RF_PROK_I domain-containing protein

Overview
NameRF_PROK_I domain-containing protein
Smed IDSMED30023797
Length (bp)727
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RF_PROK_I domain-containing protein (SMED30023797) t-SNE clustered cells

Violin plots show distribution of expression levels for RF_PROK_I domain-containing protein (SMED30023797) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RF_PROK_I domain-containing protein (SMED30023797) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RF_PROK_I domain-containing protein (SMED30023797) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023797

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 12

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023797h1SMcG0015222 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023797h1SMcG0015222 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023797h1SMcG0015222 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023797h1SMcG0015220 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023797h1SMcG0015220 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023797h1SMcG0015220 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023797h1SMcG0015222 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023797h1SMcG0015222 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023797h1SMcG0015222 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023797h1SMcG0015220 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023797h1SMcG0015220 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023797h1SMcG0015220 dd_Smed_v4_2359_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Human
Match: MRPL58 (mitochondrial ribosomal protein L58 [Source:HGNC Symbol;Acc:HGNC:5359])

HSP 1 Score: 88.5817 bits (218), Expect = 5.926e-21
Identity = 66/210 (31.43%), Postives = 103/210 (49.05%), Query Frame = 2
Query:   53 MIAHRFLK-----SGSNFLYGNFTIFRALSYKSKTATEIEDYHINDKL-----------KESNLTIGEFGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRI-ITKSNERRLRQKKKESFNKSARNNYDMD 631
            M A R L+     +G   L       R   +K K  TE +  +  DKL           +  N       +I +  L I Y  SS PGGQNVNK++SK +++FH+ +  WI + V++       ++I +    I++S+++R Q  N ADC+ +IR  I    E ++TP+   ++  +  RI I   N  RLRQK+  S  K++R   DMD
Sbjct:    1 MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMI---TEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSR-RVDMD 206          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Human
Match: MRPL58 (mitochondrial ribosomal protein L58 [Source:HGNC Symbol;Acc:HGNC:5359])

HSP 1 Score: 73.9442 bits (180), Expect = 1.300e-15
Identity = 49/149 (32.89%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  116 RALSYKSKTATEIEDYHINDKL-----------KESNLTIGEFGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKES-----FLRRESH--RITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTP 508
            RAL +K K  TE +  +  DKL           +  N       +I +  L I Y  SS PGGQNVNK++SK +++FH+ +  WI + V++      F+    H  +I +    I++S+++R Q  N ADC+ +IR  I E  +  K P
Sbjct:   28 RAL-HKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITFFICSLQHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMITEASQTPKEP 175          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Celegans
Match: R02F2.9 (pep chromosome:WBcel235:III:5499190:5499976:1 gene:WBGene00019838.1 transcript:R02F2.9.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R02F2.9)

HSP 1 Score: 78.5666 bits (192), Expect = 6.546e-18
Identity = 49/135 (36.30%), Postives = 76/135 (56.30%), Query Frame = 2
Query:  212 GEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDR-IITKSNERRLRQKKKESFNKSAR 613
            G I  + +E +Y  SS PGGQNV K  +KV+I+F V    W+ +S+++    + SHRI      II SD TR + +N ADC D++R +I   IE  +      EK E+  R     + + RL++K++ S  K++R
Sbjct:   26 GVIPTEKIEKRYTLSSGPGGQNVQKNATKVEIRFKVSEAEWLSESLRDLVEEKLSHRINTAGELIIDSDRTRERHLNVADCFDKLRSAIY-AIENEQGKREMTEKDEKILRERAAIATQHRLQEKRRTSEKKASR 159          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Fly
Match: CG6094 (gene:FBgn0032261 transcript:FBtr0080091)

HSP 1 Score: 95.5153 bits (236), Expect = 7.497e-24
Identity = 48/110 (43.64%), Postives = 69/110 (62.73%), Query Frame = 2
Query:  212 GEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTP--ETSIEKKER 535
            G I +  LEI Y  SS PGGQ+VN +++KV ++F V   +WIP+  ++  L+  ++RITKD YF I SD TRSQ +N AD ++++R  IR    V   P  E ++EK  R
Sbjct:   63 GFIPMDRLEITYSRSSGPGGQHVNTVNTKVDVRFKVAQADWIPEQTRQKLLKVLANRITKDGYFYIKSDLTRSQQMNLADALEKLRTIIRSQEAVAPAPPSEETLEKLRR 172          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Fly
Match: CG6094 (gene:FBgn0032261 transcript:FBtr0337004)

HSP 1 Score: 95.5153 bits (236), Expect = 7.497e-24
Identity = 48/110 (43.64%), Postives = 69/110 (62.73%), Query Frame = 2
Query:  212 GEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTP--ETSIEKKER 535
            G I +  LEI Y  SS PGGQ+VN +++KV ++F V   +WIP+  ++  L+  ++RITKD YF I SD TRSQ +N AD ++++R  IR    V   P  E ++EK  R
Sbjct:   63 GFIPMDRLEITYSRSSGPGGQHVNTVNTKVDVRFKVAQADWIPEQTRQKLLKVLANRITKDGYFYIKSDLTRSQQMNLADALEKLRTIIRSQEAVAPAPPSEETLEKLRR 172          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Zebrafish
Match: mrpl58 (mitochondrial ribosomal protein L58 [Source:ZFIN;Acc:ZDB-GENE-121214-202])

HSP 1 Score: 85.1149 bits (209), Expect = 5.814e-20
Identity = 46/136 (33.82%), Postives = 76/136 (55.88%), Query Frame = 2
Query:  206 EFGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR 613
            +   I +  L++ Y  SS  GGQ+VNK+++K +++FHV + +W+P+++K   L +   RI K     + S+ +RSQ  N  +C+ ++   I+E  +    P  S E +E W   + K N  RL+QKK  S  K AR
Sbjct:   55 QLTHIPVDKLKVSYSRSSGAGGQHVNKVNTKAEVRFHVQTADWLPETLKSQILLKHQSRINKAGELFVRSEISRSQRRNLQECVQKLTALIQEAEQQEAEP--SPEDQELWKNRLNKRNLERLKQKKIHSATKRAR 188          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Xenopus
Match: MRPL58 (mitochondrial ribosomal protein L58 [Source:NCBI gene;Acc:100170604])

HSP 1 Score: 95.5153 bits (236), Expect = 1.539e-23
Identity = 58/182 (31.87%), Postives = 95/182 (52.20%), Query Frame = 2
Query:   77 SGSNFLYGNFTIFRALSYKS--KTATEIEDYHINDKLKESNLTIGEFGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPET-SIEKKERWDRIITKSNERRLRQKKKESFNKSAR 613
            +    L G    FR   + S  ++A  +E  +    L+ + L      +I +  L I Y  SS PGGQNVNK+++K +++FH+ S +WIP+ V++    +  +RI +    I+ S+ +R Q+ N A C+++IR  +    +  K P+  S E  E     + K N  RL+QKK ES  K +R
Sbjct:   33 AAPGVLSGALRAFRGFRFASTYRSAYSLERLYPGSDLRTAALGDQGVADIPVDRLTISYCKSSGPGGQNVNKVNTKAEVRFHLASADWIPEDVRQKISVQCKNRINRSGELIVVSEQSRYQMENLAACLEKIRGIV---ADAAKKPKMLSKEDVEVRRARVEKMNRERLQQKKIESTIKQSR 211          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Mouse
Match: Mrpl58 (mitochondrial ribosomal protein L58 [Source:MGI Symbol;Acc:MGI:1915822])

HSP 1 Score: 90.8929 bits (224), Expect = 2.752e-22
Identity = 49/132 (37.12%), Postives = 77/132 (58.33%), Query Frame = 2
Query:  218 INIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR 613
            I +  L I Y  SS PGGQNVNK++SK +++FH+ S +WI + V++       ++I K    +++S+++R Q  N A+C+ +IR  I E  +V K P     + +R    I K N  RLRQK+  S  K++R
Sbjct:   43 IPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASQVPKEPSKEDARLQRLR--IEKMNRERLRQKRLNSALKTSR 172          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Mouse
Match: Mrpl58 (mitochondrial ribosomal protein L58 [Source:MGI Symbol;Acc:MGI:1915822])

HSP 1 Score: 90.8929 bits (224), Expect = 5.700e-22
Identity = 50/133 (37.59%), Postives = 79/133 (59.40%), Query Frame = 2
Query:  218 INIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRI-ITKSNERRLRQKKKESFNKSAR 613
            I +  L I Y  SS PGGQNVNK++SK +++FH+ S +WI + V++       ++I K    +++S+++R Q  N A+C+ +IR  I E  +V K P    ++  R  R+ I K N  RLRQK+  S  K++R
Sbjct:   72 IPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASQVPKEPS---KEDARLQRLRIEKMNRERLRQKRLNSALKTSR 201          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Mouse
Match: Mrpl58 (mitochondrial ribosomal protein L58 [Source:MGI Symbol;Acc:MGI:1915822])

HSP 1 Score: 64.3142 bits (155), Expect = 3.348e-12
Identity = 39/135 (28.89%), Postives = 69/135 (51.11%), Query Frame = 2
Query:  209 FGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR 613
            + E    D   K    +K     +  ++SK +++FH+ S +WI + V++       ++I K    +++S+++R Q  N A+C+ +IR  I E  +V K P     + +R    I K N  RLRQK+  S  K++R
Sbjct:   49 YPESKGADTAWKVPEHAKQASSYIPLVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASQVPKEPSKEDARLQRLR--IEKMNRERLRQKRLNSALKTSR 181          
BLAST of RF_PROK_I domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8R035|ICT1_MOUSE (Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Mus musculus OX=10090 GN=Mrpl58 PE=1 SV=1)

HSP 1 Score: 90.8929 bits (224), Expect = 3.987e-21
Identity = 50/133 (37.59%), Postives = 79/133 (59.40%), Query Frame = 2
Query:  218 INIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRI-ITKSNERRLRQKKKESFNKSAR 613
            I +  L I Y  SS PGGQNVNK++SK +++FH+ S +WI + V++       ++I K    +++S+++R Q  N A+C+ +IR  I E  +V K P    ++  R  R+ I K N  RLRQK+  S  K++R
Sbjct:   72 IPLDRLSISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIEEPVRQKIALTHKNKINKAGELVLTSESSRYQFRNLAECLQKIRDMIAEASQVPKEPS---KEDARLQRLRIEKMNRERLRQKRLNSALKTSR 201          
BLAST of RF_PROK_I domain-containing protein vs. UniProt/SwissProt
Match: sp|Q14197|ICT1_HUMAN (Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Homo sapiens OX=9606 GN=MRPL58 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 2.846e-20
Identity = 66/210 (31.43%), Postives = 103/210 (49.05%), Query Frame = 2
Query:   53 MIAHRFLK-----SGSNFLYGNFTIFRALSYKSKTATEIEDYHINDKL-----------KESNLTIGEFGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRI-ITKSNERRLRQKKKESFNKSARNNYDMD 631
            M A R L+     +G   L       R   +K K  TE +  +  DKL           +  N       +I +  L I Y  SS PGGQNVNK++SK +++FH+ +  WI + V++       ++I +    I++S+++R Q  N ADC+ +IR  I    E ++TP+   ++  +  RI I   N  RLRQK+  S  K++R   DMD
Sbjct:    1 MAATRCLRWGLSRAGVWLLPPPARCPRRALHKQKDGTEFKSIYSLDKLYPESQGSDTAWRVPNGAKQADSDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKIAITHKNKINRLGELILTSESSRYQFRNLADCLQKIRDMI---TEASQTPKEPTKEDVKLHRIRIENMNRERLRQKRIHSAVKTSR-RVDMD 206          
BLAST of RF_PROK_I domain-containing protein vs. UniProt/SwissProt
Match: sp|D2HD32|ICT1_AILME (Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Ailuropoda melanoleuca OX=9646 GN=MRPL58 PE=3 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.821e-19
Identity = 60/198 (30.30%), Postives = 98/198 (49.49%), Query Frame = 2
Query:   74 KSGSNFLYGNFTIFRALSYKSKTATEIEDYHINDKL------KESNLTIGEFGEINIKD-----LEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRI-ITKSNERRLRQKKKESFNKSARNNYDMD 631
            ++G+  L       R   +K    TE +  +  DKL       ++   + +  +   KD     L I Y  SS PGGQNVNK++SK +++FH+ +  WI + V++       ++I +    I++S+ +R Q  N ADC+ +IR  I    E ++TP+   ++     RI I   N  RLR+K+  S  K+ R   DMD
Sbjct:   13 RAGAWLLTPPLRCPRRALHKQADGTEFQSIYSLDKLYPESRGSDTAWKVPDDAQQTNKDIPLDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLATAEWIAEPVRQKMAIMHKNKINRSGELILTSECSRYQFRNLADCLQKIRDMI---AEASQTPKEPSKEDAALHRIRIENMNRERLRKKRIHSAIKTGR-RVDMD 206          
BLAST of RF_PROK_I domain-containing protein vs. UniProt/SwissProt
Match: sp|B5XAM2|ICT1_SALSA (Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Salmo salar OX=8030 GN=mrpl58 PE=2 SV=1)

HSP 1 Score: 84.3445 bits (207), Expect = 1.041e-18
Identity = 52/165 (31.52%), Postives = 84/165 (50.91%), Query Frame = 2
Query:  119 ALSYKSKTATEIEDYHINDKLKESNLTIGEFGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR 613
            + SY ++ +   +D H+N               I +  L + Y  SS PGGQ+VNK+ +K +++FHV + +WIP+ V++  +    +RI K    +++S+ +RSQ  N  DC+ +I   I +  E  K  E S E        + K N+ RL+QKK  S  K  R
Sbjct:   39 SFSYGNRASDNPQDGHVN---------------IPVDRLTVSYSRSSGPGGQHVNKVSTKAEVRFHVYTADWIPEDVRQKIILNNKNRINKAGELLVTSEQSRSQQRNMGDCIQKISDIIAKATE--KPHEPSAEDIALRASRLEKRNKERLKQKKLHSAVKQTR 186          
BLAST of RF_PROK_I domain-containing protein vs. UniProt/SwissProt
Match: sp|Q3T116|ICT1_BOVIN (Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Bos taurus OX=9913 GN=MRPL58 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.859e-18
Identity = 48/135 (35.56%), Postives = 76/135 (56.30%), Query Frame = 2
Query:  215 EINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTP--ETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR 613
            +I +  L I Y  SS PGGQNVNK++SK +++FH+ S +WI + V++       ++I +    I++S+ +R Q  N ADC+ +IR  I E  +    P  E +  +K R    I   N  RLR+K+  S  K++R
Sbjct:   71 DIPVDRLTISYCRSSGPGGQNVNKVNSKAEVRFHLASADWIAEPVRQKMALTHKNKINRAGELILTSEYSRYQFRNLADCLQKIRDMIAEASQPATEPSKEDAALQKLR----IENMNRERLRKKRINSAIKTSR 201          
BLAST of RF_PROK_I domain-containing protein vs. TrEMBL
Match: G4VKM1 (RF_PROK_I domain-containing protein OS=Schistosoma mansoni OX=6183 GN=Smp_086710 PE=4 SV=1)

HSP 1 Score: 153.295 bits (386), Expect = 9.431e-43
Identity = 74/143 (51.75%), Postives = 104/143 (72.73%), Query Frame = 2
Query:  212 GEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSARNNYDMD*TF 640
            G I I +L+I Y  SS PGGQ+VNK  +KV+I+FHVPS +WIPD VK+ F+ +E++RI K+NYFII+SD TR Q++NQADC++RIR  IREC++    PE S E  E   R   K+NE RLR+KK++S+ K  R+++++   F
Sbjct:   57 GYIPIDELQISYAYSSGPGGQHVNKNKTKVEIRFHVPSASWIPDQVKQLFMEKEANRINKENYFIITSDHTRKQILNQADCLERIRRIIRECVDSLNKPEPSPETLEAIQRRKMKANEERLREKKEKSYTKQFRHDHNLTDLF 199          
BLAST of RF_PROK_I domain-containing protein vs. TrEMBL
Match: A0A183QQD8 (RF_PROK_I domain-containing protein OS=Schistosoma rodhaini OX=6188 PE=4 SV=1)

HSP 1 Score: 149.828 bits (377), Expect = 1.165e-41
Identity = 72/137 (52.55%), Postives = 100/137 (72.99%), Query Frame = 2
Query:  230 DLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSARNNYDMD*TF 640
            +L+I Y  SS PGGQ+VNK  +KV+I+FHVPS +WIPD VK+ F+ +E++RI K+NYFII+SD TR Q++NQADC++RIR  IREC++    PE S E  E   R   K+NE RLR+KK++S+ K  R+N+ +   F
Sbjct:   50 ELQISYAYSSGPGGQHVNKNKTKVEIRFHVPSASWIPDQVKQLFMEKEANRINKENYFIITSDHTRKQILNQADCLERIRRIIRECVDSLNKPEPSPETLEAIQRRKVKANEERLRKKKEKSYTKQYRHNHHLTDLF 186          
BLAST of RF_PROK_I domain-containing protein vs. TrEMBL
Match: A0A4Z2DGL9 (Peptidyl-tRNA hydrolase ICT1 OS=Schistosoma japonicum OX=6182 GN=EWB00_001351 PE=4 SV=1)

HSP 1 Score: 148.288 bits (373), Expect = 7.935e-41
Identity = 74/141 (52.48%), Postives = 102/141 (72.34%), Query Frame = 2
Query:  212 GEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR-NNYDMD 631
            G I I +L+I Y+ SS PGGQ+VNK  +KV+I+FHVPS +WIPD VK+ F+ RE++RI ++NYFII+SD TR Q++NQADC++RIR  +REC      PE + E  E   R   K+NE RLR+KK++SF K  R +N+ +D
Sbjct:   57 GYIPIDELQISYLYSSGPGGQHVNKNKTKVEIRFHVPSASWIPDQVKKRFMEREANRINRENYFIITSDHTRKQILNQADCLERIRRIVRECENSLFKPEPNPETLEAIQRRKVKANEERLREKKEKSFTKQLRQDNHSVD 197          
BLAST of RF_PROK_I domain-containing protein vs. TrEMBL
Match: A0A3S5BM83 (RF_PROK_I domain-containing protein OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS23521 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 2.363e-40
Identity = 73/134 (54.48%), Postives = 94/134 (70.15%), Query Frame = 2
Query:  212 GEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR 613
            G IN+ D+   YISSS PGGQNVNK  SKVQ++F+V +V+WIP+ +K+ F+ +E +RITKD YFIISSD TR Q++NQADC++RIR SI EC+     P  S E   R +    K+NE RL+QKK  S NK  R
Sbjct:   58 GYINLDDITFTYISSSGPGGQNVNKTRSKVQVKFNVQAVSWIPEDIKKVFIDKEKNRITKDGYFIISSDRTRLQILNQADCLERIRRSITECMNTLNKPPASPEVVVRHEEQKAKANEARLKQKKLNSMNKVYR 191          
BLAST of RF_PROK_I domain-containing protein vs. TrEMBL
Match: Q5D8M4 (SJCHGC06705 protein OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 145.206 bits (365), Expect = 1.419e-39
Identity = 74/141 (52.48%), Postives = 101/141 (71.63%), Query Frame = 2
Query:  212 GEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR-NNYDMD 631
            G I I +L+I Y+ SS PGGQ+VNK  +KV+I+FHVPS +WIPD VK+ FL  E++RI ++NYFII+SD TR Q++NQADC++RIR  +REC      PE + E  E   R   K+NE RLR+KK++SF K  R +N+ +D
Sbjct:   57 GYIPIDELQISYLYSSGPGGQHVNKNKTKVEIRFHVPSASWIPDQVKKRFLVWEANRINRENYFIITSDHTRKQILNQADCLERIRRIVRECENSLLKPEPNPETLEAIQRRKVKANEERLREKKEKSFTKQLRQDNHSVD 197          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Cavefish
Match: mrpl58 (mitochondrial ribosomal protein L58 [Source:NCBI gene;Acc:103037773])

HSP 1 Score: 88.9669 bits (219), Expect = 2.025e-21
Identity = 48/132 (36.36%), Postives = 75/132 (56.82%), Query Frame = 2
Query:  218 INIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR 613
            I +  L+I Y  SS PGGQ+VNK  +K +++FHV + +WIP+ V+   + +   RI K    I++S+ +RSQ  N  DC+ +I   I E  +  + PE S +    W + + K N  RL++KK +S  K  R
Sbjct:   64 IPVDQLKISYSRSSGPGGQHVNKASTKAEVRFHVQTASWIPEEVRNEIILKNKTRINKAGELIVTSEMSRSQQRNLEDCLQKITEMITEASQ--RPPEPSEDDIALWAKRLEKRNLARLKEKKMQSATKRGR 193          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Yeast
Match: PTH4 (Protein similar to the human peptidyl-tRNA hydrolase gene ICT1; associates with mitochondrial large subunit; may function in translation termination; YOL114C is not an essential gene [Source:SGD;Acc:S000005474])

HSP 1 Score: 64.6994 bits (156), Expect = 3.013e-13
Identity = 43/141 (30.50%), Postives = 72/141 (51.06%), Query Frame = 2
Query:  212 GEINIKDLEI-----KYISSSKPGGQNVNKIHSKVQIQF-HVPSVNWIPDSVKESFLR-RESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR 613
            G +N+  L +     +Y  +S PGGQNVNK++SK  +    + +  WIP  V+      R  +     +  +I SD TRS+  N+  C +++   IR+  +     +T+ E  ++W++I  K+N+ RL  KK  S  K  R
Sbjct:   57 GALNVTGLPLNQFILRYDRASGPGGQNVNKVNSKCTLTLSGLSNCAWIPQEVRNILSSGRFRYYAKGSDSIVIQSDETRSRETNKLKCFEKLVQEIRQTCQFPN--DTTAETSKKWNKIKEKANKERLLDKKVHSDKKKNR 195          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Nematostella
Match: EDO48409 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJN9])

HSP 1 Score: 90.5077 bits (223), Expect = 1.658e-23
Identity = 42/92 (45.65%), Postives = 60/92 (65.22%), Query Frame = 2
Query:  233 LEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTP 508
            L +K+  S+ PGGQNVNK+++KV ++FHVPS NWIP+ V+   L RE +RI KDN  +ISS   RSQ  N  D + +I   ++E   + + P
Sbjct:    2 LLVKFARSTGPGGQNVNKVNTKVDVRFHVPSANWIPEEVRLKLLEREKNRINKDNELVISSTKHRSQHRNLQDAICKIEEMVKEASYIPREP 93          
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Medaka
Match: mrpl58 (mitochondrial ribosomal protein L58 [Source:NCBI gene;Acc:101155096])

HSP 1 Score: 80.1073 bits (196), Expect = 3.429e-18
Identity = 45/127 (35.43%), Postives = 74/127 (58.27%), Query Frame = 2
Query:  233 LEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSAR 613
            L + Y  SS PGGQ+VNK+++K +++FHV + +WIP+ ++   + +   R+ K    ++SS+ +RSQ  N +DC+ +I   + E  E    P T+ +   R  R + K  E RL+QKK  S  K +R
Sbjct:   54 LTVTYSRSSGPGGQHVNKVNTKAKVRFHVHTADWIPEDIRLKVIEKNRSRMNKAGELLVSSEVSRSQHRNLSDCLQKISTILAEASEKPHEP-TAEDVALRAAR-LKKRKEERLKQKKIHSGTKQSR 178          
BLAST of RF_PROK_I domain-containing protein vs. Planmine SMEST
Match: SMESG000021177.1 (SMESG000021177.1)

HSP 1 Score: 391.734 bits (1005), Expect = 1.774e-140
Identity = 190/193 (98.45%), Postives = 192/193 (99.48%), Query Frame = 2
Query:   53 MIAHRFLKSGSNFLYGNFTIFRALSYKSKTATEIEDYHINDKLKESNLTIGEFGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNERRLRQKKKESFNKSARNNYDMD 631
            MIAHRFLKSGSNFLYGNFTIFRALSYKSKTATEIEDYHINDKLKESNLTIGEFGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKE FLRRESHRITKDNYFIISSDATRSQL+NQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNE+RLRQKKKESFNKSARNNYDMD
Sbjct:    1 MIAHRFLKSGSNFLYGNFTIFRALSYKSKTATEIEDYHINDKLKESNLTIGEFGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVKELFLRRESHRITKDNYFIISSDATRSQLLNQADCMDRIRHSIRECIEVNKTPETSIEKKERWDRIITKSNEKRLRQKKKESFNKSARNNYDMD 193          
The following BLAST results are available for this feature:
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
MRPL585.926e-2131.43mitochondrial ribosomal protein L58 [Source:HGNC S... [more]
MRPL581.300e-1532.89mitochondrial ribosomal protein L58 [Source:HGNC S... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
R02F2.96.546e-1836.30pep chromosome:WBcel235:III:5499190:5499976:1 gene... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG60947.497e-2443.64gene:FBgn0032261 transcript:FBtr0080091[more]
CG60947.497e-2443.64gene:FBgn0032261 transcript:FBtr0337004[more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl585.814e-2033.82mitochondrial ribosomal protein L58 [Source:ZFIN;A... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
MRPL581.539e-2331.87mitochondrial ribosomal protein L58 [Source:NCBI g... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Mrpl582.752e-2237.12mitochondrial ribosomal protein L58 [Source:MGI Sy... [more]
Mrpl585.700e-2237.59mitochondrial ribosomal protein L58 [Source:MGI Sy... [more]
Mrpl583.348e-1228.89mitochondrial ribosomal protein L58 [Source:MGI Sy... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8R035|ICT1_MOUSE3.987e-2137.59Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Mus... [more]
sp|Q14197|ICT1_HUMAN2.846e-2031.43Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Hom... [more]
sp|D2HD32|ICT1_AILME1.821e-1930.30Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Ail... [more]
sp|B5XAM2|ICT1_SALSA1.041e-1831.52Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Sal... [more]
sp|Q3T116|ICT1_BOVIN2.859e-1835.56Peptidyl-tRNA hydrolase ICT1, mitochondrial OS=Bos... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
G4VKM19.431e-4351.75RF_PROK_I domain-containing protein OS=Schistosoma... [more]
A0A183QQD81.165e-4152.55RF_PROK_I domain-containing protein OS=Schistosoma... [more]
A0A4Z2DGL97.935e-4152.48Peptidyl-tRNA hydrolase ICT1 OS=Schistosoma japoni... [more]
A0A3S5BM832.363e-4054.48RF_PROK_I domain-containing protein OS=Protopolyst... [more]
Q5D8M41.419e-3952.48SJCHGC06705 protein OS=Schistosoma japonicum OX=61... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl582.025e-2136.36mitochondrial ribosomal protein L58 [Source:NCBI g... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
PTH43.013e-1330.50Protein similar to the human peptidyl-tRNA hydrola... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO484091.658e-2345.65Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mrpl583.429e-1835.43mitochondrial ribosomal protein L58 [Source:NCBI g... [more]
back to top
BLAST of RF_PROK_I domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000021177.11.774e-14098.45SMESG000021177.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023797 ID=SMED30023797|Name=RF_PROK_I domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=727bp
GCAAAATTTAAATTATTTTATTTTTAAATTATAAATTTATAGATAATATT
CAATGATTGCACATAGATTTTTGAAATCTGGATCAAATTTTCTATATGGA
AATTTTACTATTTTTCGAGCTCTTTCATATAAAAGTAAAACTGCTACAGA
AATAGAAGATTACCATATAAATGACAAATTAAAGGAATCAAATTTAACGA
TTGGAGAATTTGGTGAAATTAATATAAAGGACTTAGAAATTAAGTATATT
AGTTCTAGTAAACCTGGAGGGCAAAACGTTAATAAAATTCATTCAAAAGT
GCAAATACAATTCCATGTCCCATCTGTCAATTGGATCCCAGATTCAGTTA
AAGAATCATTTTTGAGACGAGAATCACATAGAATTACAAAAGACAACTAT
TTCATAATTTCTTCAGACGCAACAAGGTCACAATTAATCAATCAAGCTGA
CTGCATGGATCGTATTCGTCATTCGATTAGAGAATGCATAGAAGTCAATA
AAACACCTGAAACTTCAATTGAGAAGAAAGAACGATGGGATCGCATAATT
ACAAAATCCAATGAAAGACGTTTACGACAGAAAAAGAAGGAATCCTTTAA
TAAATCAGCTCGAAACAATTATGACATGGATTAAACATTTGCCAATCATA
ATACTATCGTTTTACAGTGGAACTGATCTGTATTTAATGATTAATAAATG
TTGGAGTTTTTTAAAAAAAAAGATCGG
back to top

protein sequence of SMED30023797-orf-1

>SMED30023797-orf-1 ID=SMED30023797-orf-1|Name=SMED30023797-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=194bp
MIAHRFLKSGSNFLYGNFTIFRALSYKSKTATEIEDYHINDKLKESNLTI
GEFGEINIKDLEIKYISSSKPGGQNVNKIHSKVQIQFHVPSVNWIPDSVK
ESFLRRESHRITKDNYFIISSDATRSQLINQADCMDRIRHSIRECIEVNK
TPETSIEKKERWDRIITKSNERRLRQKKKESFNKSARNNYDMD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR000352Pep_chain_release_fac_I
Vocabulary: biological process
TermDefinition
GO:0006415translational termination
Vocabulary: molecular function
TermDefinition
GO:0003747translation release factor activity
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.30.160.20coord: 48..192
e-value: 1.2E-38
score: 134.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 173..193
NoneNo IPR availablePANTHERPTHR11075PEPTIDE CHAIN RELEASE FACTORcoord: 52..190
NoneNo IPR availablePANTHERPTHR11075:SF54PEPTIDYL-TRNA HYDROLASE ICT1, MITOCHONDRIALcoord: 52..190
NoneNo IPR availableSUPERFAMILYSSF110916Peptidyl-tRNA hydrolase domain-likecoord: 56..144
IPR000352Peptide chain release factor class IPFAMPF00472RF-1coord: 55..186
e-value: 3.4E-20
score: 72.1