EH domain-containing protein 1

Overview
NameEH domain-containing protein 1
Smed IDSMED30023773
Length (bp)2138
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of EH domain-containing protein 1 (SMED30023773) t-SNE clustered cells

Violin plots show distribution of expression levels for EH domain-containing protein 1 (SMED30023773) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of EH domain-containing protein 1 (SMED30023773) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for EH domain-containing protein 1 (SMED30023773) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023773

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
parenchymal cellSMED30023773SMESG000001303.1 dd_Smed_v4_4829_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Match: EHD1 (EH domain containing 1 [Source:HGNC Symbol;Acc:HGNC:3242])

HSP 1 Score: 690.649 bits (1781), Expect = 0.000e+0
Identity = 343/526 (65.21%), Postives = 417/526 (79.28%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD +R FR L+ FGN FLNRF C  L NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GKESKKKEL++NL   Y +I +E+ IS GDFP + +MQE+LQ  DF  F  LK KL++ VD+MLAND+A+LM M+ +E+S    Q    VKGGAFD   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HLVPPSKR
Sbjct:   23 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQV---VKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 545          
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Match: EHD1 (EH domain containing 1 [Source:HGNC Symbol;Acc:HGNC:3242])

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 343/526 (65.21%), Postives = 417/526 (79.28%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD +R FR L+ FGN FLNRF C  L NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GKESKKKEL++NL   Y +I +E+ IS GDFP + +MQE+LQ  DF  F  LK KL++ VD+MLAND+A+LM M+ +E+S    Q    VKGGAFD   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HLVPPSKR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQV---VKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Match: EHD1 (EH domain containing 1 [Source:HGNC Symbol;Acc:HGNC:3242])

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 343/526 (65.21%), Postives = 417/526 (79.28%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD +R FR L+ FGN FLNRF C  L NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GKESKKKEL++NL   Y +I +E+ IS GDFP + +MQE+LQ  DF  F  LK KL++ VD+MLAND+A+LM M+ +E+S    Q    VKGGAFD   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HLVPPSKR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQV---VKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Match: EHD3 (EH domain containing 3 [Source:HGNC Symbol;Acc:HGNC:3244])

HSP 1 Score: 664.455 bits (1713), Expect = 0.000e+0
Identity = 342/520 (65.77%), Postives = 416/520 (80.00%), Query Frame = 2
Query:   62 YANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIV 1621
            +  V EGLK LY SKLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIRY+LE+DFPGMRIGPEPTTDSF+++M GD  G+IPGNALVVD K+ FR L+ FGN FLNRF C  L NPVL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDK+R+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MPS+ GK++KKKEL++NL   Y +I +E+ IS GDFP + RMQ+ LQ  DF  F PLK KL+E VD+MLA+D+A+LM ++ +E+S    Q    VKGGAF+      FG G  +G  +G  D +WVV R +  YDEIF +L+P +GKI G  AK+ M+++KLP ++LGKIWKL+D+D DG LD DEFALA++L+++KLEG E+P+ LP HL+PPSKR + 
Sbjct:   18 FQTVSEGLKKLYKSKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDMEGIIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDNKKKELVNNLAEIYGRIEREHQISPGDFPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEESQRPIQM---VKGGAFEGTLHGPFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVLGKIWKLADIDKDGMLDDDEFALANHLIKVKLEGHELPNELPAHLLPPSKRKVA 534          
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Match: EHD4 (EH domain containing 4 [Source:HGNC Symbol;Acc:HGNC:3245])

HSP 1 Score: 660.218 bits (1702), Expect = 0.000e+0
Identity = 326/522 (62.45%), Postives = 407/522 (77.97%), Query Frame = 2
Query:   68 NVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNGGD 1633
             V  GL++LY  K+LPLE+ YRFH+FHSP LED DF+ KPM++L+GQYSTGKTTFIRY+LE+DFPGMRIGPEPTTDSF+++M G+  G  PGNALVVD K+ FR LS+FGN FLNRF C  L N VLK+I+ ID+PGILSGEKQR+ RGY+F QV++WFAERVDRIILLFDAHKLDISDEF   I+  +G +DKIR+VLNKAD++D+QQLMRVYGALMWSLGKV+ TPEV RVYIGSFW QPL    NR+LFE E  DL  D+QSLP  AA+RKLNDLIKRARLAKVHAYIIS LK +MPS+ GKE+KK+ELIS L   Y Q+ +EY IS GDFP++  MQE L++ DF  F  LK KLIE VDNML+N ++ LM +I +E++ +  Q    V+GGAFD   +  F  G  +G  +G  +++WVV + +  YDE+F +L+P NGKI+G  AK+ M+ +KLP ++LGKIWKL+D D DG LD +EFALA +L+++KL+G E+PS+LP HLVPPS R  +   D
Sbjct:   23 TVTGGLRSLYLRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISVIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPSVFGKENKKRELISRLPEIYIQLQREYQISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLSNKISPLMNLISQEETSTPTQL---VQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPSSLPPHLVPPSHRKSLPKAD 541          
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Match: rme-1 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:Q86S80])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 348/533 (65.29%), Postives = 427/533 (80.11%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQ----SDSTGQFEHRVKGGAFD--VQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRA 1615
            S+K K ++    V EGL+ +Y  KLLPLE+ ++FHDFHSP L+D DFDAKPM++L+GQYSTGKTTFIRY+LE DFPG+RIGPEPTTD F+++M GD+ G IPGNALVVD K+QFR LS FGN FLNRFQC TL N VL+++T +DTPGILSGEKQR+DRGY+F  V+EWFAERVDRIILLFDAHKLDISDEFKR IE L G EDKIRIVLNK+D +D QQLMRVYGALMWSLGKV  TPEV+RVY+GSFWD PLHYD NR+LF+ E+HDL  DLQ+LP NAALRKLNDLIKRARLAKVHAYII+ L+ QMPS++GK+ KKK+LI NL + Y+Q+ +E++IS GDFP +++M+E LQ  DF  F+PLK KL+E VD MLA D+A+LM  IPKE+    + S G  +  V+GGAF    + +  FG G  +G +KG  + +WVV R+R   D  F+SL P NG ++G  AKE+M+K+KLP ++LGK+WKL+D+D DG LD DEFALA+YL+ LKLEG EIPS LP HL+PPSKR 
Sbjct:  240 SSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDKIYEQLQREHNISPGDFPDVNKMREKLQTQDFSKFNPLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPAGSNGSADPTVRGGAFSQTTEAETPFGFGRGEGFDKGADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLPNSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKRG 772          
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Match: rme-1 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:Q86S80])

HSP 1 Score: 720.694 bits (1859), Expect = 0.000e+0
Identity = 348/533 (65.29%), Postives = 427/533 (80.11%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQ----SDSTGQFEHRVKGGAFD--VQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRA 1615
            S+K K ++    V EGL+ +Y  KLLPLE+ ++FHDFHSP L+D DFDAKPM++L+GQYSTGKTTFIRY+LE DFPG+RIGPEPTTD F+++M GD+ G IPGNALVVD K+QFR LS FGN FLNRFQC TL N VL+++T +DTPGILSGEKQR+DRGY+F  V+EWFAERVDRIILLFDAHKLDISDEFKR IE L G EDKIRIVLNK+D +D QQLMRVYGALMWSLGKV  TPEV+RVY+GSFWD PLHYD NR+LF+ E+HDL  DLQ+LP NAALRKLNDLIKRARLAKVHAYII+ L+ QMPS++GK+ KKK+LI NL + Y+Q+ +E++IS GDFP +++M+E LQ  DF  F+PLK KL+E VD MLA D+A+LM  IPKE+    + S G  +  V+GGAF    + +  FG G  +G +KG  + +WVV R+R   D  F+SL P NG ++G  AKE+M+K+KLP ++LGK+WKL+D+D DG LD DEFALA+YL+ LKLEG EIPS LP HL+PPSKR 
Sbjct:  240 SSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDKIYEQLQREHNISPGDFPDVNKMREKLQTQDFSKFNPLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPAGSNGSADPTVRGGAFSQTTEAETPFGFGRGEGFDKGADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLPNSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKRG 772          
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Match: rme-1 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:Q86S80])

HSP 1 Score: 714.916 bits (1844), Expect = 0.000e+0
Identity = 348/533 (65.29%), Postives = 427/533 (80.11%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQ----SDSTGQFEHRVKGGAFD--VQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRA 1615
            S+K K ++    V EGL+ +Y  KLLPLE+ ++FHDFHSP L+D DFDAKPM++L+GQYSTGKTTFIRY+LE DFPG+RIGPEPTTD F+++M GD+ G IPGNALVVD K+QFR LS FGN FLNRFQC TL N VL+++T +DTPGILSGEKQR+DRGY+F  V+EWFAERVDRIILLFDAHKLDISDEFKR IE L G EDKIRIVLNK+D +D QQLMRVYGALMWSLGKV  TPEV+RVY+GSFWD PLHYD NR+LF+ E+HDL  DLQ+LP NAALRKLNDLIKRARLAKVHAYII+ L+ QMPS++GK+ KKK+LI NL + Y+Q+ +E++IS GDFP +++M+E LQ  DF  F+PLK KL+E VD MLA D+A+LM  IPKE+    + S G  +  V+GGAF    + +  FG G  +G +KG  + +WVV R+R   D  F+SL P NG ++G  AKE+M+K+KLP ++LGK+WKL+D+D DG LD DEFALA+YL+ LKLEG EIPS LP HL+PPSKR 
Sbjct:   62 SSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDKIYEQLQREHNISPGDFPDVNKMREKLQTQDFSKFNPLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPAGSNGSADPTVRGGAFSQTTEAETPFGFGRGEGFDKGADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLPNSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKRG 594          
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Match: rme-1 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:Q86S80])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 349/538 (64.87%), Postives = 427/538 (79.37%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQ----SDSTGQFEHRVKGGAFD--VQQDNLFGIGASD-----GINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRA 1615
            S+K K ++    V EGL+ +Y  KLLPLE+ ++FHDFHSP L+D DFDAKPM++L+GQYSTGKTTFIRY+LE DFPG+RIGPEPTTD F+++M GD+ G IPGNALVVD K+QFR LS FGN FLNRFQC TL N VL+++T +DTPGILSGEKQR+DRGY+F  V+EWFAERVDRIILLFDAHKLDISDEFKR IE L G EDKIRIVLNK+D +D QQLMRVYGALMWSLGKV  TPEV+RVY+GSFWD PLHYD NR+LF+ E+HDL  DLQ+LP NAALRKLNDLIKRARLAKVHAYII+ L+ QMPS++GK+ KKK+LI NL + Y+Q+ +E++IS GDFP +++M+E LQ  DF  F+PLK KL+E VD MLA D+A+LM  IPKE+    + S G  +  V+GGAF    + +  FG G  D     G +KG  + +WVV R+R   D  F+SL P NG ++G  AKE+M+K+KLP ++LGK+WKL+D+D DG LD DEFALA+YL+ LKLEG EIPS LP HL+PPSKR 
Sbjct:  240 SSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDKIYEQLQREHNISPGDFPDVNKMREKLQTQDFSKFNPLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPAGSNGSADPTVRGGAFSQTTEAETPFGFGRYDARWGEGFDKGADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLPNSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKRG 777          
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Match: rme-1 (Receptor Mediated Endocytosis [Source:UniProtKB/TrEMBL;Acc:Q86S80])

HSP 1 Score: 714.146 bits (1842), Expect = 0.000e+0
Identity = 349/538 (64.87%), Postives = 427/538 (79.37%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQ----SDSTGQFEHRVKGGAFD--VQQDNLFGIGASD-----GINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRA 1615
            S+K K ++    V EGL+ +Y  KLLPLE+ ++FHDFHSP L+D DFDAKPM++L+GQYSTGKTTFIRY+LE DFPG+RIGPEPTTD F+++M GD+ G IPGNALVVD K+QFR LS FGN FLNRFQC TL N VL+++T +DTPGILSGEKQR+DRGY+F  V+EWFAERVDRIILLFDAHKLDISDEFKR IE L G EDKIRIVLNK+D +D QQLMRVYGALMWSLGKV  TPEV+RVY+GSFWD PLHYD NR+LF+ E+HDL  DLQ+LP NAALRKLNDLIKRARLAKVHAYII+ L+ QMPS++GK+ KKK+LI NL + Y+Q+ +E++IS GDFP +++M+E LQ  DF  F+PLK KL+E VD MLA D+A+LM  IPKE+    + S G  +  V+GGAF    + +  FG G  D     G +KG  + +WVV R+R   D  F+SL P NG ++G  AKE+M+K+KLP ++LGK+WKL+D+D DG LD DEFALA+YL+ LKLEG EIPS LP HL+PPSKR 
Sbjct:  240 SSKKKNKEVLETVSEGLRKIYKQKLLPLEEFHKFHDFHSPALDDPDFDAKPMILLVGQYSTGKTTFIRYLLESDFPGIRIGPEPTTDRFIAVMHGDEEGSIPGNALVVDAKKQFRALSGFGNAFLNRFQCSTLPNQVLESVTIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFKRCIEALAGNEDKIRIVLNKSDMVDHQQLMRVYGALMWSLGKVFKTPEVSRVYLGSFWDHPLHYDLNRRLFQDEQHDLFQDLQALPRNAALRKLNDLIKRARLAKVHAYIIAELRKQMPSMIGKDKKKKDLIQNLDKIYEQLQREHNISPGDFPDVNKMREKLQTQDFSKFNPLKPKLLEVVDGMLATDIARLMAQIPKEEAAAPAGSNGSADPTVRGGAFSQTTEAETPFGFGRYDARWGEGFDKGADEAEWVVSRERTTADSTFESLGPVNGYLSGRAAKEHMVKSKLPNSVLGKVWKLADIDKDGQLDADEFALANYLINLKLEGHEIPSELPKHLIPPSKRG 777          
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Match: Past1 (gene:FBgn0016693 transcript:FBtr0082655)

HSP 1 Score: 691.804 bits (1784), Expect = 0.000e+0
Identity = 351/534 (65.73%), Postives = 426/534 (79.78%), Query Frame = 2
Query:   20 MSIFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFD-VQQDNL--FGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            M  F   +   ++   NVI  LK +Y SKLLPLE+ Y+FHDFHSP+LED DFDAKPM++L+GQYSTGKTTFIRY+LE DFPG+RIGPEPTTD F+++M  DK G+IPGNALVVD K+QFRPLSK+GN FLNRFQC ++ +PVL  I+ +DTPGILSGEKQR+DRGY+F  V+EWFAERVDRIILLFDAHKLDISDEF+R IE LKG++DKIRI+LNKAD ID QQLMRVYGALMWSLGKVL TPEV RVYIGSFWDQPL +D NR+LFE EE DL  DLQSLP NAALRKLNDLIKRARLAKVHA+II+ L+  MPS+ GK+SKKK+LI NL + YD+I +E+SIS GDFP I +MQE+LQ  DF  F  LK  L++ VDNMLA D+A+LM+MIP+E+   T   +  VKGGAF+ V  D++  FG    +GI+ G  + +W+  + +   D IF  L P +GKI+G  AK+ +IK+KLP ++L KIWKLSDVD DGFLD DEFALA +L+ +KLEG E+P+ LP+HLVPPSKR
Sbjct:    1 MFSFLKREKNTQEVVENVIGELKKIYRSKLLPLEEHYQFHDFHSPKLEDPDFDAKPMILLVGQYSTGKTTFIRYLLERDFPGIRIGPEPTTDRFIAVMYDDKEGVIPGNALVVDPKKQFRPLSKYGNAFLNRFQCSSVASPVLNAISIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFRRSIEALKGHDDKIRIILNKADMIDHQQLMRVYGALMWSLGKVLQTPEVARVYIGSFWDQPLRFDANRRLFEDEEQDLFRDLQSLPRNAALRKLNDLIKRARLAKVHAFIIAELRKDMPSVFGKDSKKKDLIKNLGQVYDRIQREHSISPGDFPDIKKMQEVLQHQDFTKFHSLKPHLLDIVDNMLAKDIARLMEMIPQEE--MTMVADPIVKGGAFEGVIDDHVSPFGYMKGEGIDAGYGEHEWICNKDKPRTDGIFNGLGPVDGKISGATAKQELIKSKLPNSVLSKIWKLSDVDGDGFLDSDEFALALHLINVKLEGCELPTVLPEHLVPPSKR 532          
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Match: Past1 (gene:FBgn0016693 transcript:FBtr0082654)

HSP 1 Score: 691.419 bits (1783), Expect = 0.000e+0
Identity = 350/531 (65.91%), Postives = 425/531 (80.04%), Query Frame = 2
Query:   29 FKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFD-VQQDNL--FGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            F   +   ++   NVI  LK +Y SKLLPLE+ Y+FHDFHSP+LED DFDAKPM++L+GQYSTGKTTFIRY+LE DFPG+RIGPEPTTD F+++M  DK G+IPGNALVVD K+QFRPLSK+GN FLNRFQC ++ +PVL  I+ +DTPGILSGEKQR+DRGY+F  V+EWFAERVDRIILLFDAHKLDISDEF+R IE LKG++DKIRI+LNKAD ID QQLMRVYGALMWSLGKVL TPEV RVYIGSFWDQPL +D NR+LFE EE DL  DLQSLP NAALRKLNDLIKRARLAKVHA+II+ L+  MPS+ GK+SKKK+LI NL + YD+I +E+SIS GDFP I +MQE+LQ  DF  F  LK  L++ VDNMLA D+A+LM+MIP+E+   T   +  VKGGAF+ V  D++  FG    +GI+ G  + +W+  + +   D IF  L P +GKI+G  AK+ +IK+KLP ++L KIWKLSDVD DGFLD DEFALA +L+ +KLEG E+P+ LP+HLVPPSKR
Sbjct:   10 FLKREKNTQEVVENVIGELKKIYRSKLLPLEEHYQFHDFHSPKLEDPDFDAKPMILLVGQYSTGKTTFIRYLLERDFPGIRIGPEPTTDRFIAVMYDDKEGVIPGNALVVDPKKQFRPLSKYGNAFLNRFQCSSVASPVLNAISIVDTPGILSGEKQRIDRGYDFTGVLEWFAERVDRIILLFDAHKLDISDEFRRSIEALKGHDDKIRIILNKADMIDHQQLMRVYGALMWSLGKVLQTPEVARVYIGSFWDQPLRFDANRRLFEDEEQDLFRDLQSLPRNAALRKLNDLIKRARLAKVHAFIIAELRKDMPSVFGKDSKKKDLIKNLGQVYDRIQREHSISPGDFPDIKKMQEVLQHQDFTKFHSLKPHLLDIVDNMLAKDIARLMEMIPQEE--MTMVADPIVKGGAFEGVIDDHVSPFGYMKGEGIDAGYGEHEWICNKDKPRTDGIFNGLGPVDGKISGATAKQELIKSKLPNSVLSKIWKLSDVDGDGFLDSDEFALALHLINVKLEGCELPTVLPEHLVPPSKR 538          
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Match: CG9297 (gene:FBgn0038181 transcript:FBtr0333192)

HSP 1 Score: 159.073 bits (401), Expect = 4.269e-40
Identity = 88/308 (28.57%), Postives = 162/308 (52.60%), Query Frame = 2
Query:   53 EKSYANVIE----GLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFP--GMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKN 958
            EK+  NV E     +K +Y + + PLE +Y++ D  +    D +  +KP+++ +G +S GK++ + Y+ + ++    +R G EP+   F  LM G+++ ++ G  L  D    F  L KFG     R + + + + +L+ +  ++ PGIL   KQ + R + F    +WF +R D I L++D  KLD+  E + +++ LKG E + RI+LNKAD +  ++L+RV GAL+W++  ++ + +   +Y  S W  P       +L   +E   + DL++        K+    + A   + HA ++    N
Sbjct:  525 EKATDNVAEIILRDIKRIYENAVKPLETLYKYRDLSNRHFSDPEIFSKPLILFMGPWSGGKSSILNYLTDNEYTPNSLRTGAEPSPAYFNILMWGNETEVLDGTQLAADYT--FAGLQKFGQGLEERLRGLKMKSKILEKVNIVEIPGILEVRKQ-VSRVFPFNDACQWFIDRADIIFLVYDPAKLDVGPETEAILDQLKGREYQTRIILNKADTVKPEELLRVQGALIWNISPLMSSAQPPLMYTTSLWTHPYQDGAPARLLLAQERAFLRDLRTAIDKRIEHKIASARRFAVRVRNHAKMVDCYLN 829          
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Match: CG9297 (gene:FBgn0038181 transcript:FBtr0082828)

HSP 1 Score: 159.073 bits (401), Expect = 4.269e-40
Identity = 88/308 (28.57%), Postives = 162/308 (52.60%), Query Frame = 2
Query:   53 EKSYANVIE----GLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFP--GMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKN 958
            EK+  NV E     +K +Y + + PLE +Y++ D  +    D +  +KP+++ +G +S GK++ + Y+ + ++    +R G EP+   F  LM G+++ ++ G  L  D    F  L KFG     R + + + + +L+ +  ++ PGIL   KQ + R + F    +WF +R D I L++D  KLD+  E + +++ LKG E + RI+LNKAD +  ++L+RV GAL+W++  ++ + +   +Y  S W  P       +L   +E   + DL++        K+    + A   + HA ++    N
Sbjct:  525 EKATDNVAEIILRDIKRIYENAVKPLETLYKYRDLSNRHFSDPEIFSKPLILFMGPWSGGKSSILNYLTDNEYTPNSLRTGAEPSPAYFNILMWGNETEVLDGTQLAADYT--FAGLQKFGQGLEERLRGLKMKSKILEKVNIVEIPGILEVRKQ-VSRVFPFNDACQWFIDRADIIFLVYDPAKLDVGPETEAILDQLKGREYQTRIILNKADTVKPEELLRVQGALIWNISPLMSSAQPPLMYTTSLWTHPYQDGAPARLLLAQERAFLRDLRTAIDKRIEHKIASARRFAVRVRNHAKMVDCYLN 829          
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Match: CG9297 (gene:FBgn0038181 transcript:FBtr0333193)

HSP 1 Score: 159.073 bits (401), Expect = 4.269e-40
Identity = 88/308 (28.57%), Postives = 162/308 (52.60%), Query Frame = 2
Query:   53 EKSYANVIE----GLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFP--GMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKN 958
            EK+  NV E     +K +Y + + PLE +Y++ D  +    D +  +KP+++ +G +S GK++ + Y+ + ++    +R G EP+   F  LM G+++ ++ G  L  D    F  L KFG     R + + + + +L+ +  ++ PGIL   KQ + R + F    +WF +R D I L++D  KLD+  E + +++ LKG E + RI+LNKAD +  ++L+RV GAL+W++  ++ + +   +Y  S W  P       +L   +E   + DL++        K+    + A   + HA ++    N
Sbjct:  525 EKATDNVAEIILRDIKRIYENAVKPLETLYKYRDLSNRHFSDPEIFSKPLILFMGPWSGGKSSILNYLTDNEYTPNSLRTGAEPSPAYFNILMWGNETEVLDGTQLAADYT--FAGLQKFGQGLEERLRGLKMKSKILEKVNIVEIPGILEVRKQ-VSRVFPFNDACQWFIDRADIIFLVYDPAKLDVGPETEAILDQLKGREYQTRIILNKADTVKPEELLRVQGALIWNISPLMSSAQPPLMYTTSLWTHPYQDGAPARLLLAQERAFLRDLRTAIDKRIEHKIASARRFAVRVRNHAKMVDCYLN 829          
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Match: ehd1b (EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2069])

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 340/527 (64.52%), Postives = 419/527 (79.51%), Query Frame = 2
Query:   32 KSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            K  K K  + +  V +GLK LY +KL PLE  YRFHDFHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G++ G+IPGNALVVD K+ FR L+ FGN FLNRF C  + NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI  LK +EDK+R+VLNKAD+I +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE DL  D+Q LP NAALRKLNDLIKRARLAKV AYIISSLK +MP++ GKE+KKKELI+NL   Y +I KE+ IS GDFPK+ +MQE+L   DF  F  LK KL+E V++MLAND+AKLM ++ +E++    Q    V+GGAF+   +  FG G  +G  +G  + +WVV + +  YDEIF +L+P NGK++G +AK+ M+K+KLP N+LGKIWKL+DVD DG+LD +EFALA++L+++KLEG E+P+ LPDHLVPPSKR
Sbjct:    7 KDGKKKDPELFQTVSDGLKRLYRTKLFPLEDAYRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHGEQEGLIPGNALVVDPKKPFRKLNAFGNAFLNRFICAQMPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIRALKNHEDKMRVVLNKADQIGTQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWAQPLLVADNRKLFEAEEQDLFRDIQGLPRNAALRKLNDLIKRARLAKVQAYIISSLKKEMPNVFGKENKKKELIANLGEIYAKIEKEHQISPGDFPKLSKMQEVLAGQDFTKFQGLKPKLLESVEDMLANDIAKLMTLVRQEEASMPSQ---AVQGGAFEGTMNGPFGHGYGEGAGEGIDELEWVVAKDKPTYDEIFYTLSPVNGKVSGAMAKKEMVKSKLPNNVLGKIWKLADVDKDGYLDDEEFALANHLIKVKLEGHELPADLPDHLVPPSKR 530          
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Match: ehd1b (EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2069])

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 340/527 (64.52%), Postives = 419/527 (79.51%), Query Frame = 2
Query:   32 KSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            K  K K  + +  V +GLK LY +KL PLE  YRFHDFHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G++ G+IPGNALVVD K+ FR L+ FGN FLNRF C  + NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI  LK +EDK+R+VLNKAD+I +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE DL  D+Q LP NAALRKLNDLIKRARLAKV AYIISSLK +MP++ GKE+KKKELI+NL   Y +I KE+ IS GDFPK+ +MQE+L   DF  F  LK KL+E V++MLAND+AKLM ++ +E++    Q    V+GGAF+   +  FG G  +G  +G  + +WVV + +  YDEIF +L+P NGK++G +AK+ M+K+KLP N+LGKIWKL+DVD DG+LD +EFALA++L+++KLEG E+P+ LPDHLVPPSKR
Sbjct:    7 KDGKKKDPELFQTVSDGLKRLYRTKLFPLEDAYRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHGEQEGLIPGNALVVDPKKPFRKLNAFGNAFLNRFICAQMPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIRALKNHEDKMRVVLNKADQIGTQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWAQPLLVADNRKLFEAEEQDLFRDIQGLPRNAALRKLNDLIKRARLAKVQAYIISSLKKEMPNVFGKENKKKELIANLGEIYAKIEKEHQISPGDFPKLSKMQEVLAGQDFTKFQGLKPKLLESVEDMLANDIAKLMTLVRQEEASMPSQ---AVQGGAFEGTMNGPFGHGYGEGAGEGIDELEWVVAKDKPTYDEIFYTLSPVNGKVSGAMAKKEMVKSKLPNNVLGKIWKLADVDKDGYLDDEEFALANHLIKVKLEGHELPADLPDHLVPPSKR 530          
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Match: ehd1b (EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-030131-2069])

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 340/527 (64.52%), Postives = 419/527 (79.51%), Query Frame = 2
Query:   32 KSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            K  K K  + +  V +GLK LY +KL PLE  YRFHDFHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G++ G+IPGNALVVD K+ FR L+ FGN FLNRF C  + NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI  LK +EDK+R+VLNKAD+I +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE DL  D+Q LP NAALRKLNDLIKRARLAKV AYIISSLK +MP++ GKE+KKKELI+NL   Y +I KE+ IS GDFPK+ +MQE+L   DF  F  LK KL+E V++MLAND+AKLM ++ +E++    Q    V+GGAF+   +  FG G  +G  +G  + +WVV + +  YDEIF +L+P NGK++G +AK+ M+K+KLP N+LGKIWKL+DVD DG+LD +EFALA++L+++KLEG E+P+ LPDHLVPPSKR
Sbjct:    7 KDGKKKDPELFQTVSDGLKRLYRTKLFPLEDAYRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHGEQEGLIPGNALVVDPKKPFRKLNAFGNAFLNRFICAQMPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIRALKNHEDKMRVVLNKADQIGTQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWAQPLLVADNRKLFEAEEQDLFRDIQGLPRNAALRKLNDLIKRARLAKVQAYIISSLKKEMPNVFGKENKKKELIANLGEIYAKIEKEHQISPGDFPKLSKMQEVLAGQDFTKFQGLKPKLLESVEDMLANDIAKLMTLVRQEEASMPSQ---AVQGGAFEGTMNGPFGHGYGEGAGEGIDELEWVVAKDKPTYDEIFYTLSPVNGKVSGAMAKKEMVKSKLPNNVLGKIWKLADVDKDGYLDDEEFALANHLIKVKLEGHELPADLPDHLVPPSKR 530          
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Match: ehd1a (EH-domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2518])

HSP 1 Score: 686.026 bits (1769), Expect = 0.000e+0
Identity = 339/517 (65.57%), Postives = 417/517 (80.66%), Query Frame = 2
Query:   62 YANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + NV +GLK LY +KL PLE  Y FHDFHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G++ G+IPGNALVVD K+ FR L+ FGN FLNRF C  LNNPVL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDK+R+VLNKAD+I +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIIS+LK +MPS+ GK+SKKKELI+NL   Y++I KE++IS GDFP + +MQE+L   DF  F  +K KL+E V++ML ND+AKLM ++ KE++    Q    VKGGAF+   +  FG G  +G  +G  + +W+VGR +  YDEIF +L+P NGKI+G  AK+ M K+KLP  +LGKIW L+DVD DG+LD +EFALA++L+++KLEG E+P+ LP+HLVPPSKR
Sbjct:   16 FQNVSDGLKRLYRTKLFPLEDTYHFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHGEQEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFMCAQLNNPVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQISTQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWAQPLLIAENRKLFEAEEQDLFQDIQSLPRNAALRKLNDLIKRARLAKVHAYIISALKKEMPSVFGKDSKKKELINNLGAIYEKIQKEHNISPGDFPNLKKMQELLSVQDFTKFPAMKPKLLESVEDMLGNDIAKLMALVRKEEATMPSQ---SVKGGAFEGISNGPFGHGYGEGAGEGIDELEWIVGRDKPSYDEIFYTLSPINGKISGATAKKEMTKSKLPNTVLGKIWTLADVDKDGYLDDEEFALANHLIKVKLEGFELPAKLPNHLVPPSKR 529          
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Match: ehd3 (EH-domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-041014-352])

HSP 1 Score: 660.603 bits (1703), Expect = 0.000e+0
Identity = 338/519 (65.13%), Postives = 414/519 (79.77%), Query Frame = 2
Query:   62 YANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAI 1618
            +  V EGLK LY +KLLPLE+ Y+FH+FHSP LED DFD KPMV+L+GQYSTGKT+FIRY+LE+DFPGMRIGPEPTTDSF+++M G   G+IPGNALVVD K+ FR L+ FGN FLNRF C  L NPVL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MPS+ GK++KKKELI++L   Y +I +E+ IS GDFP + +MQE LQ  D   F PLKMKL++ VD+MLA+D+A+LM ++ +E++    Q    VKGGAF+   +  FG G  +G  +G  + +WVV R +  YDEIF +L+P NGK+ G  AK  M+K+KLP  +LGKIWKL+D+D DG LD +EFALA++L+++KLEG E+PS LP HLVPPSKR +
Sbjct:   18 FQTVSEGLKKLYKTKLLPLEEHYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTSFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGTMEGLIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDNKKKELINSLGEIYSRIEREHQISPGDFPNLKKMQEQLQAHDLNKFQPLKMKLLDTVDDMLAHDIAQLMVLVRQEETQRPNQV---VKGGAFEGTMNGPFGHGYGEGAGEGIDEVEWVVARDKPMYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPSDLPGHLVPPSKRKV 533          
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Match: nfe2l2 (nuclear factor, erythroid 2 like 2 [Source:Xenbase;Acc:XB-GENE-943926])

HSP 1 Score: 685.641 bits (1768), Expect = 0.000e+0
Identity = 341/526 (64.83%), Postives = 415/526 (78.90%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFHDFHSP LED DF   PMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD K+ FR LS FGN FLNRF C  L NPVL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYII +LK +MP++ GKE+KKKELI+NL   Y +I KE+ IS GDFP I +MQEIL   DF  F  +K KL++ VD+MLA+D+AKLM M+ +E+S  T Q    VKGGAF+   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HL+PPSKR
Sbjct:    9 TRRKKEPELFQTVSEGLRKLYTHKLLPLEETYRFHDFHSPALEDADFHNNPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPVEGVMPGNALVVDPKKPFRKLSAFGNAFLNRFMCAQLPNPVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIIGALKKEMPNVFGKENKKKELINNLHEIYMKIEKEHQISPGDFPNIKKMQEILMTQDFAKFQAVKPKLLDTVDDMLASDIAKLMVMVRQEESQMTNQV---VKGGAFEGTMNGPFGHGYGEGAGEGIDDFEWVVGKDKPTYDEIFFTLSPVNGKITGASAKKEMVKSKLPNTVLGKIWKLADVDRDGLLDDEEFALANHLIKIKLEGHELPADLPSHLIPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:Xenbase;Acc:XB-GENE-854514])

HSP 1 Score: 676.781 bits (1745), Expect = 0.000e+0
Identity = 335/526 (63.69%), Postives = 416/526 (79.09%), Query Frame = 2
Query:   41 KSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAI 1618
            + K  + +  V +GL+ LY +KLLPLE+ Y+FH+FHSP LED DFD KPMV+L+GQYSTGKTTFIRY+LE+DFPGMRIGPEPTTDSF+++M GD  G+IPGNALVVD K+ FR L+ FGN FLNRF C  L +PVL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDK+R+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GK++KKKEL++ L   Y +I +E+ IS GDFP + +MQ++L   DF  F PLK KL+E VD MLA+D+A LM ++ +E++    Q    VKGGAF+  Q+  FG G  +G  +G  D DWVV R +  YDEIF +L+P NGK+ G  AK  M+K+KLP  +LGKIWKL+D+D DG LD +EFALA++L+++KLEG E+P+ LP HL+PPSKR +
Sbjct:   11 RKKDPEVFQTVSDGLRKLYKTKLLPLEEYYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDVEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPSPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPAVFGKDNKKKELVAGLGEIYARIEREHQISPGDFPNLKKMQDLLLAQDFNKFQPLKNKLLETVDEMLAHDIAHLMVLVRQEETQKPVQV---VKGGAFEGTQNGPFGHGYGEGAGEGIDDADWVVSRDKPMYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPNDLPCHLLPPSKRKV 533          
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:Xenbase;Acc:XB-GENE-854514])

HSP 1 Score: 676.396 bits (1744), Expect = 0.000e+0
Identity = 335/524 (63.93%), Postives = 415/524 (79.20%), Query Frame = 2
Query:   41 KSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + K  + +  V +GL+ LY +KLLPLE+ Y+FH+FHSP LED DFD KPMV+L+GQYSTGKTTFIRY+LE+DFPGMRIGPEPTTDSF+++M GD  G+IPGNALVVD K+ FR L+ FGN FLNRF C  L +PVL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDK+R+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GK++KKKEL++ L   Y +I +E+ IS GDFP + +MQ++L   DF  F PLK KL+E VD MLA+D+A LM ++ +E++    Q    VKGGAF+  Q+  FG G  +G  +G  D DWVV R +  YDEIF +L+P NGK+ G  AK  M+K+KLP  +LGKIWKL+D+D DG LD +EFALA++L+++KLEG E+P+ LP HL+PPSKR
Sbjct:   11 RKKDPEVFQTVSDGLRKLYKTKLLPLEEYYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDVEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPSPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPAVFGKDNKKKELVAGLGEIYARIEREHQISPGDFPNLKKMQDLLLAQDFNKFQPLKNKLLETVDEMLAHDIAHLMVLVRQEETQKPVQV---VKGGAFEGTQNGPFGHGYGEGAGEGIDDADWVVSRDKPMYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPNDLPCHLLPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Match: dyrk2 (dual specificity tyrosine phosphorylation regulated kinase 2 [Source:Xenbase;Acc:XB-GENE-854514])

HSP 1 Score: 666.381 bits (1718), Expect = 0.000e+0
Identity = 335/542 (61.81%), Postives = 416/542 (76.75%), Query Frame = 2
Query:   41 KSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDR----------------GYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAI 1618
            + K  + +  V +GL+ LY +KLLPLE+ Y+FH+FHSP LED DFD KPMV+L+GQYSTGKTTFIRY+LE+DFPGMRIGPEPTTDSF+++M GD  G+IPGNALVVD K+ FR L+ FGN FLNRF C  L +PVL++I+ IDTPGILSGEKQR+ R                GY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDK+R+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GK++KKKEL++ L   Y +I +E+ IS GDFP + +MQ++L   DF  F PLK KL+E VD MLA+D+A LM ++ +E++    Q    VKGGAF+  Q+  FG G  +G  +G  D DWVV R +  YDEIF +L+P NGK+ G  AK  M+K+KLP  +LGKIWKL+D+D DG LD +EFALA++L+++KLEG E+P+ LP HL+PPSKR +
Sbjct:   11 RKKDPEVFQTVSDGLRKLYKTKLLPLEEYYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDVEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPSPVLESISVIDTPGILSGEKQRISREREESGYSGLRRCTYGGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPAVFGKDNKKKELVAGLGEIYARIEREHQISPGDFPNLKKMQDLLLAQDFNKFQPLKNKLLETVDEMLAHDIAHLMVLVRQEETQKPVQV---VKGGAFEGTQNGPFGHGYGEGAGEGIDDADWVVSRDKPMYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPNDLPCHLLPPSKRKV 549          
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Match: ehd4 (EH domain containing 4 [Source:NCBI gene;Acc:100125054])

HSP 1 Score: 645.966 bits (1665), Expect = 0.000e+0
Identity = 329/527 (62.43%), Postives = 405/527 (76.85%), Query Frame = 2
Query:   32 KSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            K N    +     V  GL+ LY  KLLPLE+ YRFH+FHSP LE+ DF   PMV+L+GQYSTGKTTFIRY+LE+DFPGMRIGPEPTTDSF+++M G+K G IPGNALVVD K+ FR L+ FGN FLNRF C  L N VL++I+ ID+PGILSGEKQR+ RGY+F QV++WFAERVDRIILLFDAHKLDISDEF   I   +G +DKIR+VLNKAD++D+QQLMRVYGALMWSLGKV+ TPEV RVYIGSFW +PL    NRKLFE+E  DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIIS LK +MP++ GK++KKKELIS L   Y Q+ +E+ IS GDFP + +MQ+ L+  DF  F  +K KLIE VDNMLAN +A LM MI +E+ +   Q  H   GGAF+   +  FG G  +G  +G  D++WVV + +  YDE+F +L+P NGKI+G  AK+ M+ +KLP ++LGKIWKL+D D DG LD +EFALA +L+++KLEG E+P+ LP HLVPPS+R
Sbjct:    7 KENAKGQQDVLQTVTGGLQALYTGKLLPLEEHYRFHEFHSPALEEADFKNLPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGEKEGSIPGNALVVDPKKPFRKLNSFGNAFLNRFMCSQLPNEVLRSISIIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIRAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVVRVYIGSFWSKPLQNTENRKLFEMEAQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISHLKKEMPAVFGKDTKKKELISRLPEIYIQLQREHQISPGDFPDVKKMQQQLEMYDFSKFHTMKPKLIESVDNMLANKIAPLMSMIREEECNMPTQMVH---GGAFEGTMEGPFGQGYGEGAGEGAEDEEWVVAKDKPVYDELFYTLSPINGKISGVSAKKEMVNSKLPNSVLGKIWKLADNDKDGMLDDEEFALAKHLIKIKLEGYELPNDLPSHLVPPSQR 530          
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Match: Ehd1 (EH-domain containing 1 [Source:MGI Symbol;Acc:MGI:1341878])

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 342/526 (65.02%), Postives = 417/526 (79.28%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD +R FR L+ FGN FLNRF C  L NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GKESKKKEL++NL   Y +I +E+ IS GDFP + +MQE+LQ  DF  F  LK KL++ VD+MLAND+A+LM M+ +E+S    Q    VKGGAFD   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HL+PPSKR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISSGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQ---AVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLIPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Match: Ehd1 (EH-domain containing 1 [Source:MGI Symbol;Acc:MGI:1341878])

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 342/526 (65.02%), Postives = 417/526 (79.28%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD +R FR L+ FGN FLNRF C  L NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GKESKKKEL++NL   Y +I +E+ IS GDFP + +MQE+LQ  DF  F  LK KL++ VD+MLAND+A+LM M+ +E+S    Q    VKGGAFD   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HL+PPSKR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISSGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQ---AVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLIPPSKR 531          
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Match: Ehd3 (EH-domain containing 3 [Source:MGI Symbol;Acc:MGI:1928900])

HSP 1 Score: 659.448 bits (1700), Expect = 0.000e+0
Identity = 327/500 (65.40%), Postives = 401/500 (80.20%), Query Frame = 2
Query:  119 EKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAI 1618
            E+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIRY+LE+DFPGMRIGPEPTTDSF+++M GD  G+IPGNALVVD K+ FR L+ FGN FLNRF C  L N VL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDK+R+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MPS+ GK++KKKEL++NL   Y +I +E+ IS GDFP + RMQ+ LQ  DF  F PLK KL+E VD+MLA+D+A+LM ++ +E++    Q    VKGGAF+      FG G  +G  +G  D +WVV R +  YDEIF +L+P +GKI G  AK+ M+++KLP ++LGKIWKL+D+D DG LD +EFALA++L+++KLEG E+PS LP HL+PPSKR +
Sbjct:   37 EEYYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMQGDVEGIIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNAVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPSVFGKDTKKKELVNNLAEIYGRIEREHQISPGDFPNLKRMQDQLQAQDFSKFQPLKSKLLEVVDDMLAHDIAQLMVLVRQEETQRPVQM---VKGGAFEGTLQGPFGHGYGEGAGEGIDDAEWVVARDKPMYDEIFYTLSPVDGKITGANAKKEMVRSKLPNSVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPSELPAHLLPPSKRKV 533          
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Match: Ehd4 (EH-domain containing 4 [Source:MGI Symbol;Acc:MGI:1919619])

HSP 1 Score: 654.44 bits (1687), Expect = 0.000e+0
Identity = 323/522 (61.88%), Postives = 404/522 (77.39%), Query Frame = 2
Query:   68 NVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNGGD 1633
             V  GL++LY  K+LPLE+ YRFH+FHSP LED DF+ KPM++L+GQYSTGKTTFIRY+LE+DFPGMRIGPEPTTDSF+++M G+  G  PGNALVVD K+ FR LS+FGN FLNRF C  L N VLK+I+ ID+PGILSGEKQR+ RGY+F QV++WFAERVDRIILLFDAHKLDISDEF   I+  +G +DKIR+VLNKAD++D+QQLMRVYGALMWSLGKV+ TPEV RVYIGSFW QPL    NR+LFE E  DL  D+QSLP  AA+RKLNDLIKRARLAKVHAYIIS LK +MP++ GKE+KK+ELI  L   Y Q+ +EY IS GDFP++  MQE L++ DF  F  LK KLIE VDNML N ++ LM +I +E+ +   Q    V+GGAFD   +  F  G  +G  +G  +++WVV + +  YDE+F +L+P NGKI+G  AK+ M+ +KLP ++LGKIWKL+D D DG LD +EFALA +L+++KL+G E+P++LP HLVPPS R  +   D
Sbjct:   23 TVTGGLRSLYQRKVLPLEEAYRFHEFHSPALEDADFENKPMILLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDSFIAVMYGETEGSTPGNALVVDPKKPFRKLSRFGNAFLNRFMCSQLPNQVLKSISIIDSPGILSGEKQRISRGYDFCQVLQWFAERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVLRVYIGSFWAQPLQNTDNRRLFEAEAQDLFRDIQSLPQKAAVRKLNDLIKRARLAKVHAYIISYLKKEMPNMFGKENKKRELIYRLPEIYVQLQREYQISAGDFPEVKAMQEQLENYDFTKFHSLKPKLIEAVDNMLTNKISSLMGLISQEEMNMPTQM---VQGGAFDGTTEGPFNQGYGEGAKEGADEEEWVVAKDKPVYDELFYTLSPINGKISGVNAKKEMVTSKLPNSVLGKIWKLADCDCDGMLDEEEFALAKHLIKIKLDGYELPNSLPPHLVPPSHRKSLPKAD 541          
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Match: Ehd2 (EH-domain containing 2 [Source:MGI Symbol;Acc:MGI:2154274])

HSP 1 Score: 612.838 bits (1579), Expect = 0.000e+0
Identity = 312/520 (60.00%), Postives = 392/520 (75.38%), Query Frame = 2
Query:   68 NVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLF-GIGASDGINKGKF----DDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
             V   LK LY +KLLPLE+ YRF  FHSP LED DFD KPMV++ GQYSTGKT+FI+Y+LE++ PG R+GPEPTTD FV++M G+  G +PGNALVVD ++ FR L+ FGN FLNRF C  L N VL++I+ IDTPGILSG KQR+ RGY+F  V+ WFAERVD IILLFDAHKL+ISDEF   I  L+G+EDKIR+VLNKAD +++QQLMRVYGALMW+LGKV+ TPEV RVYIGSFW QPL    NR+LFELEE DL  D+Q LP +AALRKLNDL+KRARL +VHAYIIS LK +MP++ GKE+KKK+LI  L   + +I  E+ IS GDFP   +MQE+L   DF  F  LK KL+E +D+MLA D+AKLM ++ +E+ +S    E  V+GGAF+  +   F   G  + I  G+     D +WVV + + +YDEIF +L PA+GK++G+ AK +M+ TKLP ++LG+IWKLSDVD DG LD +EFALAS+L+E KLEG  +P+ LP  LVPPSKR
Sbjct:   20 TVTSSLKELYRTKLLPLEEHYRFGSFHSPALEDADFDGKPMVLVAGQYSTGKTSFIQYLLEQEVPGSRVGPEPTTDCFVAVMHGETEGTVPGNALVVDPEKPFRKLNPFGNTFLNRFMCAQLPNQVLESISIIDTPGILSGAKQRVSRGYDFPAVLRWFAERVDLIILLFDAHKLEISDEFSEAIGALRGHEDKIRVVLNKADMVETQQLMRVYGALMWALGKVVGTPEVLRVYIGSFWSQPLLVPDNRRLFELEEQDLFRDIQGLPRHAALRKLNDLVKRARLVRVHAYIISYLKKEMPTVFGKENKKKQLILKLPVIFAKIQLEHHISPGDFPDCQKMQELLMAHDFTKFHSLKPKLLEALDDMLAQDIAKLMPLLRQEELESV---EAGVQGGAFEGTRMGPFVERGPDEAIEDGEEGSEDDAEWVVTKDKSKYDEIFYNLAPADGKLSGSKAKTWMVGTKLPNSVLGRIWKLSDVDRDGMLDDEEFALASHLIEAKLEGHGLPTNLPRRLVPPSKR 536          
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5RBP4|EHD1_PONAB (EH domain-containing protein 1 OS=Pongo abelii OX=9601 GN=EHD1 PE=2 SV=1)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 343/526 (65.21%), Postives = 417/526 (79.28%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD +R FR L+ FGN FLNRF C  L NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GKESKKKEL++NL   Y +I +E+ IS GDFP + +MQE+LQ  DF  F  LK KL++ VD+MLAND+A+LM M+ +E+S    Q    VKGGAFD   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HLVPPSKR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQV---VKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 531          
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9H4M9|EHD1_HUMAN (EH domain-containing protein 1 OS=Homo sapiens OX=9606 GN=EHD1 PE=1 SV=2)

HSP 1 Score: 690.263 bits (1780), Expect = 0.000e+0
Identity = 343/526 (65.21%), Postives = 417/526 (79.28%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD +R FR L+ FGN FLNRF C  L NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GKESKKKEL++NL   Y +I +E+ IS GDFP + +MQE+LQ  DF  F  LK KL++ VD+MLAND+A+LM M+ +E+S    Q    VKGGAFD   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HLVPPSKR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQV---VKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 531          
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q5E9R3|EHD1_BOVIN (EH domain-containing protein 1 OS=Bos taurus OX=9913 GN=EHD1 PE=1 SV=1)

HSP 1 Score: 689.878 bits (1779), Expect = 0.000e+0
Identity = 343/526 (65.21%), Postives = 417/526 (79.28%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD +R FR L+ FGN FLNRF C  L NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GKESKKKEL++NL   Y +I +E+ IS GDFP + +MQE+LQ  DF  F  LK KL++ VD+MLAND+A+LM M+ +E+S    Q    VKGGAFD   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HLVPPSKR
Sbjct:    9 ARRKKEPELFQTVSEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISPGDFPNLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPAQV---VKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDRDGLLDDEEFALANHLIKVKLEGHELPADLPPHLVPPSKR 531          
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q641Z6|EHD1_RAT (EH domain-containing protein 1 OS=Rattus norvegicus OX=10116 GN=Ehd1 PE=1 SV=1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 342/526 (65.02%), Postives = 417/526 (79.28%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD +R FR L+ FGN FLNRF C  L NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GKESKKKEL++NL   Y +I +E+ IS GDFP + +MQE+LQ  DF  F  LK KL++ VD+MLAND+A+LM M+ +E+S    Q    VKGGAFD   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HL+PPSKR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISSGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQ---AVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLIPPSKR 531          
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Match: sp|Q9WVK4|EHD1_MOUSE (EH domain-containing protein 1 OS=Mus musculus OX=10090 GN=Ehd1 PE=1 SV=1)

HSP 1 Score: 689.493 bits (1778), Expect = 0.000e+0
Identity = 342/526 (65.02%), Postives = 417/526 (79.28%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + + K  + +  V EGL+ LY  KLLPLE+ YRFH+FHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G   G++PGNALVVD +R FR L+ FGN FLNRF C  L NPVL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIISSLK +MP++ GKESKKKEL++NL   Y +I +E+ IS GDFP + +MQE+LQ  DF  F  LK KL++ VD+MLAND+A+LM M+ +E+S    Q    VKGGAFD   +  FG G  +G  +G  D +WVVG+ +  YDEIF +L+P NGKI G  AK+ M+K+KLP  +LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P+ LP HL+PPSKR
Sbjct:    9 ARRKKEPELFQTVAEGLRQLYAQKLLPLEEHYRFHEFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLIEQDFPGMRIGPEPTTDSFIAVMHGPTEGVVPGNALVVDPRRPFRKLNAFGNAFLNRFMCAQLPNPVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISSLKKEMPNVFGKESKKKELVNNLGEIYQKIEREHQISSGDFPSLRKMQELLQTQDFSKFQALKPKLLDTVDDMLANDIARLMVMVRQEESLMPSQ---AVKGGAFDGTMNGPFGHGYGEGAGEGIDDVEWVVGKDKPTYDEIFYTLSPVNGKITGANAKKEMVKSKLPNTVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPADLPPHLIPPSKR 531          
BLAST of EH domain-containing protein 1 vs. TrEMBL
Match: A0A5J4NPS3 (EH domain-containing protein 1 OS=Paragonimus westermani OX=34504 GN=DEA37_0011781 PE=3 SV=1)

HSP 1 Score: 732.635 bits (1890), Expect = 0.000e+0
Identity = 360/537 (67.04%), Postives = 436/537 (81.19%), Query Frame = 2
Query:   20 MSIFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIP------KEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            + IFK+NK + +++Y NVIEGL  LY  KL PLE  Y+FHDFHSP LE GDF +KPMV+L+GQYSTGKTTFIRY+L++DFPGMRIGPEPTTDSF+++M G++ G+IPGNALV+D K+QFRP+S+FGN+FLNRFQC  L N VL+++TF+DTPGILSGEKQR+DRGY F  VIEWFAERVDRIILLFDAHKLDISDEFKRVIE+LKG EDKIRIVLNKAD +DSQQLMRVYGALMWSLGK+LYTPEV RV+IGSFWD PL +D NRKLFELEE DL  DL SLP +AALRKLND I+RARLAKVHAYII+ LKN+MP+L+G+E+KK+ELI+NL + Y+ +S+ + ISIGDFP + RMQE L   DF++FS L+ KLI+ VD MLAND+AKLMQMIP      +EQ  +       V+GGAFD   D  F   AS+GIN+G FD DW+V R R E D IF +LNP NGKI+G  A+++M+K+ LP + L KIW L DVD DG LD DEFAL  +L++L+L G+ +PS LP HL+PPSKR
Sbjct:    2 IKIFKNNKPQDQEAYTNVIEGLNRLYTQKLFPLETAYKFHDFHSPALESGDFHSKPMVLLIGQYSTGKTTFIRYLLDQDFPGMRIGPEPTTDSFIAVMYGEREGVIPGNALVMDQKKQFRPMSRFGNSFLNRFQCAHLPNKVLESLTFVDTPGILSGEKQRVDRGYEFSGVIEWFAERVDRIILLFDAHKLDISDEFKRVIEVLKGNEDKIRIVLNKADTVDSQQLMRVYGALMWSLGKILYTPEVARVFIGSFWDHPLTFDQNRKLFELEEQDLFRDLGSLPGDAALRKLNDFIRRARLAKVHAYIIAHLKNEMPALMGREAKKRELITNLSQVYETLSRTHHISIGDFPNVTRMQETLALHDFRSFSNLQPKLIKAVDEMLANDMAKLMQMIPQEKIRVQEQQATAVVKASTVRGGAFD-SLDTPFSYHASEGINQGMFDPDWIVSRDRAEADAIFLTLNPVNGKISGESARKHMLKSHLPNSTLRKIWILGDVDRDGCLDEDEFALVCHLMKLQLNGDTLPSILPPHLIPPSKR 537          
BLAST of EH domain-containing protein 1 vs. TrEMBL
Match: A0A504Z6J5 (Receptor Mediated Endocytosis OS=Fasciola gigantica OX=46835 GN=FGIG_02145 PE=3 SV=1)

HSP 1 Score: 731.865 bits (1888), Expect = 0.000e+0
Identity = 358/532 (67.29%), Postives = 443/532 (83.27%), Query Frame = 2
Query:   20 MSIFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRA 1615
            +S  K  KSK +++Y +VI+GL  LY  KLLPLE  Y+FHDFHS  LE GDF++KPMV+L+GQYSTGKTTFIRY+L +DFPG+RIGPEPTTDSF+++M  D+ G+IPGNALV+D K+QFRPLS+FGNNFLNRFQC T+++ VL++ITF+DTPGILSGEKQR+DRGY+F  VIEWFAERVDRIILLFDAHKLDISDEFKRVIE+LKG E+KIRIVLNKAD +DSQQLMRVYGALMWSLGK+LYTPEV RVYIGSFWD+ L +DTNRKLFELE+ DL  DL++LP +AALRKLNDLI+RARLAKVHAYIIS LK++MP+L+G+ESKKKELI+NL + Y+ +S+ + IS+GDFP + +MQE L   DF  FS L+ +LI+ VD ML+ND+AKLMQMIP+EQ       E  V+GGAFD Q    F   AS+GIN+G F+ DW+VGR++ + DEIF +LNP NGKI+G  A+ +MIK++LP + L KIW L DVD DG LD +EFAL  +L++L+L+GE++PS LP HLVPPSKR+
Sbjct:    2 LSRMKHTKSKDQEAYDSVIDGLSRLYTQKLLPLENAYKFHDFHSLALEKGDFESKPMVLLIGQYSTGKTTFIRYLLGQDFPGIRIGPEPTTDSFIAVMHSDREGIIPGNALVMDHKKQFRPLSRFGNNFLNRFQCSTMSSEVLESITFVDTPGILSGEKQRIDRGYDFSGVIEWFAERVDRIILLFDAHKLDISDEFKRVIEVLKGNEEKIRIVLNKADMVDSQQLMRVYGALMWSLGKILYTPEVARVYIGSFWDRKLLFDTNRKLFELEQQDLFRDLETLPGDAALRKLNDLIRRARLAKVHAYIISHLKSEMPALMGRESKKKELITNLSKVYELLSRTHHISLGDFPNLTKMQECLAVHDFSKFSSLQPRLIKAVDEMLSNDIAKLMQMIPQEQKAVAKIPEPAVRGGAFDSQH-TPFSYQASEGINQGMFESDWIVGREKVKTDEIFFTLNPVNGKISGESARSHMIKSQLPSSTLRKIWILGDVDRDGCLDDEEFALVCHLIKLQLDGEDLPSVLPAHLVPPSKRS 532          
BLAST of EH domain-containing protein 1 vs. TrEMBL
Match: A0A4E0R247 (Receptor Mediated Endocytosis OS=Fasciola hepatica OX=6192 GN=D915_007309 PE=3 SV=1)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 357/532 (67.11%), Postives = 442/532 (83.08%), Query Frame = 2
Query:   20 MSIFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRA 1615
            +S  K  KSK +++Y +VI+GL  LY  KLLPLE  Y+FHDFHS  LE GDF++KPMV+L+GQYSTGKTTFIRY+L +DFPG+RIGPEPTTDSF+++M  D+ G+IPGNALV+D K+QFRPLS+FGNNFLNRFQC T+ + VL++ITF+DTPGILSGEKQR+DRGY+F  VIEWFAERVDRIILLFDAHKLDISDEFKRVIE+LKG E+KIRIVLNKAD +DSQQLMRVYGALMWSLGK+LYTPEV RVYIGSFWD+ L +DTNRKLFELE+ DL  DL++LP +AALRKLNDLI+RARLAKVHAYIIS LK++MP+L+G+ESKKKELI+NL + Y+ +S+ + IS+GDFP + +MQE L   DF  FS L+ +LI+ VD ML+ND+AKLMQMIP+EQ       E  V+GGAFD Q    F   AS+GIN+G F+ DW+VGR++ + DEIF +LNP NGKI+G  A+ +MIK++LP + L KIW L DVD DG LD +EFAL  +L++L+L+GE++PS LP HL+PPSKR+
Sbjct:    2 LSRMKHTKSKDQEAYDSVIDGLSRLYTQKLLPLENAYKFHDFHSLALEKGDFESKPMVLLIGQYSTGKTTFIRYLLGQDFPGIRIGPEPTTDSFIAVMHSDREGIIPGNALVMDHKKQFRPLSRFGNNFLNRFQCSTMASEVLESITFVDTPGILSGEKQRIDRGYDFSGVIEWFAERVDRIILLFDAHKLDISDEFKRVIEVLKGNEEKIRIVLNKADMVDSQQLMRVYGALMWSLGKILYTPEVARVYIGSFWDRKLLFDTNRKLFELEQQDLFRDLETLPGDAALRKLNDLIRRARLAKVHAYIISHLKSEMPALMGRESKKKELITNLSKVYELLSRTHHISLGDFPNLTKMQECLAVHDFSKFSSLQPRLIKAVDEMLSNDIAKLMQMIPQEQKAVAKIPEPAVRGGAFDSQH-TPFSYQASEGINQGMFESDWIVGREKVKTDEIFFTLNPVNGKISGESARSHMIKSQLPSSTLRKIWILGDVDRDGCLDDEEFALVCHLIKLQLDGEDLPSVLPAHLIPPSKRS 532          
BLAST of EH domain-containing protein 1 vs. TrEMBL
Match: A0A3S1BQL5 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_003089 PE=3 SV=1)

HSP 1 Score: 730.709 bits (1885), Expect = 0.000e+0
Identity = 354/534 (66.29%), Postives = 434/534 (81.27%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSD---STGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNG 1627
            + + K  + + NV+EGLK +Y SKLLPLE+ Y+FHDFHSPQL++ DFDAKPM++L+GQYSTGKTTFIRY+LE+DFPG+RIGPEPTTD F+++M  ++ G+IPGNALVVD K+QFRPL+KFGN FLNRFQC  + NPVL +IT +DTPGILSGEKQR+DRGY+F  V+EWFAERVDRIILLFDAHKLDISDEF+R IE +KG++DKIRIVLNKAD ID QQLMRVYGALMWSLGKVL TPEV RVYIGSFWDQPL +D NR+LFELEE DL  DLQ LP NAALRKLNDLIKRARLAKVHAYIIS LK +MPS+ GK+SKKK+LI+ L  T+ Q+ +E+ IS GDFP + RMQE LQ  DF  F  L+ KL+E VD MLA D+A+LMQMIP E+ +   S G  +  + GGAF+   ++ FG+G  +G + G+ + +WVV  K+YEYD+ F  LNP NGKI+G  AK  M+K+KLP  +L KIWKL+D+D DG LD DE+ALA++L+++KL+G E+P TLPDHL+PPSKR IV G
Sbjct:    9 NKRRKEPEVFNNVVEGLKKVYKSKLLPLEETYKFHDFHSPQLDEPDFDAKPMILLIGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDRFIAVMGSEQEGVIPGNALVVDPKKQFRPLTKFGNAFLNRFQCSHMRNPVLDSITIVDTPGILSGEKQRVDRGYDFAGVLEWFAERVDRIILLFDAHKLDISDEFRRAIEAIKGHDDKIRIVLNKADMIDHQQLMRVYGALMWSLGKVLNTPEVARVYIGSFWDQPLQFDQNRRLFELEEMDLFRDLQLLPRNAALRKLNDLIKRARLAKVHAYIISHLKKEMPSMFGKDSKKKDLINKLPETFAQLQREHQISPGDFPDVKRMQEQLQHQDFTKFHALRPKLLETVDQMLAQDIARLMQMIPTEEREMAASPGDADGNIHGGAFEGYTESPFGVGRGEGADAGRGEHEWVVEAKKYEYDDKFSKLNPINGKISGAAAKSEMVKSKLPNTVLSKIWKLADIDKDGMLDTDEWALANHLMQIKLDGHEVPVTLPDHLIPPSKRTIVEG 542          
BLAST of EH domain-containing protein 1 vs. TrEMBL
Match: G7YAU0 (EH domain-containing protein 3 OS=Clonorchis sinensis OX=79923 GN=CLF_104044 PE=3 SV=1)

HSP 1 Score: 729.554 bits (1882), Expect = 0.000e+0
Identity = 360/544 (66.18%), Postives = 445/544 (81.80%), Query Frame = 2
Query:   26 IFKSN-KSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQ-----FEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNGGDEN 1639
            +FK N K K +++YA+VIEGL  LY  KLLPLE  Y+FH+FHSP LE GDF++KPMV+L+GQYSTGKTTFIRY+L +DFPG+RIGPEPTTDSF+++M  ++ G+IPGNALV D K+QFRPL +FGNNFLNRFQC  L N VL++ITFIDTPGILSGEKQRLDRGY+F  VIEWFAERVDRIILLFDAHKLDISDEFKRVIE+LKG EDKIRIVLNKAD +D+QQLMRVYGALMWSLGK+LYTPEV RVYIGSFWD+ L +DTNRKLFELE+ DL  DL +LP +AALRKLND+I+RARLAKVHAYIIS LK++MP+L+GK++KKKELI+NL + Y+ +S+ + IS+GDFP + RMQE L   DF+TF  L+ KLI+ VD+ML+ND+AKLMQMIP+E++ +  Q         V+GGAFD   D  F   AS+GIN+G +D +W+V R+R E D IF +L+P NGKI+G  A+ +MIK++LP + L KIW L DVD DG+LD DEFAL  +L++L+L+G+E+P+TLP HL+PPSKR       EN
Sbjct:  230 VFKKNTKPKDQEAYASVIEGLSRLYTQKLLPLETTYKFHEFHSPALEKGDFESKPMVLLIGQYSTGKTTFIRYLLGQDFPGIRIGPEPTTDSFIAVMYNEREGVIPGNALVADHKKQFRPLDRFGNNFLNRFQCAHLPNEVLESITFIDTPGILSGEKQRLDRGYDFSGVIEWFAERVDRIILLFDAHKLDISDEFKRVIEVLKGNEDKIRIVLNKADMVDAQQLMRVYGALMWSLGKILYTPEVARVYIGSFWDRRLLFDTNRKLFELEQRDLFRDLSTLPGDAALRKLNDIIRRARLAKVHAYIISHLKSEMPALMGKDAKKKELINNLGKVYETLSRLHHISLGDFPNVQRMQECLALHDFRTFPSLQPKLIKAVDDMLSNDMAKLMQMIPQEKAAAQEQKANAPVHEPVRGGAFD-SNDTPFSYQASEGINQGMYDSEWIVSRERAEADSIFLTLDPVNGKISGASARSHMIKSQLPNSTLRKIWILGDVDRDGYLDEDEFALVCHLIKLQLQGDELPTTLPKHLIPPSKRQTAQEPIEN 772          
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Match: ehd1a (EH domain-containing protein 1-like [Source:NCBI gene;Acc:103036046])

HSP 1 Score: 693.345 bits (1788), Expect = 0.000e+0
Identity = 346/528 (65.53%), Postives = 422/528 (79.92%), Query Frame = 2
Query:   32 KSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRA 1615
            K+N  K  + + NV EGLK LY +KL PLE  YRFHDFHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M G++ G+IPGNALVVD K+ FR L+ FGN FLNRF C  L N VL +I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDK+R+VLNKAD+I +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYII+SLK +MPS+ GK+SKKKELISNL   Y++I KE++IS GDFP + +MQE+L   DF  F  LK KL+E+V++MLAND+AKLM ++ +E++    Q    VKGGAFD   +  FG G  +G  +G  + +WVVGR +  YDEIF +L+P NGK++G  AK+ M+K+KLP  +LGKIW L+DVD DG+LD +EFALA++L+++KLEG E+PS LP HLVPPSKR 
Sbjct:    6 KNNAKKDPELFQNVSEGLKRLYRNKLFPLEDTYRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMYGEQEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFMCAQLKNAVLDSISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKMRVVLNKADQISTQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWAQPLLIADNRKLFEAEEQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIITSLKKEMPSVFGKDSKKKELISNLGAIYEKIEKEHNISPGDFPNLKKMQELLNGQDFNKFPALKPKLLENVEDMLANDIAKLMTLVRQEEASMPNQI---VKGGAFDGAMNGPFGHGYGEGAGEGIDELEWVVGRDKPSYDEIFYTLSPVNGKVSGAAAKKEMLKSKLPNTVLGKIWTLADVDKDGYLDDEEFALANHLIKVKLEGYELPSKLPSHLVPPSKRG 530          
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Match: ehd1b (EH domain-containing protein 1-like [Source:NCBI gene;Acc:103046645])

HSP 1 Score: 677.167 bits (1746), Expect = 0.000e+0
Identity = 332/527 (63.00%), Postives = 421/527 (79.89%), Query Frame = 2
Query:   32 KSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            +  + K  + ++ V +G++ LY++KLLPLE  +RFHDFHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M  ++ G++PGNALVVD K+ FR L+ FGN FLNRF C  + N VL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK YEDK+R+VLNK+D+I +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE DL  D+Q+LP NAALRKLNDLIKRARLAKVHAYIIS+LK +MP++ GKESKKKELI+NL   Y  + KEY IS GDFPK+ +MQEIL   DF  F  +K KL+E V++ML ND+A+LM ++ +E++ +  Q    V+GGAF+  ++  FG G  +G   G  + +W+V R +  YDEIF  L+P NGK++G +AK+ MIK+KLP  ILGKIWKL+DVD DG+LDI+EFALA++L+++KLEG ++P+ LP HLVPPSKR
Sbjct:    7 RDGRRKEPELFSTVSDGMRRLYHAKLLPLEDAHRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHAEQEGLVPGNALVVDPKKPFRKLNAFGNAFLNRFICAQMPNAVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNYEDKMRVVLNKSDQIGTQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWAQPLLVADNRKLFEAEEQDLFRDIQNLPRNAALRKLNDLIKRARLAKVHAYIISALKKEMPNMFGKESKKKELIANLGEIYAMVEKEYQISPGDFPKLSKMQEILAIQDFSKFQTIKPKLMEAVEDMLTNDIARLMVLVRQEEAATPSQ---TVQGGAFEGTKNGPFGHGYGEGAGAGIDELEWIVARDKPSYDEIFFMLSPINGKVSGAMAKKEMIKSKLPNTILGKIWKLADVDGDGYLDIEEFALANHLIKVKLEGHDLPADLPHHLVPPSKR 530          
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Match: ehd1b (EH domain-containing protein 1-like [Source:NCBI gene;Acc:103046645])

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 331/526 (62.93%), Postives = 420/526 (79.85%), Query Frame = 2
Query:   32 KSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSK 1609
            +  + K  + ++ V +G++ LY++KLLPLE  +RFHDFHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M  ++ G++PGNALVVD K+ FR L+ FGN FLNRF C  + N VL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK YEDK+R+VLNK+D+I +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE DL  D+Q+LP NAALRKLNDLIKRARLAKVHAYIIS+LK +MP++ GKESKKKELI+NL   Y  + KEY IS GDFPK+ +MQEIL   DF  F  +K KL+E V++ML ND+A+LM ++ +E++ +  Q    V+GGAF+  ++  FG G  +G   G  + +W+V R +  YDEIF  L+P NGK++G +AK+ MIK+KLP  ILGKIWKL+DVD DG+LDI+EFALA++L+++KLEG ++P+ LP HLVPPSK
Sbjct:    7 RDGRRKEPELFSTVSDGMRRLYHAKLLPLEDAHRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHAEQEGLVPGNALVVDPKKPFRKLNAFGNAFLNRFICAQMPNAVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNYEDKMRVVLNKSDQIGTQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWAQPLLVADNRKLFEAEEQDLFRDIQNLPRNAALRKLNDLIKRARLAKVHAYIISALKKEMPNMFGKESKKKELIANLGEIYAMVEKEYQISPGDFPKLSKMQEILAIQDFSKFQTIKPKLMEAVEDMLTNDIARLMVLVRQEEAATPSQ---TVQGGAFEGTKNGPFGHGYGEGAGAGIDELEWIVARDKPSYDEIFFMLSPINGKVSGAMAKKEMIKSKLPNTILGKIWKLADVDGDGYLDIEEFALANHLIKVKLEGHDLPADLPHHLVPPSK 529          
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Match: ehd3 (EH-domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-041014-352])

HSP 1 Score: 675.241 bits (1741), Expect = 0.000e+0
Identity = 338/537 (62.94%), Postives = 417/537 (77.65%), Query Frame = 2
Query:   62 YANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDR------------------GYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAI 1618
            +  V +GLK LY +KLLPLE+ Y+FH+FHSP LED DFD KPM++L+GQYSTGKT+FIRY+LE+DFPGMRIGPEPTTDSF+++M GD  G+IPGNALVVD K+ FR L+ FGN FLNRF C  L NPVL++I+ IDTPGILSGEKQR+ R                  GY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHA+IISSLK +MP++ GKE+KKKELI++L   Y +I +E+ IS GDFP + +MQE LQ  DF  F P+KMKL+++ D+ML ND+A+LM ++ +E++    Q    VKGGAF+   +  FG G  +G  +G  + +WVV R +  YDEIF +L+P NGK+NG  AK+ M+K+KLP  +LGKIWKLSD+D DG LD +EFALA++L+++KLEG E+PS LP HLVPPSKR I
Sbjct:   18 FQTVTDGLKTLYKAKLLPLEEHYKFHEFHSPALEDADFDNKPMILLVGQYSTGKTSFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDLEGLIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRETAEDVCGYSCLHKCPYGGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLISDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAHIISSLKKEMPTVFGKENKKKELINSLGEIYSRIEREHQISPGDFPNLKKMQEQLQAHDFMKFQPMKMKLMDNADDMLTNDIAQLMVLVRQEETQRPNQV---VKGGAFEGTMNGPFGHGYGEGAGEGIDEVEWVVARDKPMYDEIFYTLSPVNGKVNGANAKKEMLKSKLPNTVLGKIWKLSDIDKDGMLDDEEFALANHLIKVKLEGHELPSELPAHLVPPSKRKI 551          
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Match: ehd4 (EH domain-containing protein 4 [Source:NCBI gene;Acc:103028495])

HSP 1 Score: 649.432 bits (1674), Expect = 0.000e+0
Identity = 322/527 (61.10%), Postives = 400/527 (75.90%), Query Frame = 2
Query:   32 KSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            +  ++K    +  V EGL++LY  KLLPLE+ Y FHDFHSP LE+ DF +KPMV+L+GQYSTGKTTFIRY+LE+DFPGMRIGPEPTTD F+++M G+  G++PGNALVVD K+ FR L+ FGN FLNRF C  + N VL++I+ IDTPGILSGEKQR+ RGY+F +V+ WF ERVDRIILLFDAHKLDISDEF   I+  +G +DKIR+VLNKAD++D+QQLMRVYGALMWSLGKV+ TPEV RVY+GSFW +PL    +R+LFE E  DL  D+Q+LP NAALRKLNDLIKRARLAKVHAYIIS LK +MPSL GKE KK+ELI+ L   Y  + +EY IS GDFP + +MQE L   DF  F  LK+KLIE VD ML+N ++ LM MI +E+     Q    V GGAF+  +D  FG G  +GI+ G   +DW+V R +  YDEIF +L P NGK+ G  AK+ M+ ++LP  +LGKIWKL+D D DG LD +EFALA +L+++KLEG E+PS LP HLVPP+ R
Sbjct:    9 QGGRNKEGDMFQTVTEGLQSLYAKKLLPLEEAYLFHDFHSPALEEADFQSKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDGFIAVMYGENEGVVPGNALVVDPKKPFRKLNAFGNAFLNRFICSQMPNQVLQSISIIDTPGILSGEKQRISRGYDFSEVLRWFGERVDRIILLFDAHKLDISDEFSEAIKAFRGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVARVYLGSFWAKPLQNTDSRRLFEAEAQDLFRDIQALPRNAALRKLNDLIKRARLAKVHAYIISFLKKEMPSLFGKEKKKEELIARLPEIYQMLQREYHISPGDFPNVTKMQEQLMHYDFSKFPSLKIKLIEAVDKMLSNKISGLMTMIREEEGKQPTQV---VTGGAFEGSEDGPFGHGYGEGISAGADTEDWIVSRDKPRYDEIFYTLMPINGKVTGVNAKKEMMNSRLPNTVLGKIWKLADCDKDGMLDDEEFALAQHLIKVKLEGFELPSELPAHLVPPAHR 532          
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ehd1a (EH-domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-040426-2518])

HSP 1 Score: 479.174 bits (1232), Expect = 6.959e-165
Identity = 245/403 (60.79%), Postives = 312/403 (77.42%), Query Frame = 2
Query:  413 RFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIV 1621
            RF C  L NPVL++I+ IDTPGILSGEKQR+ RGY+F  V+ WFAERVDRIILLFDAHKLDISDEF  VI  LKG++DKIR+VLNKAD++++QQLMRVYGALMWSLGKV+ TPEV RVY+GSFW  PL    NR+LFE+EE DL  D+Q+LP NAALRKLNDLIKR RLAKVHAYIIS L+ +MP++ GK++KKKELI+NL   + +I +E+ IS GDFP + +MQE LQD DF  F  LK KL E VD ML++D+A+LM ++ +E++    Q    V+GGAF+  ++  FG G  +G  +G  + DWVV + +  YDEIF +L+P +GKI+G  AK  M+K+KLP  +LG+IWKL+DVD DG LD DEFALA++L+++KLEG E+P  LP HL+PPSKR + 
Sbjct:    1 RFMCAQLPNPVLESISIIDTPGILSGEKQRISRGYDFTAVLTWFAERVDRIILLFDAHKLDISDEFSEVIRALKGHDDKIRVVLNKADQVETQQLMRVYGALMWSLGKVINTPEVVRVYMGSFWSNPLLIPDNRRLFEMEEQDLFKDIQTLPRNAALRKLNDLIKRTRLAKVHAYIISHLRKEMPAVFGKDAKKKELIANLGEIFTRIEREHQISAGDFPNLKKMQEQLQDQDFTKFHTLKPKLFEKVDEMLSHDIARLMGLVRQEEARVPSQ---AVRGGAFEGTENGPFGRGYGEGAGEGADEADWVVSKDKPAYDEIFYTLSPIDGKISGASAKREMVKSKLPNTVLGRIWKLADVDKDGMLDDDEFALANHLIKVKLEGHELPEELPMHLLPPSKRKLA 400          
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007308.1 (pep scaffold:Pmarinus_7.0:GL476503:58924:70125:-1 gene:ENSPMAG00000006577.1 transcript:ENSPMAT00000007308.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 309.686 bits (792), Expect = 5.551e-97
Identity = 185/543 (34.07%), Postives = 296/543 (54.51%), Query Frame = 2
Query:   80 GLKNLYNSKLLPLEKMYRFH-DFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYIL----------EEDFPGMRIGPEPTTDSFVSLMDGDKSGMI-PGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDE--FKRVIELLKGY--EDKIRIVLNKADRI-DSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXI-SNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQ-----------MIPKEQS---DSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
             L  LY   +LP+E+ Y FH  + + +L D +FD+ P V+LLG  + GKT+ +RY+L           +      + P   T S   +  G+  G + PG+ALV++    F  L+ FG+  ++R   V L  P+L+++TF+DTPGI + E      G  +G ++ W  ER DR+ L+ DA +  +S+       +  L+ +    K+R++L +AD + +   L+R +GAL WSLG++L      RVY  +F D PL +D NR L E+ E D M+DL+SLP  A LR+LND+I RARLA+ HA I+S+L +Q+P    + +  + +    L    +   + + + +GD P+++ MQE L  CD     P++ +L+  VD +L  D   L+            ++P  Q+    S G F   +    F        G    DG +       W +  ++  Y+E+F+SL+P  G+++G  A+  +++++LP   L ++W+LSDVD DG LD DEF +A++L+   L G E+P  LP HLVPPSKR
Sbjct:   24 ALARLYRQHVLPIERRYGFHVAYRAAELRDAEFDSPPTVLLLGAPAAGKTSLLRYLLGGPSSQQQQFLQQLQQGVLQPGSATTSVTIVQHGEAPGSVTPGHALVLEANSAFAGLAAFGSAAMSRVVRVQLPCPILESVTFVDTPGIPNDEIATGQHGTYYGGLLAWLCERADRVALVCDAPRPSVSERGALATALRSLRRHLHPHKLRVLLLRADELGEPGSLLRAHGALCWSLGRLLGRVSPPRVYAAAFRDGPLRWDWNRDLLEVNERDFMNDLRSLPRLAPLRRLNDVIARARLARAHACIVSALHSQLPLFGRRAALTELVAQGGLAPVLEVAQQRWGLPVGDRPEMEPMQEWLMHCDMSFIRPMERRLLAAVDTLLQRDAPALLSRFRRRPRPSLLLLPGGQALPASSLGPFAEDL---GFVSATSPTCGDDDGDGDDDASSPAPWALSEEKALYEELFRSLSPVRGRVSGASARLVLLRSRLPACALRRVWRLSDVDADGMLDSDEFTVANHLVAAALRGHELPRELPPHLVPPSKR 563          
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: srl (sarcalumenin [Source:ZFIN;Acc:ZDB-GENE-061110-91])

HSP 1 Score: 224.557 bits (571), Expect = 2.284e-66
Identity = 119/308 (38.64%), Postives = 178/308 (57.79%), Query Frame = 2
Query:   62 YANVIEGLKNLYNSKLLPLEKMYRF-----HDFHSPQ------LEDGDFDAKPMVMLLGQYSTGKTTFIRYILEED---FPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYII 943
            +A +++ LK +Y++ + PLE++Y++     HD  +         ++ +  AKP+V+ LG +S GK++ I Y+L  D   F     G EPTT  F  +  G K   + G  +  D  R F  L KFG +FL +F  V + + +L+ +TF+DTPGI+   KQ+  RGY F  V +WF +R D I ++FD  KLD+  E + +   LKG E +IRI+LNKAD + +QQLMRVYGAL WSL  ++   E  RVY+ SFW      DTNR LF  EE  L+ DL+ + AN    K+  + + A   ++HA ++
Sbjct:    1 FAGLLDRLKKIYHTSIKPLERIYKYDSIRQHDMTASHGRSISTFDESEIIAKPLVLFLGPWSVGKSSMINYLLGLDDKAFSLYTGGAEPTTSEFTVIRHGTKVKHLEGIVMATDGSRTFASLEKFGQSFLEKFSGVEMPHRLLERVTFVDTPGIIENRKQQ-QRGYPFNDVCQWFIDRGDLIFVVFDPTKLDVGLELETLFRQLKGRESQIRIILNKADSVSTQQLMRVYGALFWSLAPLINVTEPPRVYVSSFWPYAFRVDTNRGLFLAEETSLLDDLRQIIANRMENKIALIRQHAIRVRIHALVV 307          
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004856.1 (pep scaffold:Pmarinus_7.0:GL476392:158221:184050:-1 gene:ENSPMAG00000004375.1 transcript:ENSPMAT00000004856.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.9745 bits (232), Expect = 3.695e-21
Identity = 49/137 (35.77%), Postives = 76/137 (55.47%), Query Frame = 2
Query: 1325 DDDWVV-GRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNGGDEN*KYNTVVYFYCLIQISIAITKILLSFILRFQ 1732
            D  W V   ++ ++D I+ SL P NG ++G   K  ++ +KLP   LG++W LSD+D DGFLD DEF++A YL+   LE E +P  LP  L+PP+KR          K   V   + L ++ ++   +  +F   F+
Sbjct:  118 DIPWAVKPEEKAKFDSIYDSLKPQNGLLSGEKVKPVLLNSKLPVETLGRVWDLSDIDRDGFLDRDEFSVAMYLVYRALEKEPVPLALPIKLIPPAKR----------KPGLVSSAFALPKVQVSACSLAFAFTALFE 244          

HSP 2 Score: 50.447 bits (119), Expect = 7.171e-7
Identity = 27/74 (36.49%), Postives = 43/74 (58.11%), Query Frame = 2
Query: 1337 VVGRKRYEYDEIFKSLNP-ANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKL 1555
            V   +R +YDE+F  L+   +G++ G   KE  +KT L   +L +IW LSD    G L  D+F +A +L++ K+
Sbjct:  265 VSAAERLKYDEMFTKLDKDGDGQVTGLEVKEVFMKTGLSPAVLAQIWALSDTRQCGKLTRDQFGMAMHLVQEKI 338          
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Match: EPS15L1 (epidermal growth factor receptor pathway substrate 15 like 1 [Source:HGNC Symbol;Acc:HGNC:24634])

HSP 1 Score: 96.2857 bits (238), Expect = 8.946e-21
Identity = 46/94 (48.94%), Postives = 64/94 (68.09%), Query Frame = 2
Query: 1334 WVVGR-KRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            WVV   ++ ++D IF SL PANG ++G   K  +I + LP  +LGK+W LSD+D DG LD DEFA+A +L+   L+ E +PS +P  LVPP+KR
Sbjct:  122 WVVKPDEKTKFDGIFDSLGPANGLLSGEKVKPVLINSNLPMEVLGKVWDLSDIDKDGHLDRDEFAVAMHLVYRALDKEPVPSVIPPKLVPPAKR 215          

HSP 2 Score: 55.4546 bits (132), Expect = 4.367e-8
Identity = 36/98 (36.73%), Postives = 58/98 (59.18%), Query Frame = 2
Query: 1334 WVVGRK-RYEYDEIF-KSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKL-EGEEIPSTLPDHLVPPSKRAI 1618
            WVV    + +YDEIF K+    +G ++G   K+  +++ LP  +L +IW L+D    G L  D+FAL  YL+  K+ +G + P TL   ++PPS+R +
Sbjct:  284 WVVTPADKIKYDEIFLKTDLDMDGLVSGLEVKDIFMQSGLPQAVLAQIWALADTRQQGKLTQDQFALM-YLITQKVSKGVDPPVTLNADMMPPSERGV 380          

HSP 3 Score: 51.9878 bits (123), Expect = 4.986e-7
Identity = 27/82 (32.93%), Postives = 46/82 (56.10%), Query Frame = 2
Query: 1361 YDEIFKSLNPAN-GKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPP 1603
            Y++ ++ ++P N G++  + A  ++ K+ L    LGKIW L+D D  G+LD   F +A  L+     G EI  +   H++PP
Sbjct:   19 YEKYYRLVDPGNNGRVGASEAALFLKKSGLSDLTLGKIWDLADADRKGWLDKQGFYVALRLVACAQNGHEIALSALSHVIPP 100          
BLAST of EH domain-containing protein 1 vs. Ensembl Yeast
Match: PAN1 (Part of actin cytoskeleton-regulatory complex Pan1p-Sla1p-End3p; associates with actin patches on cell cortex; promotes protein-protein interactions essential for endocytosis; binds to and activates Arp2/3 complex in vitro; phosphorylation of Thr-1225 is regulated by MAPK Hog1p in response to osmotic stress; previously thought to be a subunit of poly(A) ribonuclease [Source:SGD;Acc:S000001445])

HSP 1 Score: 51.6026 bits (122), Expect = 3.663e-7
Identity = 36/122 (29.51%), Postives = 62/122 (50.82%), Query Frame = 2
Query: 1286 GIGASDGINKGKFDD--------DWVVGRKRYEYDEIFKSLNPAN-GKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVN 1624
            G G ++   K  F++        D +   ++  + +IF++ +  N G ++   A E   K+ L    L +IW L D++  G L+  EFAL  +L+  KL G+ IP+ LP  L+P S + + N
Sbjct:  571 GFGNNEIYTKSNFNNNLIDNSSQDKISTEEKSLFYKIFETFDTQNKGLLDSPTAVEIFRKSGLNRADLEQIWNLCDINNTGQLNKQEFALGMHLVYGKLNGKPIPNVLPSSLIPSSTKLLDN 692          

HSP 2 Score: 47.7506 bits (112), Expect = 5.661e-6
Identity = 24/82 (29.27%), Postives = 49/82 (59.76%), Query Frame = 2
Query: 1334 WVVGRKRYEYDEIFKSL--NPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIP 1573
            ++  + + +++ +F+S+  N +N  ++G   ++ ++++ LP + L +IW L D    G L   EFALA +L+   L+G+ IP
Sbjct:  265 FITAQDQAKFETLFRSIVTNGSN-TVSGANCRKILMRSGLPPSQLARIWTLCDTSKAGELLFPEFALAMHLINDVLQGDTIP 345          
BLAST of EH domain-containing protein 1 vs. Ensembl Yeast
Match: EDE1 (Scaffold protein involved in the formation of early endocytic sites; putative regulator of cytokinesis; homo-oligomerization is required for localization to and organization of endocytic sites; has a network of interactions with other endocytic proteins; binds membranes in a ubiquitin-dependent manner; may also bind ubiquitinated membrane-associated proteins; interacts with Cmk2 and functions upstream of CMK2 in regulating non-apoptotic cell death; homolog of mammalian Eps15 [Source:SGD;Acc:S000000143])

HSP 1 Score: 51.2174 bits (121), Expect = 5.834e-7
Identity = 29/102 (28.43%), Postives = 55/102 (53.92%), Query Frame = 2
Query: 1307 INKGKFDD---DWVVG-RKRYEYDEIFKSLNPAN-GKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLV 1597
            ++ G F +   DW +   K+ ++D IF SL+  + G ++  V   + + ++L    L  IW L+D+  +      EFA+A +L++ K  G E+P  +P+ L+
Sbjct:  259 LSTGAFSNAASDWSLSFEKKQQFDAIFDSLDKQHAGSLSSAVLVPFFLSSRLNQETLATIWDLADIHNNAEFTKLEFAIAMFLIQKKNAGVELPDVIPNELL 360          

HSP 2 Score: 50.8322 bits (120), Expect = 7.095e-7
Identity = 32/118 (27.12%), Postives = 50/118 (42.37%), Query Frame = 2
Query: 1253 GAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEI----PSTLPDHL 1594
             +F + Q+       S   N    D   +      ++ ++F         + G  AK+  +K +LP   LG+IW L D D  G LD  EF +A YL++L +         P+ LP  L
Sbjct:  103 ASFSINQNPAPMQSGSATGNTNNTDIPALSSNDIAKFSQLFDRTAKGAQTVAGDKAKDIFLKARLPNQTLGEIWALCDRDASGVLDKSEFIMAMYLIQLCMSHHPSMNTPPAVLPTQL 220          
BLAST of EH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO49577 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGP8])

HSP 1 Score: 647.121 bits (1668), Expect = 0.000e+0
Identity = 326/535 (60.93%), Postives = 407/535 (76.07%), Query Frame = 2
Query:   35 SNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQ--DNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNGGD 1633
            SNK +  + +A+V++GLK +Y   L P+E+ Y F+DFHSP + + DF AKPMV+L+GQYSTGKTTFI+Y+LE+DFPG+RIGPEPTTDSF+++M GD   +IPGNAL+VD  +QFR LS FGN FLNRF C  L N VL +IT +DTPGILSGEKQ + RGY+F  +++WFAER DRIILLFDAHKLDISDEF+R IE+L+ Y+DKIRIVLNKAD I++QQLMRVYGALMWSLGKV+ TPEV RVYIGSFW+QPL  D NR+LFE+E  DL  D+Q LP NAALRKLND IKRARLAKVHAYIIS LK+QMPS+ GK+ KK ELI  L   Y +I +E++IS GDFP + + +E L+  DF  F  L+ K IE +D+MLA+D+ +LM MIP E +D   +    V GGAF V    +N F  GA +G+  G   D WVV   + +YDE+FK+L P +GK++G  AK+ M+K+KLP   LG+IWKLSD+D DG LD DEFALA YL+++KLE  +IP  LP HLVPPSKR + N  D
Sbjct:   10 SNK-RHPQVFASVVDGLKKMYMKNLKPMEEYYLFNDFHSPSMSEPDFHAKPMVLLVGQYSTGKTTFIKYLLEQDFPGIRIGPEPTTDSFIAVMHGDSQQVIPGNALIVDPNKQFRSLSSFGNAFLNRFCCSELPNDVLNSITIVDTPGILSGEKQSVARGYDFTGILKWFAERCDRIILLFDAHKLDISDEFQRGIEVLRDYDDKIRIVLNKADMINTQQLMRVYGALMWSLGKVINTPEVARVYIGSFWNQPLQMDDNRRLFEMEATDLFRDIQELPRNAALRKLNDFIKRARLAKVHAYIISELKSQMPSMFGKDKKKDELIKKLTDVYQKIQREHNISPGDFPPVSKFKEQLKQHDFTKFHTLRAKHIETLDHMLAHDIPRLMAMIPHETTDDASK--PSVSGGAFAVHHATNNPFASGACEGVALGAGTDTWVVEDFKPKYDELFKTLGPVDGKLSGAKAKKEMVKSKLPNTQLGRIWKLSDIDHDGCLDEDEFALAMYLIKVKLEDNDIPEELPVHLVPPSKRQLQNSAD 541          
BLAST of EH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO43900 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RX50])

HSP 1 Score: 88.5817 bits (218), Expect = 4.132e-18
Identity = 40/90 (44.44%), Postives = 59/90 (65.56%), Query Frame = 2
Query: 1334 WVVGRK-RYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVP 1600
            W++  + R  +D +F S NP NG ++G  A+   I+++LP   L KIWKL+DV  D FLD+ EFA A +L++L+L+G +IP  LP  L P
Sbjct:    7 WIINEEERTRHDALFYSQNPENGFLSGEQARSLFIRSRLPLAELSKIWKLADVTRDNFLDVSEFATAMHLIQLRLKGFDIPEKLPSTLAP 96          
BLAST of EH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO47146 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMS3])

HSP 1 Score: 70.8626 bits (172), Expect = 1.102e-12
Identity = 31/66 (46.97%), Postives = 45/66 (68.18%), Query Frame = 2
Query: 1397 GKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHL 1594
            G   G  AK++ +K+ LP  +LGKIW LSD+D DG + + EF +A +L++ KL+G E PS LP+ L
Sbjct:    5 GSPQGEQAKQFFLKSNLPAMVLGKIWSLSDIDRDGKMTMQEFTIAMHLIQNKLKGTEPPSVLPNTL 70          

HSP 2 Score: 60.077 bits (144), Expect = 2.947e-9
Identity = 31/86 (36.05%), Postives = 51/86 (59.30%), Query Frame = 2
Query: 1352 RYEYDEIFKSLN-PANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPS 1606
            R +Y ++FK+ +    G ++G   +  +I++ LP   L  IWKLSDVD DG L+ DEF LA + +++   G  +P  +P  L+ P+
Sbjct:  256 RLKYTQMFKAQDFKQTGFLSGEQVRSMLIQSGLPQPSLALIWKLSDVDKDGQLNQDEFILAMHFVDMAKLGHTLPLVVPPELLTPA 341          
BLAST of EH domain-containing protein 1 vs. Ensembl Nematostella
Match: EDO36122 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJH7])

HSP 1 Score: 57.7658 bits (138), Expect = 9.567e-9
Identity = 52/209 (24.88%), Postives = 94/209 (44.98%), Query Frame = 2
Query:  191 VMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGN--NFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELL-KGYEDKIRIVLNKADRI----DSQQ-LMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQP 793
            ++++G +S GK++FI + +EE     R G    T  F  +  G K   + GNA  +     F+PL +      +L   +  T        +TFIDTPG++ G+   +   ++  + I W     D I + FD     +      ++E L +   +++R  L+KAD      D Q+ LM++   L    G      ++  +Y+ +  D+P
Sbjct:   59 LLMIGNHSAGKSSFINWYIEEHI--QRTGVAIETQGFTFVTSGKKRESLTGNA-TLHLYSHFKPLQEIEGVVEYLTT-EISTSKQKKFPLVTFIDTPGLVDGD---MKYPFDVDEAIIWLGGLADLIFVFFDPIGQALCKRTLNLVEHLNEDQSERLRFYLSKADTAGHESDRQKVLMQITQELCKRPGLNKAGFDMPTIYVPTMLDKP 260          
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Match: ehd1a (EH domain-containing protein 1 [Source:NCBI gene;Acc:101158863])

HSP 1 Score: 697.197 bits (1798), Expect = 0.000e+0
Identity = 342/533 (64.17%), Postives = 427/533 (80.11%), Query Frame = 2
Query:   26 IFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVN 1624
            +F+    K  + + NV EGL+ LY +KL PLE  YRFHDFHSP LED DFD KPMV+L+GQYSTGKTTFIR+++E+DFPGMRIGPEPTTDSF+++M GD+ G+IPGNALVVD K+ FR L+ FGN FLNRF C  + N VL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI  LK +EDK+R+VLNKAD+I +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYII++LK +MP++ GKESKKKELI+NL   Y ++ KE++IS GDFPK+++MQE+L   DF  F+ LK KL+E V++MLAND+A+LM ++ +E+++   Q    VKGGAF+      FG G  +G ++G  + +WVVGR +  YDEIF +L+P NGK+ G  AK+ M+K+KLP ++LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P++LPDHLVPPSKR  V 
Sbjct:    1 MFRKTLKKDPELFQNVSEGLRRLYRTKLFPLEDTYRFHDFHSPALEDADFDNKPMVLLVGQYSTGKTTFIRHLMEQDFPGMRIGPEPTTDSFIAVMHGDQEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFMCAQMPNAVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIRALKNHEDKMRVVLNKADQISTQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWAQPLLVPDNRKLFEAEEQDLFVDIQSLPRNAALRKLNDLIKRARLAKVHAYIITALKKEMPAVFGKESKKKELITNLGEIYHRVEKEHNISPGDFPKLEKMQELLNGHDFTKFANLKPKLLEAVEDMLANDIARLMALVRQEEANMPSQ---SVKGGAFEGTMSGPFGHGYGEGASEGIDELEWVVGRDKPTYDEIFYTLSPINGKVTGAAAKKEMVKSKLPNSVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPASLPDHLVPPSKRGTVQ 530          
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Match: ehd4 (EH domain-containing protein 4 [Source:NCBI gene;Acc:101167502])

HSP 1 Score: 672.544 bits (1734), Expect = 0.000e+0
Identity = 331/517 (64.02%), Postives = 400/517 (77.37%), Query Frame = 2
Query:   62 YANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            Y  V EGL+ LY+ KLLPLE+ Y FHDFHSP LE  DF +KPMV+L+GQYSTGKTTFIRY+LE+DFPGMRIGPEPTTD F+++M G+  G++PGNALVVD+K+ FR L+ FGN FLNRF C  + N VL++I+ IDTPGILSGEKQR+ RGY+F +V+ WF ERVDRIILLFDAHKLDISDEF   I  LKG +DKIR+VLNKAD++D+QQLMRVYGALMWSLGKV+ TPEV RVY+GSFW +PL    NR+LFE E  DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIIS LK +MP+L G+E KK+ELI  L   Y  + +E+ IS GDFP +++MQ++LQ  DF  F  LKMKLIE VD MLA  +A LM MI +E+S     F   V GGAF+  QD  FG G  +GI+ G   +DW+V R ++ YDEIF +L P NGKI G  AK+ M+ ++LP  +LGKIWKL+D D DG LD DEFALA +L+++KLEG E+PS LPDHLVPPS R
Sbjct:   19 YQTVTEGLQTLYSKKLLPLEETYLFHDFHSPALEPADFQSKPMVLLVGQYSTGKTTFIRYLLEQDFPGMRIGPEPTTDGFIAVMYGENEGVVPGNALVVDSKKPFRKLNAFGNAFLNRFICSQMPNQVLQSISIIDTPGILSGEKQRISRGYDFAEVLRWFGERVDRIILLFDAHKLDISDEFSEAIRALKGQDDKIRVVLNKADQVDTQQLMRVYGALMWSLGKVINTPEVVRVYLGSFWAKPLQNTENRRLFEAESQDLFRDIQSLPRNAALRKLNDLIKRARLAKVHAYIISYLKKEMPTLFGREKKKEELIMRLPEIYTILQREHHISAGDFPNVNKMQDMLQHYDFHKFPSLKMKLIESVDKMLATKIAVLMAMIREEESKQPAPF---VSGGAFEGSQDGPFGQGYGEGISAGADAEDWIVSRDKHRYDEIFYTLMPVNGKITGVNAKKEMMNSRLPNTVLGKIWKLADCDQDGMLDDDEFALAQHLIKIKLEGYELPSELPDHLVPPSHR 532          
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Match: ehd3 (EH domain-containing protein 3 [Source:NCBI gene;Acc:101160952])

HSP 1 Score: 661.759 bits (1706), Expect = 0.000e+0
Identity = 340/521 (65.26%), Postives = 414/521 (79.46%), Query Frame = 2
Query:   62 YANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVN 1624
            +  V EGLK LY +KLLPLE+ Y+FH+FHSP LED DFD KPMV+L+GQYSTGKT+FIRY+LE+DFPGMRIGPEPTTDSF+++M GD  G+IPGNALVVD K+ FR L+ FGN FLNRF C  L NPVL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIIS+LK +MPS+ GKE+KKKELI++L   Y +I +E+ IS GDFP + +MQ++LQD D   F  LK KL+E VD+MLA+D+A LM ++ +E+S         VKGGAFD   +  FG G  +G  +G  + +WVV R +  YDEIF +L+P NGK+ G  AK  M+K+KLP  +LGKIWKL+D+D DG LD +EFALA++L+++KLEG E+PS LP HLVPPSKR I +
Sbjct:   18 FQTVSEGLKKLYKTKLLPLEESYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTSFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDTEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISALKKEMPSVFGKENKKKELIASLGDIYKRIEREHQISPGDFPNLKKMQDLLQDQDLTRFQALKPKLLEAVDDMLASDIASLMVLVRQEESQRPNS---AVKGGAFDGTLNGPFGHGYGEGAGEGIDEAEWVVARDKPAYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPSELPAHLVPPSKRKIAD 535          
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Match: ehd3 (EH domain-containing protein 3 [Source:NCBI gene;Acc:101160952])

HSP 1 Score: 651.358 bits (1679), Expect = 0.000e+0
Identity = 340/537 (63.31%), Postives = 414/537 (77.09%), Query Frame = 2
Query:   62 YANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDR----------------GYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVN 1624
            +  V EGLK LY +KLLPLE+ Y+FH+FHSP LED DFD KPMV+L+GQYSTGKT+FIRY+LE+DFPGMRIGPEPTTDSF+++M GD  G+IPGNALVVD K+ FR L+ FGN FLNRF C  L NPVL++I+ IDTPGILSGEKQR+ R                GY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI+ LK +EDKIR+VLNKAD+I++QQLMRVYGALMWSLGK++ TPEV RVYIGSFW  PL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYIIS+LK +MPS+ GKE+KKKELI++L   Y +I +E+ IS GDFP + +MQ++LQD D   F  LK KL+E VD+MLA+D+A LM ++ +E+S         VKGGAFD   +  FG G  +G  +G  + +WVV R +  YDEIF +L+P NGK+ G  AK  M+K+KLP  +LGKIWKL+D+D DG LD +EFALA++L+++KLEG E+PS LP HLVPPSKR I +
Sbjct:   18 FQTVSEGLKKLYKTKLLPLEESYKFHEFHSPALEDADFDNKPMVLLVGQYSTGKTSFIRYLLEQDFPGMRIGPEPTTDSFIAVMHGDTEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFVCAQLPNPVLESISVIDTPGILSGEKQRISRDKEMSGYSCLHRCPYGGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIKALKNHEDKIRVVLNKADQIETQQLMRVYGALMWSLGKIVNTPEVIRVYIGSFWSHPLLIPDNRKLFEAEEQDLFKDIQSLPRNAALRKLNDLIKRARLAKVHAYIISALKKEMPSVFGKENKKKELIASLGDIYKRIEREHQISPGDFPNLKKMQDLLQDQDLTRFQALKPKLLEAVDDMLASDIASLMVLVRQEESQRPNS---AVKGGAFDGTLNGPFGHGYGEGAGEGIDEAEWVVARDKPAYDEIFYTLSPVNGKVTGANAKREMVKSKLPNTVLGKIWKLADIDKDGMLDDEEFALANHLIKVKLEGHELPSELPAHLVPPSKRKIAD 551          
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Match: ehd1a (EH domain-containing protein 1 [Source:NCBI gene;Acc:101158863])

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 327/532 (61.47%), Postives = 406/532 (76.32%), Query Frame = 2
Query:   26 IFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIV 1621
            +F+    K  + + NV EGL+ LY +KL PLE  YRFHDFHSP LED DFD KPM                     DFPGMRIGPEPTTDSF+++M GD+ G+IPGNALVVD K+ FR L+ FGN FLNRF C  + N VL++I+ IDTPGILSGEKQR+ RGY+F  V+EWFAERVDRIILLFDAHKLDISDEF  VI  LK +EDK+R+VLNKAD+I +QQLMRVYGALMWSLGK++ TPEV RVYIGSFW QPL    NRKLFE EE DL  D+QSLP NAALRKLNDLIKRARLAKVHAYII++LK +MP++ GKESKKKELI+NL   Y ++ KE++IS GDFPK+++MQE+L   DF  F+ LK KL+E V++MLAND+A+LM ++ +E+++   Q    VKGGAF+      FG G  +G ++G  + +WVVGR +  YDEIF +L+P NGK+ G  AK+ M+K+KLP ++LGKIWKL+DVD DG LD +EFALA++L+++KLEG E+P++LPDHLVPPSKR  V
Sbjct:    1 MFRKTLKKDPELFQNVSEGLRRLYRTKLFPLEDTYRFHDFHSPALEDADFDNKPM---------------------DFPGMRIGPEPTTDSFIAVMHGDQEGVIPGNALVVDPKKPFRKLNAFGNAFLNRFMCAQMPNAVLESISIIDTPGILSGEKQRISRGYDFAAVLEWFAERVDRIILLFDAHKLDISDEFSEVIRALKNHEDKMRVVLNKADQISTQQLMRVYGALMWSLGKIINTPEVVRVYIGSFWAQPLLVPDNRKLFEAEEQDLFVDIQSLPRNAALRKLNDLIKRARLAKVHAYIITALKKEMPAVFGKESKKKELITNLGEIYHRVEKEHNISPGDFPKLEKMQELLNGHDFTKFANLKPKLLEAVEDMLANDIARLMALVRQEEANMPSQ---SVKGGAFEGTMSGPFGHGYGEGASEGIDELEWVVGRDKPTYDEIFYTLSPINGKVTGAAAKKEMVKSKLPNSVLGKIWKLADVDKDGLLDDEEFALANHLIKVKLEGHELPASLPDHLVPPSKRGTV 508          
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000001303.1 (SMESG000001303.1)

HSP 1 Score: 1078.54 bits (2788), Expect = 0.000e+0
Identity = 540/540 (100.00%), Postives = 540/540 (100.00%), Query Frame = 2
Query:   20 MSIFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNGGDEN 1639
            MSIFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPSLLGKESKKKELISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNGGDEN
Sbjct:    1 MSIFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPSLLGKESKKKELISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNGGDEN 540          
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000026849.1 (SMESG000026849.1)

HSP 1 Score: 819.305 bits (2115), Expect = 0.000e+0
Identity = 400/534 (74.91%), Postives = 464/534 (86.89%), Query Frame = 2
Query:   20 MSIFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSDSTGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIV 1621
            M++FKSNK K E+ + NVI+ L  LY  KLLPLEK Y+FH+FHS  LE GDFDAKPMV+LLGQYSTGKTTFIRY+LE+DFPG+RIGPEPTTD F+++M  +K G IPGNALVVD KR FRPLSKFGNNFL RFQC  + NPVL++I  IDTPGILSGEKQRLDRGY+F +VIEWFAERVDRIILLFDAHKLDISDEF+RVIELLKGYE+KIRIVLNK D +DSQQLMRVYGALMWSLGKVLYTPEV RVYIGSFWDQPLH+DTNRKLFELEE DL  DL+SLP N+ +RKLND I+RARLAKVHAYIIS+L+++MP+L+GK++KKKELI NLQ  YD+IS+++SIS GDFPKI+RMQ +L D DFK F  LK KLIE VD+MLAND+AKLMQMIPKEQ+ +  +F + VKGGAF+VQ DN FGIGAS+GIN+GKFD +W V + + EYDE F+SL+P NGKINGT AK+Y++KTKLPYNILGKIWKLSD+DLDG LD DEFALA YL+ LKL+ EEIP TLPDHL+PP+KR IV
Sbjct:    1 MNLFKSNKPKHEEIFVNVIQSLNKLYTQKLLPLEKQYKFHEFHSSSLETGDFDAKPMVLLLGQYSTGKTTFIRYLLEQDFPGIRIGPEPTTDKFIAIMFDEKEGTIPGNALVVDPKRPFRPLSKFGNNFLTRFQCSMIKNPVLESINIIDTPGILSGEKQRLDRGYSFSEVIEWFAERVDRIILLFDAHKLDISDEFRRVIELLKGYEEKIRIVLNKCDMVDSQQLMRVYGALMWSLGKVLYTPEVARVYIGSFWDQPLHFDTNRKLFELEEKDLFEDLRSLPRNSTVRKLNDFIRRARLAKVHAYIISALRDEMPALIGKDNKKKELIQNLQGIYDRISRQHSISPGDFPKIERMQNLLPDHDFKAFPTLKQKLIETVDDMLANDIAKLMQMIPKEQT-AQNEFTNPVKGGAFEVQHDNPFGIGASEGINRGKFDTEWAVAKFKNEYDETFRSLHPVNGKINGTTAKDYLVKTKLPYNILGKIWKLSDIDLDGALDQDEFALAMYLVRLKLDNEEIPGTLPDHLIPPTKREIV 533          
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000006379.1 (SMESG000006379.1)

HSP 1 Score: 631.328 bits (1627), Expect = 0.000e+0
Identity = 322/522 (61.69%), Postives = 408/522 (78.16%), Query Frame = 2
Query:   71 VIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDGDFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDGDK--SGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFIDTPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRVIELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVYIGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARLAKVHAYIISSLKNQMPXXXXXXXXXXXXISNLQRTYDQISKEYSISIGDFPKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPK--EQSDSTGQFEHRVKGGAFD-VQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIV 1621
            V+  L  LY  KLLPLEK Y+F  FHS  +++ DF AKP+V+L+GQYSTGKTTFIRY+LEEDFPG+RIGPEPTTD FV +M  D+  S +IPG A V D K  F+ L+KFGN+FLNRFQC  L N VLK+IT IDTPGILSGEKQR+DRGY++ QVI+WFA+RVDRIILLFDAHKLDISDEFKR I++LK Y++KIRI+LNKAD I+SQQLM+VYGAL+WSLGKVL TPEV RV++GS+WDQPL +D +RKLF+LEE +LM+DL++LP NAA+RK+NDLI+RARLAKVHA+IIS LK  MP L+ KE KK+ELIS+L   + +++  + +S GDFPK+  MQE L D DF   S LK KLI+ VDNMLA D+  L+Q IP+  E++D     +  VKGGAF+ + ++N F       INKGKF+ +WVV   +  Y+EIF SL P NG + G   +++++KTKLP  +L ++WKLSD+D DGFLD DEFALASYL++LKL G+E+P+ LP HL+PPSK  I+
Sbjct:   14 VLADLYKLYTRKLLPLEKTYKFDYFHSSIMDEADFSAKPLVLLIGQYSTGKTTFIRYLLEEDFPGIRIGPEPTTDRFVVIMHSDQGSSTVIPGQAAVTDAKLPFKGLNKFGNSFLNRFQCSMLPNDVLKSITLIDTPGILSGEKQRVDRGYDYTQVIDWFAQRVDRIILLFDAHKLDISDEFKRTIDVLKSYDNKIRIILNKADMINSQQLMKVYGALLWSLGKVLSTPEVPRVFMGSYWDQPLQFDDSRKLFQLEEEELMNDLKNLPLNAAIRKINDLIRRARLAKVHAFIISHLKQNMPYLIRKEKKKQELISSLDEVFHRLATVHQVSEGDFPKVKSMQEQLIDTDFSQLSSLKQKLIDQVDNMLAVDIPILLQKIPQITEENDFG---KKTVKGGAFNAINEENPFQ-RVEIAINKGKFETNWVVEEFQSNYNEIFNSLEPRNGLLTGQQVRDHLLKTKLPVPVLSRVWKLSDLDGDGFLDCDEFALASYLVKLKLSGDELPNELPKHLIPPSKVNIL 531          
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000070268.1 (SMESG000070268.1)

HSP 1 Score: 87.8113 bits (216), Expect = 1.810e-17
Identity = 44/92 (47.83%), Postives = 62/92 (67.39%), Query Frame = 2
Query: 1334 WVVGRKRYEYDEI-FKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLP-DHLVPP 1603
            W +  + +    I F+ LNP  G I+G  AKEY+ K+KL   ILGKIW L+DVD DG + + EF++A +L++ KLEG E+P+ LP + LVPP
Sbjct:    8 WSISTEEFSQHRIQFEHLNPVKGFISGLQAKEYLTKSKLSNQILGKIWSLADVDQDGRMSLHEFSIAMHLIKKKLEGIELPNVLPKEMLVPP 99          

HSP 2 Score: 71.633 bits (174), Expect = 1.672e-12
Identity = 41/103 (39.81%), Postives = 57/103 (55.34%), Query Frame = 2
Query: 1331 DWVVG---RKRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNGG 1630
            DWV+    R RY      +  N   G ++G  AK  ++++ L  +IL +IW LSD+D DG L  +EF +A YL+E    G  +PS LP+ LVPPS   I N  
Sbjct:  161 DWVIMQAVRPRYRLQFNQQDRN-KKGFLSGDEAKAVLLQSGLSNSILAQIWNLSDIDSDGKLTCEEFCVAMYLVEQARAGRALPSKLPETLVPPSMVTISNNN 262          
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Match: SMESG000037239.1 (SMESG000037239.1)

HSP 1 Score: 85.8853 bits (211), Expect = 4.714e-17
Identity = 39/94 (41.49%), Postives = 59/94 (62.77%), Query Frame = 2
Query: 1334 WVVGR-KRYEYDEIFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLEGEEIPSTLPDHLVPPSKR 1612
            W +   ++  Y ++F+SLNP N K++G   K   + +KL    LG+IW L+D+D DG+LD +EF LA + +   L  EE+P TLP + +P SKR
Sbjct:  122 WAISNDEQARYSKVFESLNPVNNKLSGDAVKPVFLNSKLSVPTLGQIWTLADIDADGYLDREEFCLAMHFIYKCLANEELPKTLPINFIPLSKR 215          

HSP 2 Score: 64.6994 bits (156), Expect = 1.653e-10
Identity = 35/104 (33.65%), Postives = 61/104 (58.65%), Query Frame = 2
Query: 1316 GKFDDDWVVGR-KRYEYDEIFKSLNP-ANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDEFALASYLLELKLE---GEEIPSTLPDHLVPPSKR 1612
            G    DWV+G+ ++  YD +F + +   +G ++G   K+  +++ LP   L KIW L D++  G L+ ++FALA YL+  ++     + IPS+L   ++PPS R
Sbjct:  247 GSSSSDWVIGKLEKERYDNLFFAADKDKDGFVSGLEIKDTFVQSGLPQTELAKIWDLCDINKTGLLNSEQFALAMYLINQQISSAGSKPIPSSLALDMIPPSLR 350          
The following BLAST results are available for this feature:
BLAST of EH domain-containing protein 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
EHD10.000e+065.21EH domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
EHD10.000e+065.21EH domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
EHD10.000e+065.21EH domain containing 1 [Source:HGNC Symbol;Acc:HGN... [more]
EHD30.000e+065.77EH domain containing 3 [Source:HGNC Symbol;Acc:HGN... [more]
EHD40.000e+062.45EH domain containing 4 [Source:HGNC Symbol;Acc:HGN... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rme-10.000e+065.29Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
rme-10.000e+065.29Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
rme-10.000e+065.29Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
rme-10.000e+064.87Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
rme-10.000e+064.87Receptor Mediated Endocytosis [Source:UniProtKB/T... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Past10.000e+065.73gene:FBgn0016693 transcript:FBtr0082655[more]
Past10.000e+065.91gene:FBgn0016693 transcript:FBtr0082654[more]
CG92974.269e-4028.57gene:FBgn0038181 transcript:FBtr0333192[more]
CG92974.269e-4028.57gene:FBgn0038181 transcript:FBtr0082828[more]
CG92974.269e-4028.57gene:FBgn0038181 transcript:FBtr0333193[more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ehd1b0.000e+064.52EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ehd1b0.000e+064.52EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ehd1b0.000e+064.52EH-domain containing 1b [Source:ZFIN;Acc:ZDB-GENE-... [more]
ehd1a0.000e+065.57EH-domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
ehd30.000e+065.13EH-domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nfe2l20.000e+064.83nuclear factor, erythroid 2 like 2 [Source:Xenbase... [more]
dyrk20.000e+063.69dual specificity tyrosine phosphorylation regulate... [more]
dyrk20.000e+063.93dual specificity tyrosine phosphorylation regulate... [more]
dyrk20.000e+061.81dual specificity tyrosine phosphorylation regulate... [more]
ehd40.000e+062.43EH domain containing 4 [Source:NCBI gene;Acc:10012... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ehd10.000e+065.02EH-domain containing 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ehd10.000e+065.02EH-domain containing 1 [Source:MGI Symbol;Acc:MGI:... [more]
Ehd30.000e+065.40EH-domain containing 3 [Source:MGI Symbol;Acc:MGI:... [more]
Ehd40.000e+061.88EH-domain containing 4 [Source:MGI Symbol;Acc:MGI:... [more]
Ehd20.000e+060.00EH-domain containing 2 [Source:MGI Symbol;Acc:MGI:... [more]
back to top
BLAST of EH domain-containing protein 1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q5RBP4|EHD1_PONAB0.000e+065.21EH domain-containing protein 1 OS=Pongo abelii OX=... [more]
sp|Q9H4M9|EHD1_HUMAN0.000e+065.21EH domain-containing protein 1 OS=Homo sapiens OX=... [more]
sp|Q5E9R3|EHD1_BOVIN0.000e+065.21EH domain-containing protein 1 OS=Bos taurus OX=99... [more]
sp|Q641Z6|EHD1_RAT0.000e+065.02EH domain-containing protein 1 OS=Rattus norvegicu... [more]
sp|Q9WVK4|EHD1_MOUSE0.000e+065.02EH domain-containing protein 1 OS=Mus musculus OX=... [more]
back to top
BLAST of EH domain-containing protein 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5J4NPS30.000e+067.04EH domain-containing protein 1 OS=Paragonimus west... [more]
A0A504Z6J50.000e+067.29Receptor Mediated Endocytosis OS=Fasciola gigantic... [more]
A0A4E0R2470.000e+067.11Receptor Mediated Endocytosis OS=Fasciola hepatica... [more]
A0A3S1BQL50.000e+066.29Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
G7YAU00.000e+066.18EH domain-containing protein 3 OS=Clonorchis sinen... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ehd1a0.000e+065.53EH domain-containing protein 1-like [Source:NCBI g... [more]
ehd1b0.000e+063.00EH domain-containing protein 1-like [Source:NCBI g... [more]
ehd1b0.000e+062.93EH domain-containing protein 1-like [Source:NCBI g... [more]
ehd30.000e+062.94EH-domain containing 3 [Source:ZFIN;Acc:ZDB-GENE-0... [more]
ehd40.000e+061.10EH domain-containing protein 4 [Source:NCBI gene;A... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ehd1a6.959e-16560.79EH-domain containing 1a [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000007308.15.551e-9734.07pep scaffold:Pmarinus_7.0:GL476503:58924:70125:-1 ... [more]
srl2.284e-6638.64sarcalumenin [Source:ZFIN;Acc:ZDB-GENE-061110-91][more]
ENSPMAT00000004856.13.695e-2135.77pep scaffold:Pmarinus_7.0:GL476392:158221:184050:-... [more]
EPS15L18.946e-2148.94epidermal growth factor receptor pathway substrate... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
PAN13.663e-729.51Part of actin cytoskeleton-regulatory complex Pan1... [more]
EDE15.834e-728.43Scaffold protein involved in the formation of earl... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO495770.000e+060.93Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO439004.132e-1844.44Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO471461.102e-1246.97Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO361229.567e-924.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ehd1a0.000e+064.17EH domain-containing protein 1 [Source:NCBI gene;A... [more]
ehd40.000e+064.02EH domain-containing protein 4 [Source:NCBI gene;A... [more]
ehd30.000e+065.26EH domain-containing protein 3 [Source:NCBI gene;A... [more]
ehd30.000e+063.31EH domain-containing protein 3 [Source:NCBI gene;A... [more]
ehd1a0.000e+061.47EH domain-containing protein 1 [Source:NCBI gene;A... [more]
back to top
BLAST of EH domain-containing protein 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001303.10.000e+0100.00SMESG000001303.1[more]
SMESG000026849.10.000e+074.91SMESG000026849.1[more]
SMESG000006379.10.000e+061.69SMESG000006379.1[more]
SMESG000070268.11.810e-1747.83SMESG000070268.1[more]
SMESG000037239.14.714e-1741.49SMESG000037239.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023773 ID=SMED30023773|Name=EH domain-containing protein 1|organism=Schmidtea mediterranea sexual|type=transcript|length=2138bp
CTATATAAATCTTATATGAATGAGCATTTTCAAGTCAAATAAATCAAAAG
TCGAAAAAAGTTATGCCAATGTAATTGAAGGATTAAAGAACTTGTATAAT
TCAAAATTGTTGCCACTGGAAAAAATGTATCGATTTCATGATTTTCATTC
ACCTCAACTTGAAGATGGAGATTTTGATGCAAAGCCTATGGTAATGTTAT
TAGGTCAATATTCAACCGGCAAAACAACATTTATCAGATACATACTGGAA
GAAGATTTTCCAGGAATGCGTATTGGCCCAGAGCCAACAACAGATTCATT
TGTTTCTTTAATGGATGGAGATAAAAGTGGAATGATCCCAGGCAATGCAT
TAGTCGTTGACACAAAGCGCCAATTTCGTCCCTTATCCAAATTCGGGAAT
AATTTTCTTAATAGGTTTCAGTGTGTCACTTTAAACAATCCGGTATTAAA
AACCATAACATTTATTGATACACCGGGAATTTTAAGTGGAGAAAAGCAGC
GTTTAGATAGAGGTTATAATTTTGGTCAAGTTATCGAGTGGTTTGCTGAA
AGAGTAGATCGAATCATTCTTTTATTCGATGCACACAAGCTTGATATATC
GGATGAATTTAAACGTGTTATTGAATTATTAAAGGGCTATGAAGATAAAA
TTCGAATCGTTTTAAATAAAGCTGATAGAATTGACAGTCAACAATTGATG
CGGGTATATGGGGCTTTAATGTGGAGTTTAGGAAAGGTTTTATACACACC
GGAGGTTACTCGAGTTTACATCGGTTCGTTTTGGGATCAACCATTACATT
ATGATACAAATAGAAAGTTATTCGAGTTAGAAGAACACGATCTAATGTCT
GATTTGCAGTCACTGCCAGCAAATGCTGCCTTACGAAAATTAAATGACCT
AATCAAAAGAGCTAGATTAGCAAAAGTCCATGCATACATAATTAGCAGCT
TGAAAAATCAAATGCCATCTTTACTCGGCAAAGAGAGTAAAAAGAAAGAA
TTGATTTCAAATTTACAAAGAACCTATGATCAAATCTCCAAAGAATATTC
AATTTCAATTGGCGATTTTCCAAAAATCGACAGAATGCAAGAAATTCTTC
AAGATTGCGATTTCAAAACATTTTCACCGTTGAAAATGAAATTAATTGAA
GATGTTGATAACATGTTGGCCAATGATGTCGCTAAATTGATGCAAATGAT
TCCGAAAGAACAGTCGGACTCAACGGGGCAATTTGAACATCGTGTTAAAG
GAGGAGCGTTCGATGTACAGCAAGATAATCTTTTCGGTATTGGAGCCAGT
GACGGTATTAACAAGGGCAAATTTGATGACGATTGGGTGGTTGGTCGTAA
AAGATATGAATATGATGAGATCTTTAAATCTCTCAATCCAGCAAACGGCA
AAATCAACGGCACCGTTGCCAAAGAATATATGATTAAAACCAAATTGCCT
TACAACATATTGGGCAAAATTTGGAAATTGTCCGATGTCGATTTGGATGG
TTTTCTGGATATCGATGAATTTGCTTTGGCTTCATATTTGTTGGAATTGA
AATTGGAAGGCGAGGAAATTCCCAGCACTCTACCAGATCATTTGGTACCT
CCGTCGAAAAGAGCGATAGTTAACGGCGGTGATGAAAACTGAAAATATAA
TACTGTTGTTTATTTCTATTGTCTCATACAAATCTCTATTGCTATCACAA
AAATTTTATTAAGTTTTATATTAAGATTTCAAAATTTGAAAACTTCTCTG
ACTTATATTTGAATTTTTTGATTTAATTTCTTACAAACCGGTAATCGATT
GAATAAAATTGATAATTTGAAATCAGTAAAATCAGAAAAGATCCCAATAA
AATCCCTAAGTGCCATCGATTATATTATTTTTCAATTGTGTTTGTGATTT
TTCAGACGTTTTCTGTTCAATGTTGTATGATATTCCGTATGATAGTGTTA
ATTGATTGATTTAAATTGTGATTTCTGTAAGCAGAGTGCTAATTTATTGA
TTGAAATATGTATTTTTGTGTATGTGTGTGTGCTTGCAATATTTCTGATA
TCTGATTTTTATGACGATTTAAAATTATGAAATAATTTAAAAATTAACTG
CGTTTATTATTATTATTGAACATTGAAAATAAATTTAC
back to top

protein sequence of SMED30023773-orf-1

>SMED30023773-orf-1 ID=SMED30023773-orf-1|Name=SMED30023773-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=541bp
MSIFKSNKSKVEKSYANVIEGLKNLYNSKLLPLEKMYRFHDFHSPQLEDG
DFDAKPMVMLLGQYSTGKTTFIRYILEEDFPGMRIGPEPTTDSFVSLMDG
DKSGMIPGNALVVDTKRQFRPLSKFGNNFLNRFQCVTLNNPVLKTITFID
TPGILSGEKQRLDRGYNFGQVIEWFAERVDRIILLFDAHKLDISDEFKRV
IELLKGYEDKIRIVLNKADRIDSQQLMRVYGALMWSLGKVLYTPEVTRVY
IGSFWDQPLHYDTNRKLFELEEHDLMSDLQSLPANAALRKLNDLIKRARL
AKVHAYIISSLKNQMPSLLGKESKKKELISNLQRTYDQISKEYSISIGDF
PKIDRMQEILQDCDFKTFSPLKMKLIEDVDNMLANDVAKLMQMIPKEQSD
STGQFEHRVKGGAFDVQQDNLFGIGASDGINKGKFDDDWVVGRKRYEYDE
IFKSLNPANGKINGTVAKEYMIKTKLPYNILGKIWKLSDVDLDGFLDIDE
FALASYLLELKLEGEEIPSTLPDHLVPPSKRAIVNGGDEN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0032456endocytic recycling
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR040990DUF5600
IPR029952EHD4
IPR000261EH_dom
IPR031692EHD_N
IPR011992EF-hand-dom_pair
IPR027417P-loop_NTPase
IPR022812Dynamin_SF
IPR030381G_DYNAMIN_dom
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005525GTP binding
GO:0005509calcium ion binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000261EH domainSMARTSM00027eh_3coord: 438..531
e-value: 1.9E-33
score: 127.2
IPR000261EH domainPFAMPF12763EF-hand_4coord: 447..535
e-value: 3.3E-17
score: 62.3
IPR000261EH domainPROSITEPS50031EHcoord: 444..532
score: 23.011
IPR000261EH domainCDDcd00052EHcoord: 448..504
e-value: 3.03981E-17
score: 74.1782
IPR022812Dynamin superfamilyPFAMPF00350Dynamin_Ncoord: 58..217
e-value: 1.2E-12
score: 48.2
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 58..282
e-value: 1.8E-159
score: 532.4
NoneNo IPR availableGENE3DG3DSA:1.10.268.20coord: 21..383
e-value: 1.8E-159
score: 532.4
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 432..533
e-value: 1.9E-28
score: 100.1
NoneNo IPR availablePANTHERPTHR11216EH DOMAINcoord: 7..533
NoneNo IPR availableCDDcd09913EHDcoord: 57..297
e-value: 2.57133E-155
score: 441.327
IPR040990Domain of unknown function DUF5600PFAMPF18150DUF5600coord: 285..391
e-value: 9.3E-43
score: 145.2
IPR031692EH domain-containing protein, N-terminalPFAMPF16880EHD_Ncoord: 21..53
e-value: 7.7E-17
score: 60.9
IPR029952EH domain-containing protein 4PANTHERPTHR11216:SF57EH DOMAIN-CONTAINING PROTEIN 4coord: 7..533
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 476..511
score: 8.906
IPR030381Dynamin-type guanine nucleotide-binding (G) domainPROSITEPS51718G_DYNAMIN_2coord: 52..283
score: 38.574
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 444..531
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 45..301