWCGHCK L P Y + A +L   +  I++ K+DAT  +++ S + +SG+PT+     +  +      S   + + +K + S    P KN+
Sbjct:  349 DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNF 465          
BLAST of Protein disulfide-isomerase A4 vs. Planmine SMEST
Match: SMESG000041085.1 (SMESG000041085.1)

HSP 1 Score: 201.83 bits (512), Expect = 6.074e-57
Identity = 136/456 (29.82%), Postives = 228/456 (50.00%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDFSSIYSFSDEI--RLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHHKTATKKWLEKITKIAVNYKD---QIQFAIADDERQSDKLRELRLDDSG-EEINVGCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLR-NIXXXXXXXXXXXXXXXXXMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNS 1865
            VL     +F + V+    ILVEF+APWCGHCK LAPE+  AA  L   +PPI +A VD T ET   +++ VSGYPTLK+FKN  F  DYSG RS+DGI+ +M+     ++K + +  +F         +++G F+SE+  L+  F+       EDF   ++F + +  +L Y  N       I++   + + N +E    K++    + +  ++ +++E+N+  +      RT   ++   K+ L +  + VD+  + K  T  W  +I K+A  + D    I FAI++ +  + +L E  ++     ++ +    E + K++M  M +F  E++ KF++  L  KV   LKS  IP+    E +  VV   + E++ND   + L+  Y   C  C+SL            +   +    MD + ND+P  S  E   F PT+ F   ++   P S
Sbjct:   19 VLEFKDSSFEQSVKEHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELKTEENFNKFTASADPVVVGFFTSESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNN-------IVIFHSKKMANKFEDTQVKYK---GDASEHQMRTWVEENIMGLAGH---RTHSNVKYFAKRPLIVALYNVDYEKNPK-GTNYWRNRILKVAKKFIDSGKSIHFAISNVQEMNQELSEYGIESPDFSKVYITARDERNQKFKM--MADFSMENLEKFINDFLEEKVPVYLKSESIPEKN-DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAESDIVIAKMDATANDVP--SPYEVSGF-PTIYFAPKNSKHSPKS 454          

HSP 2 Score: 124.02 bits (310), Expect = 8.949e-30
Identity = 76/230 (33.04%), Postives = 122/230 (53.04%), Query Frame = 3
Query:  156 IPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSS-IPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKA-AKILSNLNPPIQLA-TVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRSSDGIVDWMIKN 833
            + + S+V      +F++ +  +++++VEFYAPWCGHCK+L P Y  AA  LKK +PPI + KVD T E++   + G+SGYPTLK+FK+    +DY   RS   I+ +M     P  +  K      T+ENF +   S+  ++V FF        S + +  KA   +   LN   + A T D T+ T L  + ++  + + K+  K ++  V Y G  S   +  W+ +N
Sbjct:   13 LAMASDVLEFKDSSFEQSVKEHSVILVEFYAPWCGHCKKLAPEYEIAATALKKQDPPIAIAKVDCTAETKTCEKHGVSGYPTLKVFKNGQFAFDYSGERSADGIIKYMVSKSGPSSKELK------TEENFNKFTASADPVVVGFFT-------SESSDLYKAFLSVAEKLNEDFRFAHTFDETLSTKLNYKNNIVIFHSKKMANKFEDTQVKYKGDASEHQMRTWVEEN 229          

HSP 3 Score: 72.7886 bits (177), Expect = 3.903e-13
Identity = 41/119 (34.45%), Postives = 67/119 (56.30%), Query Frame = 3
Query:  165 DSNVYVLNSENFDEFIN-ANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNY 518
            D  V V+ ++NFDE +N     V++EFYAPWCGHCK L P Y + A +L   +  I++ K+DAT  +++ S + +SG+PT+     +  +      S   + + +K + S    P KN+
Sbjct:  363 DEPVKVVVAKNFDEIVNDPTKDVLIEFYAPWCGHCKSLAPKYEELAKKLSAES-DIVIAKMDATA-NDVPSPYEVSGFPTIYFAPKNSKHSPKSYSSGREVDDMLKYIASEASSPLKNF 479          
BLAST of Protein disulfide-isomerase A4 vs. Planmine SMEST
Match: SMESG000023147.1 (SMESG000023147.1)

HSP 1 Score: 160.614 bits (405), Expect = 3.931e-42
Identity = 121/420 (28.81%), Postives = 198/420 (47.14%), Query Frame = 3
Query:  519 VLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNRENAAKAVSSILDFRNVQNPQRVLLLGLF---SSENDLLFTTFIDATNLFREDFSSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSNVT-PF---EVMSFIEKNMFPIVAEYDFRT--KVYLEKLEKKFLCIFFFT----VDFSIHHKTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINVGCIGENDMKYRMSAMDE-----------FDSEHIRKFLDSILAGKVFPILKSAPIPKTPLSEGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNI 1706
            VL LT  NF E++E + Y+LVEF+APWCGHCK+LAPE+A AA+ L   N  I+LA VDATVE DLA ++ + GYPTLK FK+    +DY G R++D I+ W+ K     A  + S+ + + +   + V+++G F   +S     F +  D+ +      +S  +  DE ++  D        SI+L             F KF    ++ T PF   ++ +FI+K   PIV E++  T  K++   ++K  L           +     +T+ KK+L ++  + +N           DE  +D++ E            G    +   +RM  +++             SE++  F+ S+L GKV P + +  IP+      +  +VG  +  +  D      +  Y   C  C+ L  I
Sbjct:   26 VLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKV-MDYGGGRTADTIISWLEKKTGPPAATLKSVEEAKALIESKDVVVVGFFKDQASAAAKAFESVADSKDDVVFGVTSQKAVFDEFKVSSD-------DSIVL-------------FKKFDEGRNDFTGPFVDKDIRTFIDKYQLPIVIEFNQETAGKIFGGSIKKHVLSFISKKSEKYAELKGQFETSAKKFLGQVLFVIINT----------DEEDNDRVLEF----------FGMAKTDTPSFRMIQLEDDMVKFKPDDATISSENLNLFVQSVLDGKVKPHMMTQEIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPI 404          

HSP 2 Score: 127.872 bits (320), Expect = 5.765e-31
Identity = 83/220 (37.73%), Postives = 118/220 (53.64%), Query Frame = 3
Query:  150 GEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDDSRSESAIVNFM-KKVGSPDWQPPKNYVLTLTKENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFK----NKNFFVDYSGP 794
             +I  +  V VL + NF+E I  N  V+VEFYAPWCGHCK L P Y  AA +LK+ N  I L KVDATVE++LAS+F I GYPTLK FK     DY   R+   I++++ KK G     PP   + ++  E    ++ES   ++V FF       K  A   AKA + +++    +       T +  +  E+ VS   ++ LFK     +N   D++GP
Sbjct:   18 ADITEEEGVLVLTNSNFNEVIEKNKYVLVEFYAPWCGHCKALAPEYASAAEKLKEKNSIIKLAKVDATVENDLASKFKIQGYPTLKFFKDGKVMDYGGGRTADTIISWLEKKTG-----PPAATLKSV--EEAKALIESKDVVVVGFF-------KDQASAAAKAFESVADSKDDVVFGV---TSQKAVFDEFKVSSDDSIVLFKKFDEGRN---DFTGP 217          

HSP 3 Score: 69.3218 bits (168), Expect = 5.012e-12
Identity = 42/101 (41.58%), Postives = 57/101 (56.44%), Query Frame = 3
Query:  153 EIPIDSN---VYVLNSENFDEFI-NANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSSIPYDYDD 443
            EIP D +   V VL  +NFD    + +  V VEFYAPWCGHCKQL PI+ +   +  K+N  I++ K+D+T       R  I  +PT+K F    P D D+
Sbjct:  357 EIPEDWDKNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLG-ETYKDNTDIVIAKMDSTANEVEGVR--IQSFPTIKYF----PKDSDE 450          

HSP 4 Score: 64.3142 bits (155), Expect = 1.620e-10
Identity = 37/104 (35.58%), Postives = 57/104 (54.81%), Query Frame = 3
Query:  495 DWQPPKNYVLTLTKENFTEIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLF-KNKNFFVDYSGPRS 800
            DW   KN V  L  +NF  +  + S  + VEF+APWCGHCK LAP + +  +   + N  I +A +D+T      +   +  +PT+K F K+ +  VD+ G R+
Sbjct:  361 DWD--KNPVKVLVGKNFDSVARDKSKAVFVEFYAPWCGHCKQLAPIWDQLGETYKD-NTDIVIAKMDSTANE--VEGVRIQSFPTIKYFPKDSDEMVDFEGDRT 459          
BLAST of Protein disulfide-isomerase A4 vs. Planmine SMEST
Match: SMESG000017020.1 (SMESG000017020.1)

HSP 1 Score: 155.606 bits (392), Expect = 8.034e-41
Identity = 102/268 (38.06%), Postives = 134/268 (50.00%), Query Frame = 3
Query:  102 ILFSACINFGFFKNILGEIPIDSNVYVLNSENFDEFINANNIVMVEFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGISGYPTLKIFKSS--IPYDYDDSRSESAIVNFM----------------------KKVGSPDWQPPKNYVLTLTKENFTEIV-ESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLATVDATVETDLAKEYHVSGYPTLKLFK---NKNFFVDYSGPRSSDGIVDW 821
            IL+S  + F + K+       + +V  L   NFD+  N++++  VEFYAPWCGHC+ L P + KAA  LK     + +G VD    S L   +GI G+PT+KIF  S   P DY   R+  +IVN                        ++  S         V+ LT  NF E+V +S    LVEFFAPWCGHCK+L P + +AA   S L   ++L  +DATV T  A  Y V GYPT+K F          DY G RSS  IV W
Sbjct:    2 ILYSFFLIFLYAKSSTALYSSNDDVVELTPSNFDDMKNSDSLWFVEFYAPWCGHCQSLAPEWKKAATALKGV---VKVGAVDMDKYSSLGQPYGIQGFPTIKIFGKSKHSPKDYQGDRTAGSIVNAALKELDELVRSRLGGASGGSSSHERKSSGGSSGSGGDVVELTDSNFDEMVLKSEEPWLVEFFAPWCGHCKNLKPHWDQAA---SELRGKVKLGALDATVHTATASRYGVQGYPTIKFFPAGVKSGDSQDYDGGRSSSDIVRW 263          
The following BLAST results are available for this feature:
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PDIA46.594e-12937.77protein disulfide isomerase family A member 4 [Sou... [more]
PDIA49.217e-12937.77protein disulfide isomerase family A member 4 [Sou... [more]
PDIA35.834e-4630.00protein disulfide isomerase family A member 3 [Sou... [more]
PDIA65.471e-4436.47protein disulfide isomerase family A member 6 [Sou... [more]
PDIA63.290e-4337.80protein disulfide isomerase family A member 6 [Sou... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
C14B9.21.434e-11336.38Probable protein disulfide-isomerase A4 [Source:U... [more]
pdi-33.932e-5729.46pep chromosome:WBcel235:I:7015912:7021743:-1 gene:... [more]
pdi-33.932e-5729.46pep chromosome:WBcel235:I:7015912:7020790:-1 gene:... [more]
pdi-33.932e-5729.46pep chromosome:WBcel235:I:7015912:7020797:-1 gene:... [more]
pdi-65.782e-3835.79Protein disulfide-isomerase A6 homolog [Source:Un... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ERp601.542e-5329.72gene:FBgn0033663 transcript:FBtr0088058[more]
Pdi1.125e-4029.70gene:FBgn0286818 transcript:FBtr0346644[more]
Pdi1.125e-4029.70gene:FBgn0286818 transcript:FBtr0075648[more]
CaBP11.466e-4039.00gene:FBgn0025678 transcript:FBtr0345544[more]
CaBP11.466e-4039.00gene:FBgn0025678 transcript:FBtr0080837[more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia41.268e-14040.36protein disulfide isomerase family A, member 4 [So... [more]
pdia85.889e-5029.81protein disulfide isomerase family A, member 8 [So... [more]
pdia85.889e-5029.81protein disulfide isomerase family A, member 8 [So... [more]
pdia36.216e-4730.75protein disulfide isomerase family A, member 3 [So... [more]
pdia76.542e-4727.16protein disulfide isomerase family A, member 7 [So... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chst136.961e-12837.42carbohydrate (chondroitin 4) sulfotransferase 13 [... [more]
chst139.026e-12837.25carbohydrate (chondroitin 4) sulfotransferase 13 [... [more]
chst131.550e-12737.25carbohydrate (chondroitin 4) sulfotransferase 13 [... [more]
chst131.974e-12737.25carbohydrate (chondroitin 4) sulfotransferase 13 [... [more]
pdia37.570e-5130.27protein disulfide isomerase family A member 3 [Sou... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pdia41.233e-13038.69protein disulfide isomerase associated 4 [Source:M... [more]
Pdia32.952e-4229.11protein disulfide isomerase associated 3 [Source:M... [more]
Pdia64.895e-4235.34protein disulfide isomerase associated 6 [Source:M... [more]
P4hb3.154e-3729.93prolyl 4-hydroxylase, beta polypeptide [Source:MGI... [more]
Txndc51.008e-3129.67thioredoxin domain containing 5 [Source:MGI Symbol... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P38659|PDIA4_RAT7.227e-13040.54Protein disulfide-isomerase A4 OS=Rattus norvegicu... [more]
sp|P08003|PDIA4_MOUSE7.904e-13038.69Protein disulfide-isomerase A4 OS=Mus musculus OX=... [more]
sp|P13667|PDIA4_HUMAN4.426e-12837.77Protein disulfide-isomerase A4 OS=Homo sapiens OX=... [more]
sp|Q29RV1|PDIA4_BOVIN6.889e-12739.38Protein disulfide-isomerase A4 OS=Bos taurus OX=99... [more]
sp|P34329|PDIA4_CAEEL1.824e-11236.38Probable protein disulfide-isomerase A4 OS=Caenorh... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V4B1I82.334e-14440.73Protein disulfide-isomerase OS=Lottia gigantea OX=... [more]
A0A2T7P9K12.438e-14241.39Protein disulfide-isomerase OS=Pomacea canaliculat... [more]
A0A3Q3NC752.950e-13940.03Protein disulfide-isomerase A4 OS=Mastacembelus ar... [more]
A0A3Q1IHZ92.211e-13840.03Protein disulfide-isomerase A4 OS=Anabas testudine... [more]
A0A060XVD83.630e-13839.80Protein disulfide-isomerase A4 OS=Oncorhynchus myk... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia41.978e-14039.67protein disulfide isomerase family A member 4 [Sou... [more]
pdia35.459e-5029.91protein disulfide isomerase family A member 3 [Sou... [more]
pdia81.886e-4928.45protein disulfide-isomerase A3-like [Source:NCBI g... [more]
pdia71.228e-4729.58protein disulfide-isomerase A3-like [Source:NCBI g... [more]
pdia82.851e-4729.30protein disulfide-isomerase A3-like [Source:NCBI g... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia42.719e-12939.47protein disulfide isomerase family A, member 4 [So... [more]
pdia32.332e-4328.26protein disulfide isomerase family A, member 3 [So... [more]
ENSPMAT00000006474.15.032e-3835.47pep scaffold:Pmarinus_7.0:GL478000:14574:47610:1 g... [more]
pdia67.117e-3734.78protein disulfide isomerase family A, member 6 [So... [more]
txndc52.391e-3236.54thioredoxin domain containing 5 [Source:ZFIN;Acc:Z... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
PDI11.705e-2743.90Protein disulfide isomerase; multifunctional oxido... [more]
EUG15.085e-1824.70Protein disulfide isomerase of the endoplasmic ret... [more]
MPD11.788e-1329.14Member of the protein disulfide isomerase (PDI) fa... [more]
TRX14.114e-834.62Cytoplasmic thioredoxin isoenzyme; part of thiored... [more]
EPS11.132e-724.41ER protein with chaperone and co-chaperone activit... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO329302.630e-14039.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO316341.466e-5231.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473401.936e-4540.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371559.701e-4237.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO413777.700e-4034.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
pdia48.953e-13939.90protein disulfide isomerase family A member 4 [Sou... [more]
pdia31.018e-4729.28protein disulfide isomerase family A member 3 [Sou... [more]
pdia87.722e-4327.54protein disulfide-isomerase A3 [Source:NCBI gene;A... [more]
pdia81.410e-4228.05protein disulfide-isomerase A3 [Source:NCBI gene;A... [more]
pdia67.612e-3936.21protein disulfide isomerase family A member 6 [Sou... [more]
back to top
BLAST of Protein disulfide-isomerase A4 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000010656.10.000e+099.04SMESG000010656.1[more]
SMESG000041085.14.110e-5729.82SMESG000041085.1[more]
SMESG000041085.16.074e-5729.82SMESG000041085.1[more]
SMESG000023147.13.931e-4228.81SMESG000023147.1[more]
SMESG000017020.18.034e-4138.06SMESG000017020.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023805 ID=SMED30023805|Name=Protein disulfide-isomerase A4|organism=Schmidtea mediterranea sexual|type=transcript|length=2124bp
CAAAGTAATCAGTCAAATTAAGTTATAAATTCAACTATTTAATTACAAAG
TACTCCAGCTTTATCCATAATAATTGTATTTCAGCAATGCATTTTATCAG
TATTCTTTTTTCTGCATGTATCAATTTTGGTTTCTTTAAAAATATTCTTG
GAGAGATTCCAATTGACAGTAATGTCTATGTATTAAACAGTGAAAATTTT
GATGAATTCATTAATGCAAACAATATTGTTATGGTAGAATTCTATGCACC
TTGGTGCGGTCATTGTAAACAGCTAACGCCTATATATACCAAGGCAGCCG
TTCAATTGAAAAAAAATAATCCCCCAATTCTGCTGGGTAAAGTTGACGCA
ACCGTTGAAAGTGAATTAGCTTCTAGATTTGGTATCAGTGGTTATCCGAC
ACTCAAAATTTTCAAATCTAGTATTCCTTACGATTATGATGATAGTAGAT
CAGAATCAGCAATTGTAAATTTCATGAAAAAAGTCGGCAGTCCAGATTGG
CAGCCTCCCAAAAATTATGTTCTAACATTGACGAAGGAAAACTTTACTGA
AATAGTAGAAAGTTCTGGATATATATTGGTTGAATTCTTTGCTCCATGGT
GTGGCCATTGCAAGAGTTTAGCTCCTGAGTTTGCGAAGGCTGCAAAAATA
TTAAGCAATTTAAATCCACCGATTCAACTGGCAACAGTCGATGCTACTGT
TGAAACCGATCTAGCTAAGGAATATCACGTTTCAGGCTATCCTACATTAA
AACTTTTCAAAAATAAAAATTTTTTTGTTGATTACAGTGGCCCTCGATCC
AGTGATGGAATTGTAGACTGGATGATAAAAAATCGTGAGAATGCTGCCAA
AGCTGTTAGTTCGATTTTAGATTTTCGCAATGTCCAAAATCCTCAAAGAG
TTTTACTGTTAGGTTTATTTTCGTCAGAGAACGATTTACTCTTTACAACA
TTTATTGACGCTACAAATCTATTCCGAGAGGATTTTAGCTCTATTTATAG
TTTTAGCGATGAAATTCGCCTATTATATGATGCCAACGTTGACGATGGGA
TCGGTTCAATTATTTTGTTACGACCTGAATATCTAAGAAATATATATGAA
CCAGATTTTACCAAATTCCAACATCTTAACTCGAATGTTACACCCTTTGA
AGTCATGTCCTTCATAGAGAAGAACATGTTTCCTATTGTTGCTGAATACG
ATTTTAGAACTAAAGTATATCTAGAAAAATTAGAGAAAAAGTTCTTATGC
ATCTTTTTCTTTACTGTGGATTTCTCTATTCACCATAAAACAGCTACGAA
GAAATGGTTAGAAAAAATTACTAAGATCGCTGTCAATTATAAAGATCAAA
TCCAATTCGCCATAGCAGATGATGAAAGGCAATCAGACAAATTGAGAGAA
CTTAGGCTCGATGATTCTGGTGAAGAAATAAATGTTGGTTGTATTGGTGA
AAACGATATGAAATATCGCATGTCAGCAATGGATGAATTTGACAGTGAAC
ATATTCGCAAATTTTTGGATAGTATTCTAGCTGGCAAAGTATTTCCTATA
TTAAAATCTGCTCCAATTCCAAAAACTCCTTTATCGGAAGGAATTACAAC
CGTTGTTGGTGACACCTATAAAGAGCTAATTAATGATATTCCTGGCGAGA
GTTTGCTTCTGCTCTATCGAAGTCCTTGTAAAAGTTGCCAGTCTTTACGT
AATATTTTGTCTTCTCTGTCCTCTACATTTTCTGGTAAATCGTTGAAGTT
CTTCTCGATGGATTTGAGTCAAAACGATATGCCTCCAATCAGTGGTTTGG
AATATGAGCGTTTTCAACCGACAGTTAATTTTATTATGGATTCCACTGAT
TCTGATCCAAACAGTTTGCTACGAAAAAAGGCCATTAAATTCCGAGGTGA
TCAATTAAACGAATATGAAATCAAGTCATTTATTTTGAAAAATTCCAAAG
TATTAAAGGATGAACTTTGATCAAATATTGCTTTTCTTAGTAGCTTTTTA
TTTCCAGGCAGTCTCATGTTGCTATTAGCTTGCCTGTTTGATTTAGGTCT
TATGTTTGTGGTATTTTTATTATTCATTTTGTTGTGGTTTTTTTAAGAAA
ATAAACATTTGATTGCTTCAAAAA
back to top

protein sequence of SMED30023805-orf-1

>SMED30023805-orf-1 ID=SMED30023805-orf-1|Name=SMED30023805-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=628bp
MHFISILFSACINFGFFKNILGEIPIDSNVYVLNSENFDEFINANNIVMV
EFYAPWCGHCKQLTPIYTKAAVQLKKNNPPILLGKVDATVESELASRFGI
SGYPTLKIFKSSIPYDYDDSRSESAIVNFMKKVGSPDWQPPKNYVLTLTK
ENFTEIVESSGYILVEFFAPWCGHCKSLAPEFAKAAKILSNLNPPIQLAT
VDATVETDLAKEYHVSGYPTLKLFKNKNFFVDYSGPRSSDGIVDWMIKNR
ENAAKAVSSILDFRNVQNPQRVLLLGLFSSENDLLFTTFIDATNLFREDF
SSIYSFSDEIRLLYDANVDDGIGSIILLRPEYLRNIYEPDFTKFQHLNSN
VTPFEVMSFIEKNMFPIVAEYDFRTKVYLEKLEKKFLCIFFFTVDFSIHH
KTATKKWLEKITKIAVNYKDQIQFAIADDERQSDKLRELRLDDSGEEINV
GCIGENDMKYRMSAMDEFDSEHIRKFLDSILAGKVFPILKSAPIPKTPLS
EGITTVVGDTYKELINDIPGESLLLLYRSPCKSCQSLRNILSSLSSTFSG
KSLKFFSMDLSQNDMPPISGLEYERFQPTVNFIMDSTDSDPNSLLRKKAI
KFRGDQLNEYEIKSFILKNSKVLKDEL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000499cell
PLANA:0000034epidermis
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0003001lateral region of the whole animal
Vocabulary: cellular component
TermDefinition
GO:0005788endoplasmic reticulum lumen
GO:0005783endoplasmic reticulum
Vocabulary: INTERPRO
TermDefinition
IPR036249Thioredoxin-like_sf
IPR005788Disulphide_isomerase
IPR013766Thioredoxin_domain
IPR012336Thioredoxin-like_fold
IPR017937Thioredoxin_CS
Vocabulary: biological process
TermDefinition
GO:0045454cell redox homeostasis
Vocabulary: molecular function
TermDefinition
GO:0003756protein disulfide isomerase activity
GO:0016853isomerase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availablePRINTSPR00421THIOREDOXINcoord: 99..110
score: 47.08
coord: 56..65
score: 60.22
coord: 48..56
score: 60.25
NoneNo IPR availablePFAMPF13848Thioredoxin_6coord: 278..478
e-value: 2.0E-12
score: 47.4
NoneNo IPR availablePANTHERPTHR18929PROTEIN DISULFIDE ISOMERASEcoord: 121..567
NoneNo IPR availablePANTHERPTHR18929:SF210PROTEIN DISULFIDE-ISOMERASE A4coord: 121..567
coord: 30..131
NoneNo IPR availablePANTHERPTHR18929PROTEIN DISULFIDE ISOMERASEcoord: 30..131
NoneNo IPR availableCDDcd02961PDI_a_familycoord: 32..130
e-value: 1.5556E-38
score: 135.431
NoneNo IPR availableCDDcd02961PDI_a_familycoord: 146..246
e-value: 1.31151E-38
score: 135.816
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..22
score: 0.476
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 498..623
e-value: 3.8E-5
score: 25.4
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 23..142
e-value: 1.7E-39
score: 136.6
coord: 143..255
e-value: 3.3E-37
score: 129.2
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 374..497
e-value: 3.1E-27
score: 97.3
IPR036249Thioredoxin-like superfamilyGENE3DG3DSA:3.40.30.10coord: 256..370
e-value: 5.6E-10
score: 41.2
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 363..497
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 467..566
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 138..249
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 24..133
IPR036249Thioredoxin-like superfamilySUPERFAMILYSSF52833Thioredoxin-likecoord: 257..366
IPR005788Disulphide isomeraseTIGRFAMTIGR01126TIGR01126coord: 33..132
e-value: 9.1E-36
score: 120.3
coord: 148..248
e-value: 5.8E-33
score: 111.3
IPR013766Thioredoxin domainPFAMPF00085Thioredoxincoord: 145..247
e-value: 4.3E-28
score: 97.3
coord: 30..132
e-value: 6.0E-28
score: 96.9
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 137..251
score: 12.839
IPR013766Thioredoxin domainPROSITEPS51352THIOREDOXIN_2coord: 5..135
score: 14.282
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 49..67
IPR017937Thioredoxin, conserved sitePROSITEPS00194THIOREDOXIN_1coord: 164..182