ATP-dependent RNA helicase DBP2

Overview
NameATP-dependent RNA helicase DBP2
Smed IDSMED30023756
Length (bp)3397
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ATP-dependent RNA helicase DBP2 (SMED30023756) t-SNE clustered cells

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DBP2 (SMED30023756) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ATP-dependent RNA helicase DBP2 (SMED30023756) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ATP-dependent RNA helicase DBP2 (SMED30023756) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023756

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 17

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023756h1SMcG0014927 dd_Smed_v4_747_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023756h1SMcG0014927 dd_Smed_v4_747_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023756h1SMcG0014927 dd_Smed_v4_747_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023756h1SMcG0014927 dd_Smed_v4_747_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023756h1SMcG0014927 dd_Smed_v4_747_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023756h1SMcG0014927 dd_Smed_v4_747_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023756h1SMcG0014927 Contig55289newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
pharynxSMED30023756h1SMcG0014927 dd_Smed_v4_3816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023756h1SMcG0014927 dd_Smed_v4_3816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023756h1SMcG0014927 dd_Smed_v4_3816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023756h1SMcG0014927 dd_Smed_v4_3816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023756h1SMcG0014927 dd_Smed_v4_3816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023756h1SMcG0014927 dd_Smed_v4_3816_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023756h1SMcG0014927 dd_Smed_v6_747_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023756h1SMcG0014927 dd_Smed_v6_3816_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023756h1SMcG0014927 SMED_06736_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023756h1SMcG0014927 SMED_06736_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Match: DDX5 (DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2746])

HSP 1 Score: 414.075 bits (1063), Expect = 4.555e-131
Identity = 217/391 (55.50%), Postives = 271/391 (69.31%), Query Frame = 2
Query:   26 RFXXXXXXXXXKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            RF  S +      K G    KL    WN  +L KFEKNFY+E   +  R   EVE +R+   IT+ G N P PVL F E  FP  +M+ I    + +PTAIQ+QGWP+ALSG D+VG+AQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+    ++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRR TYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK+Y+ IN+G+L L AN +I Q V     +++ EK  RL+E +   K  +++VF ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   20 RFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDV 410          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Match: DDX5 (DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2746])

HSP 1 Score: 414.075 bits (1063), Expect = 5.679e-131
Identity = 217/391 (55.50%), Postives = 271/391 (69.31%), Query Frame = 2
Query:   26 RFXXXXXXXXXKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            RF  S +      K G    KL    WN  +L KFEKNFY+E   +  R   EVE +R+   IT+ G N P PVL F E  FP  +M+ I    + +PTAIQ+QGWP+ALSG D+VG+AQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+    ++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRR TYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK+Y+ IN+G+L L AN +I Q V     +++ EK  RL+E +   K  +++VF ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   20 RFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDV 410          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 406.757 bits (1044), Expect = 7.882e-127
Identity = 207/379 (54.62%), Postives = 266/379 (70.18%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENV-PNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   W+  +L KFEKNFY E   V      EV++ R++  IT+ G +V P PV  F    FP ++M+ + D  + +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++Y QINVG+L L AN +I Q V      ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q ER+ VL +FR G+  +LIATDVASRGLD++ V
Sbjct:  109 KFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDV 487          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 406.757 bits (1044), Expect = 8.329e-127
Identity = 207/379 (54.62%), Postives = 266/379 (70.18%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENV-PNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   W+  +L KFEKNFY E   V      EV++ R++  IT+ G +V P PV  F    FP ++M+ + D  + +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++Y QINVG+L L AN +I Q V      ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q ER+ VL +FR G+  +LIATDVASRGLD++ V
Sbjct:  109 KFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDV 487          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Match: DDX17 (DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:2740])

HSP 1 Score: 406.371 bits (1043), Expect = 1.012e-126
Identity = 207/379 (54.62%), Postives = 266/379 (70.18%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENV-PNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   W+  +L KFEKNFY E   V      EV++ R++  IT+ G +V P PV  F    FP ++M+ + D  + +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++Y QINVG+L L AN +I Q V      ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q ER+ VL +FR G+  +LIATDVASRGLD++ V
Sbjct:  109 KFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDV 487          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 357.451 bits (916), Expect = 9.449e-111
Identity = 178/367 (48.50%), Postives = 252/367 (68.66%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQX---XXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDI 1180
            L+  DW+   L   EK+FY E + V  R   E++++   N +T+ G  VP PV  F E   P  I   +   ++ KPT IQS  WP+A+SG D++ IA+TGSGKT +F+LPA+VHI  Q   Q G+GP  L+L+PTRELAQQV++V+I+F     +K+ C +GGAS+  Q   L +  ++V+ATPGRL+DFL++  TN+++C+YLVLDEADRMLDMGFEP I+KI+ Q+RPDRQTLM+SATWP EV+ LASDF K+   +NVGSL L AN +I Q    +E   ++ K   L+  + + K  ++++F ETKRK D+L R + R G   + +HGDK Q ER+ VLQ+F+ G+  +++ATDVA+RGLD+
Sbjct:   77 LRDVDWSAENLTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIHELLY-GKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDV 442          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 357.451 bits (916), Expect = 9.449e-111
Identity = 178/367 (48.50%), Postives = 252/367 (68.66%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQX---XXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDI 1180
            L+  DW+   L   EK+FY E + V  R   E++++   N +T+ G  VP PV  F E   P  I   +   ++ KPT IQS  WP+A+SG D++ IA+TGSGKT +F+LPA+VHI  Q   Q G+GP  L+L+PTRELAQQV++V+I+F     +K+ C +GGAS+  Q   L +  ++V+ATPGRL+DFL++  TN+++C+YLVLDEADRMLDMGFEP I+KI+ Q+RPDRQTLM+SATWP EV+ LASDF K+   +NVGSL L AN +I Q    +E   ++ K   L+  + + K  ++++F ETKRK D+L R + R G   + +HGDK Q ER+ VLQ+F+ G+  +++ATDVA+RGLD+
Sbjct:   77 LRDVDWSAENLTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIHELLY-GKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDV 442          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 357.451 bits (916), Expect = 9.449e-111
Identity = 178/367 (48.50%), Postives = 252/367 (68.66%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQX---XXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDI 1180
            L+  DW+   L   EK+FY E + V  R   E++++   N +T+ G  VP PV  F E   P  I   +   ++ KPT IQS  WP+A+SG D++ IA+TGSGKT +F+LPA+VHI  Q   Q G+GP  L+L+PTRELAQQV++V+I+F     +K+ C +GGAS+  Q   L +  ++V+ATPGRL+DFL++  TN+++C+YLVLDEADRMLDMGFEP I+KI+ Q+RPDRQTLM+SATWP EV+ LASDF K+   +NVGSL L AN +I Q    +E   ++ K   L+  + + K  ++++F ETKRK D+L R + R G   + +HGDK Q ER+ VLQ+F+ G+  +++ATDVA+RGLD+
Sbjct:   77 LRDVDWSAENLTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIHELLY-GKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDV 442          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 357.451 bits (916), Expect = 9.449e-111
Identity = 178/367 (48.50%), Postives = 252/367 (68.66%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQX---XXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDI 1180
            L+  DW+   L   EK+FY E + V  R   E++++   N +T+ G  VP PV  F E   P  I   +   ++ KPT IQS  WP+A+SG D++ IA+TGSGKT +F+LPA+VHI  Q   Q G+GP  L+L+PTRELAQQV++V+I+F     +K+ C +GGAS+  Q   L +  ++V+ATPGRL+DFL++  TN+++C+YLVLDEADRMLDMGFEP I+KI+ Q+RPDRQTLM+SATWP EV+ LASDF K+   +NVGSL L AN +I Q    +E   ++ K   L+  + + K  ++++F ETKRK D+L R + R G   + +HGDK Q ER+ VLQ+F+ G+  +++ATDVA+RGLD+
Sbjct:   77 LRDVDWSAENLTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIHELLY-GKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDV 442          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Match: ddx-17 (DEAD boX helicase homolog [Source:UniProtKB/TrEMBL;Acc:Q9XUW5])

HSP 1 Score: 357.451 bits (916), Expect = 9.449e-111
Identity = 178/367 (48.50%), Postives = 252/367 (68.66%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQX---XXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDI 1180
            L+  DW+   L   EK+FY E + V  R   E++++   N +T+ G  VP PV  F E   P  I   +   ++ KPT IQS  WP+A+SG D++ IA+TGSGKT +F+LPA+VHI  Q   Q G+GP  L+L+PTRELAQQV++V+I+F     +K+ C +GGAS+  Q   L +  ++V+ATPGRL+DFL++  TN+++C+YLVLDEADRMLDMGFEP I+KI+ Q+RPDRQTLM+SATWP EV+ LASDF K+   +NVGSL L AN +I Q    +E   ++ K   L+  + + K  ++++F ETKRK D+L R + R G   + +HGDK Q ER+ VLQ+F+ G+  +++ATDVA+RGLD+
Sbjct:   77 LRDVDWSAENLTPIEKDFYHENAAVSRREQYEIDQWVSANQVTLEGRGVPRPVFEFNEAPLPGQIHELLY-GKFQKPTVIQSISWPIAMSGRDIISIAKTGSGKTLAFMLPALVHITKQAHRQRGEGPAVLVLLPTRELAQQVQEVSIDFCHSLGLKMTCLFGGASKGPQARDLERGVDIVVATPGRLLDFLDNGTTNMKKCSYLVLDEADRMLDMGFEPQIKKIIGQIRPDRQTLMFSATWPKEVRALASDFQKDAAFLNVGSLELAANHNITQVVDILEEHAKQAKLMELLNHIMNQKECKTIIFVETKRKADELTRAMRRDGWPTLCIHGDKNQGERDWVLQEFKAGKTPIMLATDVAARGLDV 442          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0309320)

HSP 1 Score: 412.535 bits (1059), Expect = 1.869e-132
Identity = 210/377 (55.70%), Postives = 276/377 (73.21%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCD-----NKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRH 1204
            ++P D+++  L  F+KNFY+E   V NR+  EV+++R+E  IT+ G+ VPNP+  F EV  P+++M  I+   +  PTAIQ+QGWP+A+SGS+ VGIA+TGSGKT  ++LPAIVHI  Q P+Q GDGPI L+L PTRELAQQ+++VA EF   + ++  C +GGA +  Q+  L +  E+VIATPGRLIDFL+   TNL+RCTYLVLDEADRMLDMGFEP IRKIVSQ+RPDRQTLMWSATWP EV+ LA DFL NY+QIN+GSL L AN +I+Q V++ DE  KEE+L  +L D         + ++F ETKR+VD+L R I   G+ C A+HGDK Q ER+ VL++FR G+  +L+ATDVA+RGLD    T   H
Sbjct:   87 MRPVDFSN--LAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQ-VPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDPTTTTEPNH 460          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0301947)

HSP 1 Score: 413.69 bits (1062), Expect = 1.031e-131
Identity = 208/372 (55.91%), Postives = 276/372 (74.19%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCD-----NKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            ++P D+++  L  F+KNFY+E   V NR+  EV+++R+E  IT+ G+ VPNP+  F EV  P+++M  I+   +  PTAIQ+QGWP+A+SGS+ VGIA+TGSGKT  ++LPAIVHI  Q P+Q GDGPI L+L PTRELAQQ+++VA EF   + ++  C +GGA +  Q+  L +  E+VIATPGRLIDFL+   TNL+RCTYLVLDEADRMLDMGFEP IRKIVSQ+RPDRQTLMWSATWP EV+ LA DFL NY+QIN+GSL L AN +I+Q V++ DE  KEE+L  +L D         + ++F ETKR+VD+L R I   G+ C A+HGDK Q ER+ VL++FR G+  +L+ATDVA+RGLD+  +
Sbjct:   87 MRPVDFSN--LAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQ-VPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGI 455          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078650)

HSP 1 Score: 413.69 bits (1062), Expect = 1.031e-131
Identity = 208/372 (55.91%), Postives = 276/372 (74.19%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCD-----NKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            ++P D+++  L  F+KNFY+E   V NR+  EV+++R+E  IT+ G+ VPNP+  F EV  P+++M  I+   +  PTAIQ+QGWP+A+SGS+ VGIA+TGSGKT  ++LPAIVHI  Q P+Q GDGPI L+L PTRELAQQ+++VA EF   + ++  C +GGA +  Q+  L +  E+VIATPGRLIDFL+   TNL+RCTYLVLDEADRMLDMGFEP IRKIVSQ+RPDRQTLMWSATWP EV+ LA DFL NY+QIN+GSL L AN +I+Q V++ DE  KEE+L  +L D         + ++F ETKR+VD+L R I   G+ C A+HGDK Q ER+ VL++FR G+  +L+ATDVA+RGLD+  +
Sbjct:   87 MRPVDFSN--LAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQ-VPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGI 455          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078649)

HSP 1 Score: 413.69 bits (1062), Expect = 1.096e-131
Identity = 208/372 (55.91%), Postives = 276/372 (74.19%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCD-----NKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            ++P D+++  L  F+KNFY+E   V NR+  EV+++R+E  IT+ G+ VPNP+  F EV  P+++M  I+   +  PTAIQ+QGWP+A+SGS+ VGIA+TGSGKT  ++LPAIVHI  Q P+Q GDGPI L+L PTRELAQQ+++VA EF   + ++  C +GGA +  Q+  L +  E+VIATPGRLIDFL+   TNL+RCTYLVLDEADRMLDMGFEP IRKIVSQ+RPDRQTLMWSATWP EV+ LA DFL NY+QIN+GSL L AN +I+Q V++ DE  KEE+L  +L D         + ++F ETKR+VD+L R I   G+ C A+HGDK Q ER+ VL++FR G+  +L+ATDVA+RGLD+  +
Sbjct:   90 MRPVDFSN--LAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQ-VPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGI 458          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Match: Rm62 (gene:FBgn0003261 transcript:FBtr0078651)

HSP 1 Score: 413.69 bits (1062), Expect = 1.096e-131
Identity = 208/372 (55.91%), Postives = 276/372 (74.19%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCD-----NKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            ++P D+++  L  F+KNFY+E   V NR+  EV+++R+E  IT+ G+ VPNP+  F EV  P+++M  I+   +  PTAIQ+QGWP+A+SGS+ VGIA+TGSGKT  ++LPAIVHI  Q P+Q GDGPI L+L PTRELAQQ+++VA EF   + ++  C +GGA +  Q+  L +  E+VIATPGRLIDFL+   TNL+RCTYLVLDEADRMLDMGFEP IRKIVSQ+RPDRQTLMWSATWP EV+ LA DFL NY+QIN+GSL L AN +I+Q V++ DE  KEE+L  +L D         + ++F ETKR+VD+L R I   G+ C A+HGDK Q ER+ VL++FR G+  +L+ATDVA+RGLD+  +
Sbjct:   90 MRPVDFSN--LAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQ-VPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGI 458          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 426.017 bits (1094), Expect = 2.041e-137
Identity = 215/378 (56.88%), Postives = 272/378 (71.96%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G   ++L+   WN  +L KFEKNFY+E   V  R+  EVE +R+   IT+ G + P P++ F E  FP ++M+ I    W  PT IQ+QGWP+ALSG D+VGIAQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+ + ++IK  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK Y+QINVG+L L AN +I Q V      ++++K  RL+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   35 KFGNPGDRLRKKHWNLDELPKFEKNFYQENPDVARRSAQEVEHYRRSKEITVKGRDGPKPIVKFHEANFPKYVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDV 412          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 427.172 bits (1097), Expect = 3.893e-136
Identity = 215/378 (56.88%), Postives = 272/378 (71.96%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G   ++L+   WN  +L KFEKNFY+E   V  R+  EVE +R+   IT+ G + P P++ F E  FP ++M+ I    W  PT IQ+QGWP+ALSG D+VGIAQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+ + ++IK  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK Y+QINVG+L L AN +I Q V      ++++K  RL+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   35 KFGNPGDRLRKKHWNLDELPKFEKNFYQENPDVARRSAQEVEHYRRSKEITVKGRDGPKPIVKFHEANFPKYVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLDVEDV 412          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Match: ddx5 (DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN;Acc:ZDB-GENE-030131-925])

HSP 1 Score: 419.468 bits (1077), Expect = 6.114e-135
Identity = 213/375 (56.80%), Postives = 271/375 (72.27%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXX---XXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDI 1180
            K G   ++L+   WN  +L KFEKNFY+E   V  R+  EVE +R+   IT+ G + P P++ F E  FP ++M+ I    W  PT IQ+QGWP+ALSG D+VGIAQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+ + ++IK  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK Y+QINVG+L L AN +I Q V++    ++++K  RL+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGL +
Sbjct:   35 KFGNPGDRLRKKHWNLDELPKFEKNFYQENPDVARRSAQEVEHYRRSKEITVKGRDGPKPIVKFHEANFPKYVMDVITKQNWTDPTPIQAQGWPVALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGKASRIKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYIQINVGALQLSANHNILQIVDVCNDGEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKNQQERDWVLNEFKYGKAPILIATDVASRGLGL 409          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Match: si:dkey-156n14.5 (si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18])

HSP 1 Score: 405.601 bits (1041), Expect = 7.118e-131
Identity = 205/373 (54.96%), Postives = 268/373 (71.85%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGL 1174
            K G   ++L+   W+  QL KFEKNFY E   V + +  +VE++R++  IT+ G   P PV  F + QFP ++M+ +    + +PTAIQ+QG+P+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + ++IK  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++YVQIN+G+L L AN +I Q V      ++  K  +L+E +   K  ++++F ETK++ D+L R + R G   M +HGDK Q ER+ VL +FR G+  +LIATDVASRGL
Sbjct:   34 KFGNPGDRLRKKKWDLDQLPKFEKNFYNENPEVHHMSQYDVEEYRRKREITVRGSGCPKPVTNFHQAQFPQYVMDVLLQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVAFDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINIGALELSANHNILQIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGL 406          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Match: DDX17 (si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-18])

HSP 1 Score: 405.601 bits (1041), Expect = 7.118e-131
Identity = 205/373 (54.96%), Postives = 268/373 (71.85%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGL 1174
            K G   ++L+   W+  QL KFEKNFY E   V + +  +VE++R++  IT+ G   P PV  F + QFP ++M+ +    + +PTAIQ+QG+P+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + ++IK  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++YVQIN+G+L L AN +I Q V      ++  K  +L+E +   K  ++++F ETK++ D+L R + R G   M +HGDK Q ER+ VL +FR G+  +LIATDVASRGL
Sbjct:   34 KFGNPGDRLRKKKWDLDQLPKFEKNFYNENPEVHHMSQYDVEEYRRKREITVRGSGCPKPVTNFHQAQFPQYVMDVLLQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVAFDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEVGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLQDYVQINIGALELSANHNILQIVDVCMENEKDNKLIQLMEEIMAEKENKTIIFVETKKRCDELTRRMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGL 406          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 407.142 bits (1045), Expect = 7.635e-130
Identity = 205/378 (54.23%), Postives = 270/378 (71.43%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   W+  +L KFEKNFY E   V      +VE+ R++  ITI G N P P+  F +  FP ++++ + D R+ +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPA+VHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++YVQIN+G+L L AN +I Q V   +  ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q+ER+ VL +FR G+  +LIATDVASRGLD++ +
Sbjct:   35 KFGNPGERLRKKRWDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQYVLDVLIDQRFKEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAMVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYVQINIGNLELSANHNILQIVDVCQESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLDVEDI 412          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 406.757 bits (1044), Expect = 1.023e-129
Identity = 205/378 (54.23%), Postives = 270/378 (71.43%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   W+  +L KFEKNFY E   V      +VE+ R++  ITI G N P P+  F +  FP ++++ + D R+ +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPA+VHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++YVQIN+G+L L AN +I Q V   +  ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q+ER+ VL +FR G+  +LIATDVASRGLD++ +
Sbjct:   23 KFGNPGERLRKKRWDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQYVLDVLIDQRFKEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAMVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYVQINIGNLELSANHNILQIVDVCQESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLDVEDI 400          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 406.757 bits (1044), Expect = 1.046e-129
Identity = 205/378 (54.23%), Postives = 270/378 (71.43%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   W+  +L KFEKNFY E   V      +VE+ R++  ITI G N P P+  F +  FP ++++ + D R+ +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPA+VHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++YVQIN+G+L L AN +I Q V   +  ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q+ER+ VL +FR G+  +LIATDVASRGLD++ +
Sbjct:   12 KFGNPGERLRKKRWDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQYVLDVLIDQRFKEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAMVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYVQINIGNLELSANHNILQIVDVCQESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLDVEDI 389          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 402.519 bits (1033), Expect = 2.509e-129
Identity = 210/412 (50.97%), Postives = 281/412 (68.20%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQ----AVTTKRHIYGT-KLTCP*MVYVSRVRAYLCAP 1276
            K G    +L+   W+  +L KFEKNFY E   V      +VE+ R++  ITI G N P P+  F +  FP ++++ + D R+ +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPA+VHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++YVQIN+G+L L AN +I Q V   +  ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q+ER+ VL +FR G+  +LIATDVASRGL +     ++ +  H   T +      +Y + +   +CAP
Sbjct:   12 KFGNPGERLRKKRWDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQYVLDVLIDQRFKEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAMVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYVQINIGNLELSANHNILQIVDVCQESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLGLYFWRFSLFSSLHSPATLRFPLCSTLYCAYMYPLICAP 423          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Match: ddx17 (DEAD-box helicase 17 [Source:NCBI gene;Acc:549535])

HSP 1 Score: 406.757 bits (1044), Expect = 2.444e-128
Identity = 205/378 (54.23%), Postives = 270/378 (71.43%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   W+  +L KFEKNFY E   V      +VE+ R++  ITI G N P P+  F +  FP ++++ + D R+ +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPA+VHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++YVQIN+G+L L AN +I Q V   +  ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q+ER+ VL +FR G+  +LIATDVASRGLD++ +
Sbjct:   21 KFGNPGERLRKKRWDLSELPKFEKNFYTEHPEVARMTQHDVEELRRKKEITIRGVNCPKPIYGFHQANFPQYVLDVLIDQRFKEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAMVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKSSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYVQINIGNLELSANHNILQIVDVCQESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQQERDWVLCEFRTGKAPILIATDVASRGLDVEDI 398          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Match: Ddx5 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:MGI Symbol;Acc:MGI:105037])

HSP 1 Score: 406.757 bits (1044), Expect = 3.070e-131
Identity = 211/373 (56.57%), Postives = 263/373 (70.51%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGL 1174
            K G    KL    WN  +L KFEKNFY+E   +  R   EV+ +R+   IT+ G N P PVL F E  FP  +M+ I    + +PTAIQ+QGWP+ALSG D+VG+AQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+    ++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRR TYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK+Y+ IN+G+L L AN +I Q V     +++ EK  RL+E +   K  +++VF ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGL
Sbjct:   33 KFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGL 405          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Match: Ddx5 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:MGI Symbol;Acc:MGI:105037])

HSP 1 Score: 412.92 bits (1060), Expect = 1.089e-130
Identity = 216/391 (55.24%), Postives = 271/391 (69.31%), Query Frame = 2
Query:   26 RFXXXXXXXXXKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            RF  S +      K G    KL    WN  +L KFEKNFY+E   +  R   EV+ +R+   IT+ G N P PVL F E  FP  +M+ I    + +PTAIQ+QGWP+ALSG D+VG+AQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+    ++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRR TYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK+Y+ IN+G+L L AN +I Q V     +++ EK  RL+E +   K  +++VF ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   20 RFGGSRTGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDV 410          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 400.208 bits (1027), Expect = 1.387e-128
Identity = 206/379 (54.35%), Postives = 264/379 (69.66%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENV-PNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   W+  +L KFEKNFY E   V      EV++ R++  IT+ G +V P PV  F    FP ++M+ + D  + +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++Y QINVG+L L AN +I Q V      ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q ER+ VL +FR G+  +LIATDVASRGL   A+
Sbjct:   30 KFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLGSPAL 408          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 399.053 bits (1024), Expect = 2.069e-128
Identity = 205/376 (54.52%), Postives = 263/376 (69.95%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENV-PNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDI 1180
            K G    +L+   W+  +L KFEKNFY E   V      EV++ R++  IT+ G +V P PV  F    FP ++M+ + D  + +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++Y QINVG+L L AN +I Q V      ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q ER+ VL +FR G+  +LIATDVASRGL +
Sbjct:   30 KFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLGL 405          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Match: Ddx17 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:MGI Symbol;Acc:MGI:1914290])

HSP 1 Score: 406.757 bits (1044), Expect = 6.922e-128
Identity = 207/379 (54.62%), Postives = 266/379 (70.18%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENV-PNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   W+  +L KFEKNFY E   V      EV++ R++  IT+ G +V P PV  F    FP ++M+ + D  + +PT IQ QG+P+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL++Y QINVG+L L AN +I Q V      ++  K  +L+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q ER+ VL +FR G+  +LIATDVASRGLD++ V
Sbjct:   30 KFGNPGERLRKKKWDLSELPKFEKNFYVEHPEVARLTPYEVDELRRKKEITVRGGDVCPKPVFAFHHANFPQYVMDVLMDQHFTEPTPIQCQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVADDYGKCSRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLRDYTQINVGNLELSANHNILQIVDVCMESEKDHKLIQLMEEIMAEKENKTIIFVETKRRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLNEFRSGKAPILIATDVASRGLDVEDV 408          
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Match: sp|P17844|DDX5_HUMAN (Probable ATP-dependent RNA helicase DDX5 OS=Homo sapiens OX=9606 GN=DDX5 PE=1 SV=1)

HSP 1 Score: 414.075 bits (1063), Expect = 2.188e-130
Identity = 217/391 (55.50%), Postives = 271/391 (69.31%), Query Frame = 2
Query:   26 RFXXXXXXXXXKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            RF  S +      K G    KL    WN  +L KFEKNFY+E   +  R   EVE +R+   IT+ G N P PVL F E  FP  +M+ I    + +PTAIQ+QGWP+ALSG D+VG+AQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+    ++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRR TYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK+Y+ IN+G+L L AN +I Q V     +++ EK  RL+E +   K  +++VF ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   20 RFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDV 410          
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Match: sp|Q4R6M5|DDX5_MACFA (Probable ATP-dependent RNA helicase DDX5 OS=Macaca fascicularis OX=9541 GN=DDX5 PE=2 SV=1)

HSP 1 Score: 413.305 bits (1061), Expect = 5.567e-130
Identity = 217/391 (55.50%), Postives = 270/391 (69.05%), Query Frame = 2
Query:   26 RFXXXXXXXXXKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            RF  S +      K G    KL    WN  +L KFEKNFY+E   +  R   EVE +R+   IT+ G N P PVL F E  FP  +M+ I    + +PTAIQ+QGWP+ALSG D+VG+AQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+    ++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRR TYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK+Y+ IN+G+L L AN +I Q V     +++ EK  RL+E +   K  +++VF ETKR+ D+L R + R G   M +HGDK Q+ER  VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   20 RFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERGWVLNEFKHGKAPILIATDVASRGLDVEDV 410          
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Match: sp|Q61656|DDX5_MOUSE (Probable ATP-dependent RNA helicase DDX5 OS=Mus musculus OX=10090 GN=Ddx5 PE=1 SV=2)

HSP 1 Score: 412.92 bits (1060), Expect = 7.953e-130
Identity = 216/391 (55.24%), Postives = 271/391 (69.31%), Query Frame = 2
Query:   26 RFXXXXXXXXXKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            RF  S +      K G    KL    WN  +L KFEKNFY+E   +  R   EV+ +R+   IT+ G N P PVL F E  FP  +M+ I    + +PTAIQ+QGWP+ALSG D+VG+AQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+    ++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRR TYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK+Y+ IN+G+L L AN +I Q V     +++ EK  RL+E +   K  +++VF ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   20 RFGGSRTGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVDTYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDV 410          
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Match: sp|A5A6J2|DDX5_PANTR (Probable ATP-dependent RNA helicase DDX5 OS=Pan troglodytes OX=9598 GN=DDX5 PE=2 SV=1)

HSP 1 Score: 411.764 bits (1057), Expect = 2.200e-129
Identity = 217/391 (55.50%), Postives = 270/391 (69.05%), Query Frame = 2
Query:   26 RFXXXXXXXXXKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            RF  S +      K G    KL    WN  +L KFEKNFY+E   +  R   EVE +R+   IT+ G N P PVL F E  FP  +M+ I    + +PTAIQ+QGWP+ALSG D+VG+AQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+    ++K  C YGGA +  QI  L +  E  IATPGRLIDFL    TNLRR TYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK+Y+ IN+G+L L AN +I Q V     +++ EK  RL+E +   K  +++VF ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   20 RFGGSRAGPLSGKKFGNPGEKLVKKKWNLDELPKFEKNFYQEHPDLARRTAQEVETYRRSKEITVRGHNCPKPVLNFYEANFPANVMDVIARQNFTEPTAIQAQGWPVALSGLDMVGVAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYCRACRLKSTCIYGGAPKGPQIRDLERGVENCIATPGRLIDFLECGKTNLRRTTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYIHINIGALELSANHNILQIVDVCHDVEKDEKLIRLMEEIMSEKENKTIVFVETKRRCDELTRKMRRDGWPAMGIHGDKSQQERDWVLNEFKHGKAPILIATDVASRGLDVEDV 410          
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Match: sp|P19109|DDX17_DROME (ATP-dependent RNA helicase p62 OS=Drosophila melanogaster OX=7227 GN=Rm62 PE=1 SV=3)

HSP 1 Score: 413.305 bits (1061), Expect = 9.586e-129
Identity = 208/372 (55.91%), Postives = 276/372 (74.19%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCD-----NKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            ++P D+++  L  F+KNFY+E   V NR+  EV+++R+E  IT+ G+ VPNP+  F EV  P+++M  I+   +  PTAIQ+QGWP+A+SGS+ VGIA+TGSGKT  ++LPAIVHI  Q P+Q GDGPI L+L PTRELAQQ+++VA EF   + ++  C +GGA +  Q+  L +  E+VIATPGRLIDFL+   TNL+RCTYLVLDEADRMLDMGFEP IRKIVSQ+RPDRQTLMWSATWP EV+ LA DFL NY+QIN+GSL L AN +I+Q V++ DE  KEE+L  +L D         + ++F ETKR+VD+L R I   G+ C A+HGDK Q ER+ VL++FR G+  +L+ATDVA+RGLD+  +
Sbjct:  231 MRPVDFSN--LAPFKKNFYQEHPNVANRSPYEVQRYREEQEITVRGQ-VPNPIQDFSEVHLPDYVMKEIRRQGYKAPTAIQAQGWPIAMSGSNFVGIAKTGSGKTLGYILPAIVHINNQQPLQRGDGPIALVLAPTRELAQQIQQVATEFGSSSYVRNTCVFGGAPKGGQMRDLQRGCEIVIATPGRLIDFLSAGSTNLKRCTYLVLDEADRMLDMGFEPQIRKIVSQIRPDRQTLMWSATWPKEVKQLAEDFLGNYIQINIGSLELSANHNIRQVVDVCDEFSKEEKLKTLLSDIYDTSESPGKIIIFVETKRRVDNLVRFIRSFGVRCGAIHGDKSQSERDFVLREFRSGKSNILVATDVAARGLDVDGI 599          
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Match: A0A448XGE6 (Uncharacterized protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS29386 PE=3 SV=1)

HSP 1 Score: 463.766 bits (1192), Expect = 3.406e-150
Identity = 226/360 (62.78%), Postives = 284/360 (78.89%), Query Frame = 2
Query:  101 DWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDI 1180
            +W+   L+KFEK FY+E S VR R+  E++ FR+++ ITI+G+ VP P+  F E  FP++I++ I  N+W +PT+IQ+QG P+A+SG D+VGIAQTGSGKTASFL+PA++HI AQP ++ GDGPI L+LVPTRELAQQVE V+ EF   +KI IACCYGGA R+ Q+ +L K PEVVIATPGRL+DFL    TNLRRCTYLVLDEADRMLDMGFEP IR+I+SQVRPDRQTLMWSATWP EV+ LA+DFL +Y+QIN+GS  LHAN +IKQ VE+L E EK  RLIE+L    R+R ++F+ETKR+ DDLC  ++ +G    AMHGDK QRERE VL  FR GR  +L+ATD+ASRGL +
Sbjct:   15 EWDRYSLVKFEKKFYRESSAVRRRSTREIDDFRRKHKITILGDGVPRPIFKFSEAGFPSYIVDIINQNKWERPTSIQAQGLPLAMSGRDMVGIAQTGSGKTASFLIPALIHIRAQPSMKPGDGPIALVLVPTRELAQQVESVSEEFCANSKIHIACCYGGAPRSLQLRRLQKYPEVVIATPGRLLDFLEGGNTNLRRCTYLVLDEADRMLDMGFEPSIRRIISQVRPDRQTLMWSATWPKEVRALANDFLTDYIQINIGSSKLHANHNIKQVVEVLQESEKPRRLIELLKSFSRERIIIFTETKRRTDDLCERLLDRGFSAAAMHGDKPQREREHVLDRFRSGRITILVATDIASRGLGV 374          
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Match: A0A183TBL5 (Uncharacterized protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS13863 PE=3 SV=1)

HSP 1 Score: 464.537 bits (1194), Expect = 8.080e-149
Identity = 230/369 (62.33%), Postives = 289/369 (78.32%), Query Frame = 2
Query:   83 NKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
             KL+P DW + +L+KFEK FY+E S VR R+ +E+++FRK++ IT  GE+VP P+  F E  FP  +M+ I+DN+W  PTAIQ+QGWP+ALSG DVVGIAQTGSGKTA+FLLPAIVHI+AQP ++  DGPI LILV TRELAQQVEKVA EF   A +K AC YGGA R  Q+ QL + PEVVIATPGRL+DFL  K TNLRRCTYLV+DEADRMLDMGFEP +R+I+SQVRPDRQTLMWSATWP EV++LA DFL  +VQIN+GS  L AN +IKQ VE++ E +K +RL+ +L +  + +S++F ET++K D+LC  +  +G    AMHG+K QRERE VL DFR G+  +L+ATD+ASRGLDIQ +
Sbjct:   18 QKLRPVDWKNERLVKFEKEFYRESSSVRKRSSAEIKQFRKDSKITTEGEDVPRPIFKFSEAGFPKSVMDVIRDNKWKNPTAIQAQGWPIALSGKDVVGIAQTGSGKTAAFLLPAIVHIKAQPSMKRLDGPIALILVTTRELAQQVEKVAREFCSNAGLKCACLYGGAPRVPQLRQLERYPEVVIATPGRLLDFLETKDTNLRRCTYLVVDEADRMLDMGFEPSLRRIISQVRPDRQTLMWSATWPKEVRSLARDFLHKFVQINIGSQDLSANHNIKQIVEVIPESKKYDRLVLLLKEFGKAKSIIFVETRKKADELCYRLYDRGFATAAMHGNKQQREREAVLDDFRRGKVNILVATDIASRGLDIQDI 386          
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Match: A0A0V0J4X6 (Uncharacterized protein (Fragment) OS=Schistocephalus solidus OX=70667 GN=TR148536 PE=3 SV=1)

HSP 1 Score: 458.373 bits (1178), Expect = 3.972e-148
Identity = 227/364 (62.36%), Postives = 285/364 (78.30%), Query Frame = 2
Query:   83 NKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGL 1174
             KL+P DW + +L+KFEK FY+E S VR R+ +E+++FRK++ IT  GE+VP P+  F E  FP  +M+ I+DN+W  PTAIQ+QGWP+ALSG DVVGIAQTGSGKTA+FLLPAIVHI+AQP ++  DGPI LILV TRELAQQVEKVA EF   A +K AC YGGA R  Q+ QL + PEVVIATPGRL+DFL  K TNLRRCTYLV+DEADRMLDMGFEP +R+I+SQVRPDRQTLMWSATWP EV++LA DFL  +VQIN+GS  L AN +IKQ VE++ E +K +RL+ +L +  + +S++F ET++K D+LC  +  +G    AMHG+K QRERE VL DFR G+  +L+ATD+ASRGL
Sbjct:    3 QKLRPVDWKNERLVKFEKEFYRESSSVRKRSSAEIKQFRKDSKITTEGEDVPRPIFKFSEAGFPKSVMDVIRDNKWKNPTAIQAQGWPIALSGKDVVGIAQTGSGKTAAFLLPAIVHIKAQPSMKRLDGPIALILVTTRELAQQVEKVAREFCSNAGLKCACLYGGAPRVPQLRQLERYPEVVIATPGRLLDFLETKDTNLRRCTYLVVDEADRMLDMGFEPSLRRIISQVRPDRQTLMWSATWPKEVRSLARDFLHKFVQINIGSQDLSANHNIKQIVEVIPESKKYDRLVLLLKEFGKAKSIIFVETRKKADELCYRLYDRGFATAAMHGNKQQREREAVLDDFRRGKVNILVATDIASRGL 366          
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Match: A0A0X3QDI2 (Putative ATP-dependent RNA helicase DDX17 (Fragment) OS=Schistocephalus solidus OX=70667 GN=DDX17 PE=4 SV=1)

HSP 1 Score: 468.774 bits (1205), Expect = 5.507e-146
Identity = 230/368 (62.50%), Postives = 289/368 (78.53%), Query Frame = 2
Query:   86 KLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            KL+P DW + +L+KFEK FY+E S VR R+ +E+++FRK++ IT  GE+VP P+  F E  FP  +M+ I+DN+W  PTAIQ+QGWP+ALSG DVVGIAQTGSGKTA+FLLPAIVHI+AQP ++  DGPI LILV TRELAQQVEKVA EF   A +K AC YGGA R  Q+ QL + PEVVIATPGRL+DFL  K TNLRRCTYLV+DEADRMLDMGFEP +R+I+SQVRPDRQTLMWSATWP EV++LA DFL  +VQIN+GS  L AN +IKQ VE++ E +K +RL+ +L +  + +S++F ET++K D+LC  +  +G    AMHG+K QRERE VL DFR G+  +L+ATD+ASRGLDIQ +
Sbjct:    4 KLRPVDWKNERLVKFEKEFYRESSSVRKRSSAEIKQFRKDSKITTEGEDVPRPIFKFSEAGFPKSVMDVIRDNKWKNPTAIQAQGWPIALSGKDVVGIAQTGSGKTAAFLLPAIVHIKAQPSMKRLDGPIALILVTTRELAQQVEKVAREFCSNAGLKCACLYGGAPRVPQLRQLERYPEVVIATPGRLLDFLETKDTNLRRCTYLVVDEADRMLDMGFEPSLRRIISQVRPDRQTLMWSATWPKEVRSLARDFLHKFVQINIGSQDLSANHNIKQIVEVIPESKKYDRLVLLLKEFGKAKSIIFVETRKKADELCYRLYDRGFATAAMHGNKQQREREAVLDDFRRGKVNILVATDIASRGLDIQDI 371          
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Match: A0A430QNF2 (ATP-dependent RNA helicase DDX17 OS=Schistosoma bovis OX=6184 GN=DC041_0008513 PE=4 SV=1)

HSP 1 Score: 466.077 bits (1198), Expect = 2.537e-144
Identity = 232/367 (63.22%), Postives = 282/367 (76.84%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            L+  DW+   L KFEK FY E S VR+R+  +VE+FR ++ +T++G NVP P+  F E  FP++IM+ IK ++W  PT IQ QGWP+ALSG D+VGIAQTGSGKTASFLLPAIVH +AQP ++ GDGPI LILVPTRELAQQVEKVA +F   A  K AC YGGASR  Q   L ++PEVVIATPGRL+DFL  + TN+RRCTYLVLDEADRMLDMGFEP IR++VSQVRPDRQTLMWSATWP EV+ LA DFL +Y+QINVGS  L AN +I+Q VEIL+E EK +RL+ +L      R LVF+ETK++ D+LC+ +  KG D  AMHGDK Q+ER++ L  FR+G   VL+ATDVASRGLDI  V
Sbjct:   24 LRSVDWSAYTLAKFEKKFYHECSSVRDRSRRDVEEFRSKHKVTVLGHNVPRPLFKFSEAGFPSYIMSVIKKSKWDSPTPIQCQGWPVALSGRDLVGIAQTGSGKTASFLLPAIVHAKAQPSLKRGDGPIVLILVPTRELAQQVEKVAEDFCYSAGFKSACLYGGASRTGQAEALGQSPEVVIATPGRLLDFLESRHTNMRRCTYLVLDEADRMLDMGFEPSIRRVVSQVRPDRQTLMWSATWPREVKALAEDFLYDYIQINVGSTKLSANHNIRQHVEILNESEKFKRLLSLLNSFDNARVLVFTETKKRTDELCQKLQDKGFDATAMHGDKHQKERDRALDMFREGHISVLVATDVASRGLDINDV 390          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103046784])

HSP 1 Score: 424.476 bits (1090), Expect = 1.248e-137
Identity = 214/383 (55.87%), Postives = 271/383 (70.76%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRH 1204
            K G    +L+   WN  +L KFEKNFYKE   +  R++ EVE++R+   +T+ G + P PV+ F E  FPN++M  I    W +PT IQ+QGWP+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+   +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK YVQIN+G+L L AN +I Q V      ++ +K  RL+E +   K  ++++F ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGL    V   RH
Sbjct:   33 KFGNPGERLRKRHWNLDELPKFEKNFYKEHPDITRRSMQEVEQYRRAKEVTVKGRDCPKPVMKFNEATFPNYVMEVINKQAWSEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINIGALQLSANHNILQIVDVCNDGEKDDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKYGKACILIATDVASRGLGGVFVAGPRH 415          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103046784])

HSP 1 Score: 426.402 bits (1095), Expect = 7.866e-136
Identity = 213/378 (56.35%), Postives = 272/378 (71.96%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   WN  +L KFEKNFYKE   +  R++ EVE++R+   +T+ G + P PV+ F E  FPN++M  I    W +PT IQ+QGWP+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+   +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK YVQIN+G+L L AN +I Q V      ++ +K  RL+E +   K  ++++F ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   33 KFGNPGERLRKRHWNLDELPKFEKNFYKEHPDITRRSMQEVEQYRRAKEVTVKGRDCPKPVMKFNEATFPNYVMEVINKQAWSEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINIGALQLSANHNILQIVDVCNDGEKDDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKYGKACILIATDVASRGLDVEDV 410          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Match: ddx5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:103024726])

HSP 1 Score: 425.246 bits (1092), Expect = 1.866e-135
Identity = 214/371 (57.68%), Postives = 268/371 (72.24%), Query Frame = 2
Query:   86 KLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            +L+   WN  +L KFEKNFY+E   V  R   EVE++R+   IT+ G   P PV+ F E  FP+++M+ I    W  PT IQ+QGWP+ALSG D+VGIAQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+   +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK YVQINVG+L L AN +I Q V      ++++K  RL+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   42 RLRKKHWNLDELPKFEKNFYQEHPDVGRRTPQEVEQYRRSKEITVKGRECPKPVMRFHESNFPSYVMDVISKQNWTDPTPIQAQGWPLALSGQDMVGIAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINVGALQLSANHNILQIVDVCNDGEKEDKLLRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDV 412          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:103021425])

HSP 1 Score: 291.197 bits (744), Expect = 1.520e-84
Identity = 174/395 (44.05%), Postives = 239/395 (60.51%), Query Frame = 2
Query:  104 WNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITII-----GEN--VPNPVLCFEEV--QFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQP-PVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNK-RKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRHIYGTKLTCP*MVYVSRV 1255
            W D+  +K  KNFY E   V  R+  E+  +RKENN   +     GE   +P PV  F E    +P  IM  I    + KPT IQSQ WP+ L G D++GIAQTG+GKT ++LLP  +H++ QP P     GP  L+L PTRELA Q+E    ++S Y   K  C YGG  R +QI  +    ++VIATPGRL D   +++ NLR  TYLVLDEADRMLDMGFEP I KI+  +RPDRQT+M SATWP  V+ LA  +LK+ + + VG+L L A   ++Q V  + E+EK+  + + + + +   + L+F   K   DDL   +  +GI   ++HGD+ Q +RE+ LQDF+DGR  +L+ATD+ASRGLD+  +T   H++          YV RV
Sbjct:  231 WQDLPPLK--KNFYIEDEAVARRSAEEITVWRKENNNIFVDDLKEGEKRVIPYPVYTFLEAFQHYPE-IMENIHRVGFQKPTPIQSQAWPVVLKGLDLIGIAQTGTGKTLAYLLPGFIHMDEQPVPRNKQSGPGMLVLTPTRELALQIEVECNKYS-YKGFKSICVYGGGDRRAQIKMVTSGVDIVIATPGRLNDLQMNELINLRSITYLVLDEADRMLDMGFEPQIMKIILDIRPDRQTVMTSATWPAGVRRLARSYLKDPMMVYVGTLDLAAVNTVQQTVLFVQEEEKKAYVFDFIHNMEPLDKVLIFVGKKIVADDLSSDLCLRGIAVQSLHGDREQCDREEALQDFKDGRVRILVATDLASRGLDVHDIT---HVFNYDFPRNIEEYVHRV 618          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Match: ddx43 (DEAD-box helicase 43 [Source:NCBI gene;Acc:103021425])

HSP 1 Score: 286.189 bits (731), Expect = 6.076e-84
Identity = 172/402 (42.79%), Postives = 230/402 (57.21%), Query Frame = 2
Query:  104 WNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITII-----GEN--VPNPVLCFEEV--QFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQP-PVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRHIYGTKLTCP*MVYVSRV-RAYLCAP 1276
            W D+  +K  KNFY E   V  R+  E+  +RKENN   +     GE   +P PV  F E    +P  IM  I    + KPT IQSQ WP+ L G D++GIAQTG+GKT ++LLP  +H++ QP P     GP  L+L PTRELA Q+E    ++S Y   K  C YGG  R +QI  +    ++VIATPGRL D   +++ NLR  TYLVLDEADRMLDMGFEP I KI+  +RPDRQT+M SATWP  V+ LA  +LK+ + + VG+L L  + D+   +   +                  R L+        DDL   +  +GI   ++HGD+ Q +RE+ LQDF+DGR  +L+ATD+ASRGLD+  +T   H++          YV RV R  LC P
Sbjct:  199 WQDLPPLK--KNFYIEDEAVARRSAEEITVWRKENNNIFVDDLKEGEKRVIPYPVYTFLEAFQHYPE-IMENIHRVGFQKPTPIQSQAWPVVLKGLDLIGIAQTGTGKTLAYLLPGFIHMDEQPVPRNKQSGPGMLVLTPTRELALQIEVECNKYS-YKGFKSICVYGGGDRRAQIKMVTSGVDIVIATPGRLNDLQMNELINLRSITYLVLDEADRMLDMGFEPQIMKIILDIRPDRQTVMTSATWPAGVRRLARSYLKDPMMVYVGTLDLAVSWDMFNVLSWENFL----------------RPLM-------ADDLSSDLCLRGIAVQSLHGDREQCDREEALQDFKDGRVRILVATDLASRGLDVHDIT---HVFNYDFPRNIEEYVHRVGRTGLCLP 570          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Match: ddx42 (DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFIN;Acc:ZDB-GENE-050706-53])

HSP 1 Score: 263.848 bits (673), Expect = 2.619e-75
Identity = 148/370 (40.00%), Postives = 211/370 (57.03%), Query Frame = 2
Query:  101 DWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDN-----KRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTT 1195
            D ++I+   F+KNFY E   + +   SE  + + +    + G   P P   F    F   ++N I+ + + +PT IQ QG P+ALSG D++GIA+TGSGKTASF+ P +VHI AQ  ++ GDGPI LI VPTREL QQ+      F +   +     YGG S   Q   L +  E+V+ TPGRLID +  K TNL+R TYLV DEADRM DMGFE  +R I + VRPDRQT+++SAT+   V+ LA D L + +++  G +   AN D+ Q    ++           LC +          L+F   K   ++L   + ++G     +HGD  Q ER KV+ DF+     +++ATDVA+RGLDI ++ T
Sbjct:  204 DHSEIEYEPFDKNFYVEHEEISSLGASEAHELKAQ----VSGAAPPKPCSSFGHFGFDEQLLNLIRKSEFTQPTPIQCQGIPIALSGRDIIGIAKTGSGKTASFIWPMLVHIMAQKELKPGDGPIGLICVPTRELCQQINVECKRFGKAYNLHSVAVYGGGSMWEQAKALQEGAEIVVCTPGRLIDHVKKKATNLQRVTYLVFDEADRMFDMGFEYQVRSIANHVRPDRQTMLYSATFRMRVEKLARDILIDPIRVVQGDIG-EANEDVTQ---RVEIFSNGAAKWNWLCSHLVEFTSSGSVLIFVTRKDNSEELSNDLEQEGFQVGLLHGDMDQSERNKVISDFKKKVIPIMVATDVAARGLDIPSIKT 565          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Match: ddx46 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:NCBI gene;Acc:321948])

HSP 1 Score: 268.855 bits (686), Expect = 2.665e-75
Identity = 140/366 (38.25%), Postives = 226/366 (61.75%), Query Frame = 2
Query:  101 DWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKE-NNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFL---NDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRS-LVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQ 1183
            D + I    F +NFY E+  +      EV  +R E   + + G+  P P+  + +      I+N +K   + KPT IQ+Q  P  +SG D++GIA+TGSGKT  FLLP   H+  Q P++ G+GPI +I+ PTRELA Q+ K   +F++   +++ C YGG   + QI +L +  E+++ TPGR+ID L   + ++TN RR TY+VLDEADRM DMGFEP + +I+   RPDRQT+M+SAT+P  ++ LA   L   V++ VG   +  + D++Q V +++E  K  +L+E+L   + K + +VF + +   D L + +++    C+++HG   Q +R+ ++ DF+ G C +++AT VA+RGLD++
Sbjct:  319 DHSKIAYEPFRRNFYVEVPELAKMTAEEVSAYRLEMEGVMVKGKGCPKPIKTWVQCGISMKILNTLKKQNYEKPTPIQAQAIPAIMSGRDLIGIAKTGSGKTIGFLLPMFRHVMDQRPLEEGEGPIGVIMTPTRELALQIAKECRKFTKQLALRVVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLAANSGRVTNFRRATYMVLDEADRMFDMGFEPQVMRIIETSRPDRQTVMFSATFPRAMEALARRILNKPVEVQVGGRSVVCS-DVEQHVIVIEEDTKFYKLLELLGLYQEKGAVIVFVDKQEHADTLLKDLMKASYPCLSLHGGIDQYDRDSIINDFKSGVCRLMVATSVAARGLDVK 683          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003898.1 (pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 gene:ENSPMAG00000003524.1 transcript:ENSPMAT00000003898.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 236.498 bits (602), Expect = 1.327e-67
Identity = 141/376 (37.50%), Postives = 211/376 (56.12%), Query Frame = 2
Query:  194 FRKENNITI--IGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPV----------------QSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQ----VRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRHIYGTKLTCP*MVYVSRV 1255
            F K ++I +   G + P  +  F E++    IM+++   R+ +PT +Q    P+  +  D++  AQTGSGKTA+FLLP +  I +  P                 Q    P+ L+L PTRELA Q+   A +F+  + ++    YGGA   +Q+ +L K   +++ATPGRL+D +      L  C YLVLDEADRMLDMGFEP IR+IV Q     + DRQTLM+SAT+P E+Q LA DFL++Y+ + VG +   +    ++ V + +  ++   L  +    +   +LVF ETK+  D L   +  +G  C ++HGD+ QR+RE+ L  FR GR  +L+AT VA+RGLDI  V   +H+    L      YV R+
Sbjct:   39 FEKYDDIPVEATGNDCPPHIESFHELELGEIIMSSVTLCRYERPTPVQKYAIPIIKAKRDLMACAQTGSGKTAAFLLPILSQIYSGGPGKVVEDTKNQQETVKYGQRKQYPMSLVLAPTRELALQIYDEARKFAYRSCVRPCVVYGGADIGNQVRELQKGCHLLVATPGRLVDMMERGKVGLDHCRYLVLDEADRMLDMGFEPQIRRIVEQDVMPTKGDRQTLMFSATFPKEIQILARDFLEDYIFLAVGRVGSASENITQKVVWVEEMDKRSFLLDLLNATGRDSLTLVFVETKKGADALQGFLCSEGYSCTSIHGDRSQRDREEALSLFRTGRRPILVATAVAARGLDIPNV---KHVINFDLPSDIEEYVHRI 411          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Match: ddx23 (DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:ZFIN;Acc:ZDB-GENE-030131-6215])

HSP 1 Score: 229.18 bits (583), Expect = 2.108e-63
Identity = 142/365 (38.90%), Postives = 209/365 (57.26%), Query Frame = 2
Query:  194 FRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQ----SGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKI-----VSQVRPD---------------------RQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANP--DIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVT 1192
            FR++ NIT  G  +PNP+  ++E   P+ I   I+   +  PT IQ Q  P+ L   D++GIA+TGSGKTA+FL+P +V I   P +     +  GP  +IL PTRELAQQ+E+  I+F +   I+     GG SR  Q  +L    ++VIATPGRLID L ++   L RCTY+VLDEADRM+DMGFEPD+++I     VS  +PD                     RQT+M++AT P  V+ LA  +L+    + +GS+     P   ++Q+V I+ E EK ++L+E+L        ++F   K+  D L + + + G +   +HG K Q +RE  L + + G   +L+ATDVA RG+DI  V+
Sbjct:  302 FREDYNITTKGGKIPNPIRLWKESILPSHIREVIEKCGYKDPTPIQRQAIPIGLQNRDIIGIAETGSGKTAAFLIPLLVWITTLPKIDRIEDTDQGPYAVILAPTRELAQQIEEETIKFGKPLGIRTVAVIGGISREDQGFRLRMGCKIVIATPGRLIDVLENRYLVLSRCTYVVLDEADRMIDMGFEPDVQRILEHMPVSNQKPDTDDAEDPDKMTANFESGRHKYRQTVMFTATMPAAVERLARSYLRRPAVVYIGSV---GKPIERVEQRVFIMGESEKRKKLLELLSRGFEPPIIIFVNQKKGCDVLAKSLEKMGFNACTLHGGKGQEQREFALSNLKAGAKDILVATDVAGRGIDIHDVS 663          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006773.1 (pep scaffold:Pmarinus_7.0:GL491147:244:6091:-1 gene:ENSPMAG00000006112.1 transcript:ENSPMAT00000006773.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 216.083 bits (549), Expect = 3.876e-63
Identity = 126/272 (46.32%), Postives = 166/272 (61.03%), Query Frame = 2
Query:  104 WNDIQLMKFEKNFYKEI-SVVRNRNVSEVEKFRKENNITII------GENVPNPVLCFEEV--QFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQP-PVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYL 889
            WND   +K  KNFY E  SV R      +   +  NNI+++      G ++PNPV  F +    FP+ + N  +   +  P+ IQSQ WP+ L G D+VGIAQTG+GKT +FL P  +H+  QP P +  +GP  LIL PTRELA Q++    ++S Y  I   C YGG +R  QI    +  ++VIATPGRL D + +   ++R  TYLVLDEAD MLD+GFEP I KI+  VRPDRQT M SATWP  V+ LA  +LK+ V + VGSL L
Sbjct:   44 WNDCPPIK--KNFYFESPSVTRMEPWPLLATRKSNNNISVVDMCEEGGRSIPNPVRTFADAFEHFPDILDNICRAG-FTTPSPIQSQAWPVVLLGWDLVGIAQTGTGKTLAFLFPGFIHLTLQPIPREQREGPGMLILTPTRELALQIKSECSKYS-YQGITSVCIYGGGNRREQIDIATRGVDIVIATPGRLNDLMMNGHISMRGITYLVLDEAD-MLDLGFEPQIMKILLDVRPDRQTTMTSATWPPGVRRLARSYLKDPVLVYVGSLNL 310          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Match: DBP2 (ATP-dependent RNA helicase of the DEAD-box protein family; has strong preference for dsRNA; interacts with YRA1; required for assembly of Yra1p, Nab2p and Mex67p onto mRNA and formation of nuclear mRNP; involved in mRNA decay and rRNA processing; may be involved in suppression of transcription from cryptic initiation sites [Source:SGD;Acc:S000005056])

HSP 1 Score: 395.201 bits (1014), Expect = 5.570e-126
Identity = 195/374 (52.14%), Postives = 262/374 (70.05%), Query Frame = 2
Query:   86 KLKPPDWND--IQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQ----XXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            +L  P+W++   +L  FEKNFY E   VR+R+ SE+ +FRKEN +TI G ++P P+  F+E  FP++++N +K   + KPT IQ QGWPMALSG D+VGIA TGSGKT S+ LP IVHI AQP +  GDGPI L+L PTRELA Q++    +F   ++I+  C YGG  ++ QI  L++  E+VIATPGRLID L    TNL+R TYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA+D+L + +Q+ VGSL L A+ +I Q      +        + L     DN+ K +L+F+ TKR  DD+ + +   G   +A+HGDK QRER+ VLQ+FR+GR  +++ATDVA+RG+D++ +
Sbjct:   57 ELIKPNWDEELPKLPTFEKNFYVEHESVRDRSDSEIAQFRKENEMTISGHDIPKPITTFDEAGFPDYVLNEVKAEGFDKPTGIQCQGWPMALSGRDMVGIAATGSGKTLSYCLPGIVHINAQPLLAPGDGPIVLVLAPTRELAVQIQTECSKFGHSSRIRNTCVYGGVPKSQQIRDLSRGSEIVIATPGRLIDMLEIGKTNLKRVTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVKQLAADYLNDPIQVQVGSLELSASHNITQIVEVVSDFEKRDRLNKYLETASQDNEYK-TLIFASTKRMCDDITKYLREDGWPALAIHGDKDQRERDWVLQEFRNGRSPIMVATDVAARGIDVKGI 429          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Match: DBP3 (RNA-Dependent ATPase, member of DExD/H-box family; involved in cleavage of site A3 within the ITS1 spacer during rRNA processing; not essential for growth, but deletion causes severe slow-growth phenotype [Source:SGD;Acc:S000003046])

HSP 1 Score: 228.794 bits (582), Expect = 2.771e-65
Identity = 153/414 (36.96%), Postives = 231/414 (55.80%), Query Frame = 2
Query:  140 FYKEISVVRNRNVSEVEKFRKENNITIIG--ENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPD-RQTLMWSATWPNEVQNLASDFLKNYVQINVGSL-YLHANPDIKQXXXX-----XXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRHIYGTKLTCP*MV--YVSRV----RAYLCAPTR*FLTR-----AGGVVSFI 1321
            FY +   + +   S+++++ KEN I +    +    P+L F+ +   + I   I  +++ KPT IQ+  WP  LSG DVVG+A+TGSGKT +F +PAI H+      Q   G   L++ PTRELA Q+    I  ++   ++  C YGG  ++ Q  QL K+ +VV+ATPGRL+D L +   +L +  YLVLDEADRML+ GFE DI+ I+ +     RQTLM++ATWP EV+ LAS F+ N +++++G+   L AN  I Q VE+      + K  E          K ++ L+F+  K++   + R +   G +  A+HGD  Q++R + L +F+ G+  +L+ATDVA+RGLDI  V T        LT P  V  YV R+    RA          T      AGG+V+ +
Sbjct:   76 FYVQSEALTSLPQSDIDEYFKENEIAVEDSLDLALRPLLSFDYLSLDSSIQAEI--SKFPKPTPIQAVAWPYLLSGKDVVGVAETGSGKTFAFGVPAISHLMND---QKKRGIQVLVISPTRELASQIYDNLIVLTDKVGMQCCCVYGGVPKDEQRIQLKKS-QVVVATPGRLLDLLQEGSVDLSQVNYLVLDEADRMLEKGFEEDIKNIIRETDASKRQTLMFTATWPKEVRELASTFMNNPIKVSIGNTDQLTANKRITQIVEVVDPRGKERKLLELLKKYHSGPKKNEKVLIFALYKKEAARVERNLKYNGYNVAAIHGDLSQQQRTQALNEFKSGKSNLLLATDVAARGLDIPNVKTV-----INLTFPLTVEDYVHRIGRTGRAGQTGTAHTLFTEQEKHLAGGLVNVL 478          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Match: DBP1 (Putative ATP-dependent RNA helicase of the DEAD-box protein family; mutants show reduced stability of the 40S ribosomal subunit scanning through 5' untranslated regions of mRNAs; protein abundance increases in response to DNA replication stress; DBP1 has a paralog, DED1, that arose from the whole genome duplication [Source:SGD;Acc:S000006040])

HSP 1 Score: 224.942 bits (572), Expect = 4.453e-63
Identity = 140/371 (37.74%), Postives = 209/371 (56.33%), Query Frame = 2
Query:  191 KFRKENNITI--IGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHI----------EAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVR----PDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRHIYGTKLTCP*MVYVSRV 1255
            KF   +NI +   G++VP P+L F        +M  IK   + KPT +Q    P+   G D++  AQTGSGKT  FL P    +          +AQ        P  L+L PTRELA Q+ + A +F+  + ++    YGGA   +Q+ ++++  ++++ATPGRL D L     +L    YLVLDEADRMLDMGFEP IR IV +       +RQTLM+SAT+P ++Q+LA DFL NY+ ++VG +    + +I Q++  +D+ +K+  L+++L    +  +L+F ETKR  D L   ++ +     A+HGD+ Q ERE+ L  F+     +L+AT VA+RGLDI  VT   H+    L      YV R+
Sbjct:  133 KFDNYDNIPVDASGKDVPEPILDFSSPPLDELLMENIKLASFTKPTPVQKYSIPIVTKGRDLMACAQTGSGKTGGFLFPLFTELFRSGPSPVPEKAQSFYSRKGYPSALVLAPTRELATQIFEEARKFTYRSWVRPCVVYGGAPIGNQMREVDRGCDLLVATPGRLNDLLERGKVSLANIKYLVLDEADRMLDMGFEPQIRHIVEECDMPSVENRQTLMFSATFPVDIQHLARDFLDNYIFLSVGRVG-STSENITQRILYVDDMDKKSALLDLLSAEHKGLTLIFVETKRMADQLTDFLIMQNFKATAIHGDRTQAERERALSAFKANVADILVATAVAARGLDIPNVT---HVINYDLPSDIDDYVHRI 499          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Match: DED1 (ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helicase; required for translation initiation of all yeast mRNAs; binds to mRNA cap-associated factors, and binding stimulates Ded1p RNA-dependent ATPase activity; mutation in human homolog DBY is associated with male infertility; human homolog DDX3X complements ded1 null mutation; DED1 has a paralog, DBP1, that arose from the whole genome duplication [Source:SGD;Acc:S000005730])

HSP 1 Score: 224.172 bits (570), Expect = 5.292e-63
Identity = 138/358 (38.55%), Postives = 204/358 (56.98%), Query Frame = 2
Query:  224 GENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHI-----EAQPPVQSG-----DGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVS--QVRP--DRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRHIYGTKLTCP*MVYVSRV 1255
            G++VP P+  F        ++  IK  R+ KPT +Q    P+  +G D++  AQTGSGKT  FL P +          QP  Q         P  +I+ PTRELA Q+   A +F+  + +K    YGG+   +Q+ ++ +  ++++ATPGRL D L     +L    YLVLDEADRMLDMGFEP IR IV    + P  +RQTLM+SAT+P ++Q+LA DFL +Y+ ++VG +    + +I QKV  ++ ++K+  L+++L  +    +L+F ETKR  D L   ++ +     A+HGD+ Q ERE+ L  FR G   +L+AT VA+RGLDI  VT   H+    L      YV R+
Sbjct:  134 GKDVPEPITEFTSPPLDGLLLENIKLARFTKPTPVQKYSVPIVANGRDLMACAQTGSGKTGGFLFPVLSESFKTGPSPQPESQGSFYQRKAYPTAVIMAPTRELATQIFDEAKKFTYRSWVKACVVYGGSPIGNQLREIERGCDLLVATPGRLNDLLERGKISLANVKYLVLDEADRMLDMGFEPQIRHIVEDCDMTPVGERQTLMFSATFPADIQHLARDFLSDYIFLSVGRVG-STSENITQKVLYVENQDKKSALLDLLSASTDGLTLIFVETKRMADQLTDFLIMQNFRATAIHGDRTQSERERALAAFRSGAATLLVATAVAARGLDIPNVT---HVINYDLPSDVDDYVHRI 487          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Match: PRP5 (RNA helicase in the DEAD-box family; necessary for prespliceosome formation, bridges U1 and U2 snRNPs and enables stable U2 snRNP association with intron RNA [Source:SGD;Acc:S000000441])

HSP 1 Score: 217.238 bits (552), Expect = 5.458e-59
Identity = 141/390 (36.15%), Postives = 219/390 (56.15%), Query Frame = 2
Query:  116 QLMKFEKNFYKEISVVRNRNVSEVEKFRKE-NNITIIGENVPNPVLCFEEVQFPNFIMNAIKDN-RWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGD-GPICLILVPTRELAQQVEKVAIEFSEY-AKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFL--ND-KITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVD--------------------DLCRIIVRK----GIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVT 1192
            +L  F+KNFY E   V + +  EVE+ R   +NI I G   P PV  + ++      M  I +   +   T IQSQ  P  +SG DV+GI++TGSGKT S+LLP +  ++AQ P+   + GP+ LIL PTRELA Q+ +   +F+E    I+  CC GG+    QI  L +  E+V+ATPGR ID L  ND K+ + +R T++V+DEADR+ D+GFEP I +I+  VRPD+Q +++SAT+PN++++ A   L + + I + S  +  N ++KQK  I   ++++   +  L     +RS  F E + + D                    ++C  I +K    GI   A+H  K  +ER   L+ F+  +  +L+ T+V SRGL++  V+
Sbjct:  210 ELEPFQKNFYIESETVSSMSEMEVEELRLSLDNIKIKGTGCPKPVTKWSQLGLSTDTMVLITEKLHFGSLTPIQSQALPAIMSGRDVIGISKTGSGKTISYLLPLLRQVKAQRPLSKHETGPMGLILAPTRELALQIHEEVTKFTEADTSIRSVCCTGGSEMKKQITDLKRGTEIVVATPGRFIDILTLNDGKLLSTKRITFVVMDEADRLFDLGFEPQITQIMKTVRPDKQCVLFSATFPNKLRSFAVRVLHSPISITINSKGM-VNENVKQKFRICHSEDEKFDNLVQLI---HERSEFFDEVQSENDGQSSDVEEVDAKAIIFVSSQNICDFISKKLLNAGIVTCAIHAGKPYQERLMNLEKFKREKNSILLCTEVLSRGLNVPEVS 595          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Match: EDO38061 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SDX5])

HSP 1 Score: 410.994 bits (1055), Expect = 8.126e-133
Identity = 206/370 (55.68%), Postives = 262/370 (70.81%), Query Frame = 2
Query:   89 LKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            L+ P W+   L KFEKNFY+E  VV+ R   EV+ +R+  ++T+ G NVP PV  FEE  FP++I +  K   + +PT IQ+QGWP+AL+G ++VGIAQTGSGKT SF+LP IVHI  QP +Q GDGPI L+L PTRELAQQV++VA    ++ K++  C YGGA +  QI +L +  E+ IATPGRLID L  + TNLRRCTYLVLDEADRMLDMGFEP IR I+ Q+RPDRQTLMWSATWP EVQ LA DFL +YV I VGSL L AN  I Q V   E  +++ K  +L+E +   K  ++L+F+ETKR+ D+L R +   G   M +HGDK Q ER+ VL +FR G   +L+ATDVASRGLDI  +
Sbjct:    5 LRKPRWDMNSLQKFEKNFYREHPVVQARGQHEVDAYRRSKDLTVNGRNVPKPVTTFEESAFPDYIQSYFKREGFTEPTMIQAQGWPVALTGRNLVGIAQTGSGKTLSFILPGIVHINHQPLLQPGDGPIVLVLCPTRELAQQVQEVAYSVGKHCKLRSTCIYGGAPKGPQIRELERGVEICIATPGRLIDMLESRKTNLRRCTYLVLDEADRMLDMGFEPQIRTIIDQIRPDRQTLMWSATWPKEVQGLAHDFLSDYVHITVGSLGLTANHKILQIVDVCEDHEKEHKLLKLLEEIMGEKENKTLIFTETKRRADELTRKLRSDGWPAMCIHGDKAQPERDWVLSEFRKGHAPILVATDVASRGLDISDI 374          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Match: EDO43557 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY08])

HSP 1 Score: 280.026 bits (715), Expect = 3.490e-83
Identity = 153/367 (41.69%), Postives = 216/367 (58.86%), Query Frame = 2
Query:  101 DWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXX--XXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTT 1195
            D ++I    F KNFY+E   +  ++  E++  RK+  I + G     P + F    F   +M +I+   + +PT IQ Q  P+ALSG D++GIA+TGSGKTA+FL PA+VHI  QP +Q GDGPI LI  PTREL QQ+   A  F +   I +   +GG ++  Q   L +  E+V+ATPGRLID +  K TNL R TYLV DEADRM DMGFEP +R I + VRPDRQTL++SAT+  +V++L  D L + V++ +G L   AN D+ Q V I +    +       ++        L+F   K   ++L   + +   +   +HGD  Q ER KVL  F+     +L+ATDVA+RGLDI ++ T
Sbjct:   57 DHSEIDYKPFNKNFYEEHPEITKQSKQEIDDLRKKMGIKVSGAMPARPCISFAHFGFDEQMMASIRKLEYTQPTQIQCQALPIALSGRDIIGIAKTGSGKTAAFLWPALVHIMDQPELQVGDGPIVLICAPTRELCQQIYTEARRFGKAYNIHVVAVFGGGNKYEQSKALQEGAEIVVATPGRLIDHVKAKATNLHRVTYLVFDEADRMFDMGFEPQVRSIANNVRPDRQTLLFSATFKKKVEHLCRDILVDPVRVVIGELG-EANEDVTQIVHIFNSMPSKWEWLTQNLVSFASAGSVLIFVTKKLNSEELATNLRKNDFEVALLHGDMDQFERSKVLGQFKKREIPILVATDVAARGLDIPSIKT 422          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Match: EDO39699 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9G4])

HSP 1 Score: 268.085 bits (684), Expect = 6.983e-80
Identity = 176/402 (43.78%), Postives = 241/402 (59.95%), Query Frame = 2
Query:  206 NNITI--IGENV-----PNPVLCFEEV--QFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPV-QSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLV-----------LDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNK-RKRSLVFSETKRKVDDLCRIIVRKGIDCM-AMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTT------KRHIYGTKLTCP*MVYVSRVRAY-LCAPTR*FLTRAGGVVSFI 1321
            NNI +   GE V     PNPV  FEE   Q+P  I+  IK   ++KP+ IQ Q WP+ +SG D++GIAQTG+GKT +FLLPA +HI+ Q    +   GP  L+L PTRELA Q+E+   ++  Y  I+  C YGG SR  QI  + K  E+VIATPGRL D L   I ++R  TYLV           LDEADRMLDMGFEP+I+KI+  +RPDRQT+M SATWP  VQ +A  ++ + V++ VG L L+A  ++ Q VE +D   K+ER+IE +      ++ L+F   K   DDL   ++  GID +  +HGD+ Q +RE+ L DF+ G   +LIATDVASRGLDI+ +T        RHI      C    Y+++  +   C     F +R+G  ++FI
Sbjct:    2 NNIMVENYGETVQERAIPNPVTKFEEAFEQYPE-ILEEIKKAGFVKPSPIQCQAWPVVMSGMDLIGIAQTGTGKTLAFLLPAFLHIDGQELAREKRGGPSVLVLSPTRELALQIEQEVKKY-HYRGIRSVCIYGGGSRKDQIGVVEKGVEIVIATPGRLNDLLMHDILSVRSVTYLVSMSGHNICSIVLDEADRMLDMGFEPEIKKILLDIRPDRQTVMTSATWPPGVQRMADQYMTDPVRVFVGCLDLNACENVTQLVEEVDGSLKKERVIEFIEGMAPGEKVLIFVGKKVLADDLSSDLMLHGIDGVQCIHGDREQYDREQALDDFKTGLARILIATDVASRGLDIKDITYVINYDFPRHIEEGGGGC----YLTQTLSLSFC-----FSSRSGTSLTFI 392          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Match: EDO42894 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S034])

HSP 1 Score: 277.715 bits (709), Expect = 1.346e-79
Identity = 146/373 (39.14%), Postives = 238/373 (63.81%), Query Frame = 2
Query:   80 ENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKE-NNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFL---NDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRS-LVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQ 1183
            + +L+P D   +    F K+FY E+  +      E ++FR    NI + G+N P PV  + +      I++ +K N + KPT IQ+Q  P+ +SG D++GIA+TGSGKT +FL+P   HI+ QPP++  +GPI +++ PTRELA Q+ +   +F +   ++  C YGG   + QI +L +  E+++ TPGR+ID L   N ++TN +RCTYLVLDEADRM DMGFEP + +I+  +RPDRQT+M+SAT+P +++ LA   L   ++I VG   +  + D++Q V +++E +K  +L+E+L   + + S LVF E +   D L + ++++   C+++HG   Q +R+  + DF++G   ++IAT VA+RGLD++
Sbjct:   80 KKELQPVDHKTVVYQPFRKDFYVEVPELAKMTPEETDEFRLSLENIHVRGKNAPKPVKTWAQTGVQLKILDVLKKNSYEKPTPIQAQAIPVIMSGRDMIGIAKTGSGKTLAFLIPMFRHIKDQPPLEREEGPIAIVMTPTRELAIQIHRECKKFCKPNNLRCVCVYGGTGISEQIAELKRGAEIIVCTPGRMIDMLTANNGRVTNCQRCTYLVLDEADRMFDMGFEPQVMRIIDCIRPDRQTVMFSATFPRQMEALARKILDKPIEIQVGGRSVVCS-DVEQNVVVIEEDDKFLKLLELLGLYQEQGSVLVFVEKQDSADSLFKDLLKRSYPCLSLHGGMDQFDRDSTIADFKNGVTKLMIATSVAARGLDVK 451          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Match: EDO49247 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGX3])

HSP 1 Score: 251.136 bits (640), Expect = 3.577e-73
Identity = 143/343 (41.69%), Postives = 208/343 (60.64%), Query Frame = 2
Query:  182 EVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAI---VHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSE------YAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRS-LVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDI 1180
            ++E+ RK+ +I + G+++P PV  F+E++FP  I+ A+K      PT IQ QG P  L+G D++GIA TGSGKT  F LP I   +  E   P Q  +GP  +I+VP+RELA+Q  +V   FS       +  ++   C GG+S   Q   + +   +V+ATPGRL+D L+ +I  L  C YLVLDEADRM+DMGFE D+R I S  +  RQTL++SAT P ++QN A   L   V +NVG     A+ D+ Q  E+   K++ + +  + C  K     L+F+E K  VDD+   ++ KG++ +A+HGDK Q ER   +++F  G   VL+ATDVAS+GLD 
Sbjct:   25 KIERIRKKWHILVEGDDIPPPVKTFKEMKFPRPILAALKKKGITHPTPIQVQGLPAVLTGRDMIGIAFTGSGKTLVFTLPIIMFSLEQEKAMPFQRNEGPYGMIVVPSRELARQTFEVITHFSRALEAHGFPSLRTNLCIGGSSIKEQSDAMKRGVHMVVATPGRLMDLLDKRIITLDVCRYLVLDEADRMIDMGFEEDVRTIFSYFKSQRQTLLFSATMPKKIQNFAKSALVKPVTVNVGRAGA-ASLDVIQ--EVEYVKQEAKVVYLLECLQKTPPPVLIFAEKKSDVDDIHEYLLLKGVEAVAIHGDKSQEERVHAIREFHQGNKDVLVATDVASKGLDF 364          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Match: ddx5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101160075])

HSP 1 Score: 429.098 bits (1102), Expect = 8.915e-137
Identity = 213/371 (57.41%), Postives = 269/371 (72.51%), Query Frame = 2
Query:   86 KLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            +L+   WN  +L KFEKNFY++ + V  R+  EVE++R+   IT+ G   PNP+  F E  FP+++M  I    W +PT IQ+QGWP+ALSG D+VGIAQTGSGKT S+LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA E+   +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK YVQINVG+L L AN +I Q V      +++ K  RL+E +   K  ++++F ETKR+ DDL R + R G   M +HGDK Q+ER+ VL +F+ G+  +LIATDVASRGLD++ V
Sbjct:   48 RLRKKHWNLDELPKFEKNFYQQHADVARRSPQEVEQYRRTKVITVKGRECPNPITHFHEASFPSYVMEVINKQNWTEPTPIQAQGWPLALSGKDMVGIAQTGSGKTLSYLLPAIVHINHQPFLERGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINVGALQLSANHNILQIVDVCTDGEKENKLVRLLEEIMSEKENKTIIFVETKRRCDDLTRRMRRDGWPAMGIHGDKSQQERDWVLNEFKFGKAPILIATDVASRGLDVEDV 418          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101167926])

HSP 1 Score: 416.387 bits (1069), Expect = 2.316e-134
Identity = 211/383 (55.09%), Postives = 277/383 (72.32%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXX---XXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRH 1204
            K G    +L+   WN  +L KF+KNFY+E   V +R+  E+E++R+   +T+ G + P P++ F E  FP+++M+ I    +  PT IQSQGWP+ALSG D+VGIAQTGSGKT ++LLPAIVHI+ QP ++ GDGPICL+L PTRELAQQV++VA E+   +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK+YVQIN+G+L L AN +I Q V++   +++++K  RL+E +   K  ++++F ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +FR G+  +LIATDVASRGL    V   RH
Sbjct:   39 KFGNPGERLRKKHWNLDELPKFQKNFYQEHPDVTHRSPQEIEQYRRSKEVTVKGRDCPKPMIKFNEASFPSYVMDMIVKQNFTDPTPIQSQGWPVALSGKDMVGIAQTGSGKTLAYLLPAIVHIQHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECNKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYVQINIGALQLSANHNILQIVDVCNDMEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFRYGKAPILIATDVASRGLGGVFVAGTRH 421          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Match: DDX5 (probable ATP-dependent RNA helicase DDX5 [Source:NCBI gene;Acc:101167926])

HSP 1 Score: 420.239 bits (1079), Expect = 1.884e-133
Identity = 210/378 (55.56%), Postives = 276/378 (73.02%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G    +L+   WN  +L KF+KNFY+E   V +R+  E+E++R+   +T+ G + P P++ F E  FP+++M+ I    +  PT IQSQGWP+ALSG D+VGIAQTGSGKT ++LLPAIVHI+ QP ++ GDGPICL+L PTRELAQQV++VA E+   +++K  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK+YVQIN+G+L L AN +I Q V     +++++K  RL+E +   K  ++++F ETKR+ D+L R + R G   M +HGDK Q+ER+ VL +FR G+  +LIATDVASRGLD++ V
Sbjct:   39 KFGNPGERLRKKHWNLDELPKFQKNFYQEHPDVTHRSPQEIEQYRRSKEVTVKGRDCPKPMIKFNEASFPSYVMDMIVKQNFTDPTPIQSQGWPVALSGKDMVGIAQTGSGKTLAYLLPAIVHIQHQPFLEHGDGPICLVLAPTRELAQQVQQVAAEYGRASRLKSTCIYGGAPKGPQIRDLERGVEICIATPGRLIDFLECNKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKDYVQINIGALQLSANHNILQIVDVCNDMEKEDKLIRLLEEIMSEKENKTIIFVETKRRCDELTRRMRRDGWPAMGIHGDKSQQERDWVLNEFRYGKAPILIATDVASRGLDVEDV 416          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Match: si:dkey-156n14.5 (probable ATP-dependent RNA helicase DDX17 [Source:NCBI gene;Acc:101158507])

HSP 1 Score: 415.231 bits (1066), Expect = 2.565e-131
Identity = 210/379 (55.41%), Postives = 271/379 (71.50%), Query Frame = 2
Query:   62 LKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            +K G    +L+   WN  +L KFEKNFY E   V++ +  EVE+FR++  ITI G   P PV  F +  FP ++M+ +    + +PTAIQSQG+P+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP ++ GDGPICL+L PTRELAQQV++VA ++ + ++IK  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFL+ Y+QIN+G+L L AN +I Q V      ++  K  +L+E +   K  ++++F ETK++ DDL R + R G   M +HGDK Q ER+ VL +FR G+  +LIATDVASRGLD++ V
Sbjct:   34 MKFGNPGERLRKKRWNLDELPKFEKNFYIEHPEVQHVSQFEVEEFRRKKEITIRGSGCPKPVTAFHQAHFPQYVMDVLMQQNFKEPTAIQSQGFPVALSGKDMVGIAQTGSGKTLAYLLPAIVHINHQPYLERGDGPICLVLAPTRELAQQVQQVAYDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLEAGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLREYIQINIGALELSANHNILQIVDVCMENEKDNKLLQLMEEIMAEKENKTIIFVETKKRCDDLTRKMRRDGWPAMCIHGDKSQPERDWVLTEFRSGKAPILIATDVASRGLDVEDV 412          
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Match: ENSORLT00000031911.1 (probable ATP-dependent RNA helicase DDX17 [Source:NCBI gene;Acc:101171584])

HSP 1 Score: 414.461 bits (1064), Expect = 3.232e-131
Identity = 209/378 (55.29%), Postives = 271/378 (71.69%), Query Frame = 2
Query:   65 KNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXX---XXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            K G   ++L+   W+  QL KFEKNFY E + V   +  +VE+FR++  IT+ G   P P+  F + QFP ++++ +    + +PTAIQ+QG+P+ALSG D+VGIAQTGSGKT ++LLPAIVHI  QP +  GDGPICL+L PTRELAQQV++VA ++ + ++IK  C YGGA +  QI  L +  E+ IATPGRLIDFL    TNLRRCTYLVLDEADRMLDMGFEP IRKIV Q+RPDRQTLMWSATWP EV+ LA DFLK YVQIN+G+L L AN +I Q V      ++ +K  +L+E +   K  ++++F ETK++ DDL R + R G   M +HGDK Q ER+ VL +FR G+  VLIATDVASRGLD++ V
Sbjct:   32 KFGNPGDRLRRKKWDLDQLPKFEKNFYSEHAEVERMSQFDVEEFRRKKEITVRGSGCPKPLTSFHQAQFPQYVIDVLMQQNFKEPTAIQAQGFPLALSGRDMVGIAQTGSGKTLAYLLPAIVHINHQPYLDRGDGPICLVLAPTRELAQQVQQVACDYGKSSRIKSTCVYGGAPKGPQIRDLERGVEICIATPGRLIDFLESGKTNLRRCTYLVLDEADRMLDMGFEPQIRKIVDQIRPDRQTLMWSATWPKEVRQLAEDFLKEYVQINIGALELSANHNILQIVDVCTESEKDQKLIQLMEEIMAEKENKTIIFVETKKRCDDLTRRMRRDGWPAMCIHGDKSQPERDWVLSEFRSGKAPVLIATDVASRGLDVEDV 409          
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Match: SMESG000012031.1 (SMESG000012031.1)

HSP 1 Score: 774.237 bits (1998), Expect = 0.000e+0
Identity = 404/404 (100.00%), Postives = 404/404 (100.00%), Query Frame = 2
Query:   20 MGRFXXXXXXXXXKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRHIYGTKLTCP 1231
            MGRFSTSSSPSSPKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQKVEILDEKEKEERLIEILCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRHIYGTKLTCP
Sbjct:    1 MGRFSTSSSPSSPKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQKVEILDEKEKEERLIEILCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRHIYGTKLTCP 404          
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Match: SMESG000012031.1 (SMESG000012031.1)

HSP 1 Score: 758.444 bits (1957), Expect = 0.000e+0
Identity = 387/390 (99.23%), Postives = 388/390 (99.49%), Query Frame = 2
Query:   20 MGRFXXXXXXXXXKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            MGRFSTSSSPSSPKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQKVEILDEKEKEERLIEILCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDI  +
Sbjct:    1 MGRFSTSSSPSSPKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQKVEILDEKEKEERLIEILCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIDDI 390          
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Match: SMESG000033916.1 (SMESG000033916.1)

HSP 1 Score: 424.861 bits (1091), Expect = 2.755e-136
Identity = 212/370 (57.30%), Postives = 272/370 (73.51%), Query Frame = 2
Query:   80 ENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            E  L   DWN   L+ FEKNFY+E  VV NR+ SE+E +R+   +T+ G+N+  P+  F E+     IM+ I++N+W +PT IQ+QG PMALSG ++VG+A+TGSGKTAS+L+PAIVH++AQPP++ GDGPICLI+VPTRELAQQV+ VA +F E   I+  C YGGA++  QI QL    E+++ATPGRLID L   ITNL R TY+VLDEADRMLDMGFEP IRKI SQVR DRQTLMWSATWP EVQ LA DFL  Y+Q+N+GS  LHANP+I+Q VEILDE  K++RL+E++    R + +VF+ETK+K D +C  +  K     AMHGDK Q +RE +L  FR     +L+ATDVASRGLD+  +
Sbjct:   77 EQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFNEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRNGAEIIVATPGRLIDLLKSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSKDKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDI 446          
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Match: SMESG000033908.1 (SMESG000033908.1)

HSP 1 Score: 425.246 bits (1092), Expect = 2.866e-136
Identity = 212/370 (57.30%), Postives = 272/370 (73.51%), Query Frame = 2
Query:   80 ENKLKPPDWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            E  L   DWN   L+ FEKNFY+E  VV NR+ SE+E +R+   +T+ G+N+  P+  F E+     IM+ I++N+W +PT IQ+QG PMALSG ++VG+A+TGSGKTAS+L+PAIVH++AQPP++ GDGPICLI+VPTRELAQQV+ VA +F E   I+  C YGGA++  QI QL    E+++ATPGRLID L   ITNL R TY+VLDEADRMLDMGFEP IRKI SQVR DRQTLMWSATWP EVQ LA DFL  Y+Q+N+GS  LHANP+I+Q VEILDE  K++RL+E++    R + +VF+ETK+K D +C  +  K     AMHGDK Q +RE +L  FR     +L+ATDVASRGLD+  +
Sbjct:   83 EQTLNSVDWNSQNLIPFEKNFYRENPVVSNRSSSEIENYRRLKEMTVKGDNINKPIFSFNEIDLSREIMSVIRNNKWNEPTPIQAQGLPMALSGRNLVGVARTGSGKTASYLIPAIVHLKAQPPLRRGDGPICLIVVPTRELAQQVQTVANDFCESVGIRSVCVYGGANKGDQIRQLRSGAEIIVATPGRLIDLLKSSITNLHRTTYVVLDEADRMLDMGFEPQIRKIFSQVRQDRQTLMWSATWPKEVQRLAQDFLGKYIQVNIGSQELHANPNIEQIVEILDEYSKDKRLLEVVSKTPRDKMIVFAETKKKADMICSFLRSKQFRVGAMHGDKSQSDREYILNGFRGENLNILVATDVASRGLDVDDI 452          
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Match: SMESG000005969.1 (SMESG000005969.1)

HSP 1 Score: 425.631 bits (1093), Expect = 6.404e-136
Identity = 209/364 (57.42%), Postives = 273/364 (75.00%), Query Frame = 2
Query:  101 DWNDIQLMKFEKNFYKEISVVRNRNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKPTAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDGPICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLN-KNPEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVSQVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQXXXXXXXXXXXXXXXXXXCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMAMHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAV 1189
            DW  I+LM F+KNFY E  +V  R+  E+++FR E  +T++G+NVP P+  F E+ FPNFI+  I  N+W++PT IQ QGWPMA+SG +VVGIAQTGSGKTA+FLLPA++HI AQPP+ +GDGPICL+LVPTRELAQQVE V  EF       + C YGG+ R +QI  L+ K PE+++ATPGRL+D L    TNLRR TYLVLDEADRMLDMGFEP IR +++QVRPDRQ L+WSATWP EV+ LA DFL  Y+Q+N+G++ LHAN +I Q VE++DE  KE RLIE+L      ++LVF   K++ D +  ++  +    +AMHGDK QRERE+ L++FR+GR  +++ATDVASRGLDI  +
Sbjct:   34 DWPTIRLMPFKKNFYIEHPIVTARSSYEIDRFRNEKEMTVVGKNVPRPIFNFSEMNFPNFILTTILKNKWVRPTPIQCQGWPMAMSGRNVVGIAQTGSGKTAAFLLPALIHIRAQPPLVAGDGPICLVLVPTRELAQQVESVVEEFGISGGFNMVCVYGGSDRQNQIKNLHTKRPEILVATPGRLLDLLKQNETNLRRTTYLVLDEADRMLDMGFEPQIRAVLNQVRPDRQMLLWSATWPLEVRRLAEDFLNEYIQVNIGAMSLHANHNICQYVEVIDEFGKERRLIELLKQFNGLKTLVFVALKKRCDRMSDMLNSRSFKALAMHGDKPQRERERALENFRNGRSNIMVATDVASRGLDIDDI 397          
The following BLAST results are available for this feature:
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX54.555e-13155.50DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX55.679e-13155.50DEAD-box helicase 5 [Source:HGNC Symbol;Acc:HGNC:2... [more]
DDX177.882e-12754.62DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX178.329e-12754.62DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
DDX171.012e-12654.62DEAD-box helicase 17 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx-179.449e-11148.50DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-179.449e-11148.50DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-179.449e-11148.50DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-179.449e-11148.50DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
ddx-179.449e-11148.50DEAD boX helicase homolog [Source:UniProtKB/TrEMB... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rm621.869e-13255.70gene:FBgn0003261 transcript:FBtr0309320[more]
Rm621.031e-13155.91gene:FBgn0003261 transcript:FBtr0301947[more]
Rm621.031e-13155.91gene:FBgn0003261 transcript:FBtr0078650[more]
Rm621.096e-13155.91gene:FBgn0003261 transcript:FBtr0078649[more]
Rm621.096e-13155.91gene:FBgn0003261 transcript:FBtr0078651[more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx52.041e-13756.88DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
ddx53.893e-13656.88DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
ddx56.114e-13556.80DEAD (Asp-Glu-Ala-Asp) box helicase 5 [Source:ZFIN... [more]
si:dkey-156n14.57.118e-13154.96si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
DDX177.118e-13154.96si:dkey-156n14.5 [Source:ZFIN;Acc:ZDB-GENE-030131-... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx177.635e-13054.23DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx171.023e-12954.23DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx171.046e-12954.23DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx172.509e-12950.97DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
ddx172.444e-12854.23DEAD-box helicase 17 [Source:NCBI gene;Acc:549535][more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ddx53.070e-13156.57DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:M... [more]
Ddx51.089e-13055.24DEAD (Asp-Glu-Ala-Asp) box polypeptide 5 [Source:M... [more]
Ddx171.387e-12854.35DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
Ddx172.069e-12854.52DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
Ddx176.922e-12854.62DEAD (Asp-Glu-Ala-Asp) box polypeptide 17 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17844|DDX5_HUMAN2.188e-13055.50Probable ATP-dependent RNA helicase DDX5 OS=Homo s... [more]
sp|Q4R6M5|DDX5_MACFA5.567e-13055.50Probable ATP-dependent RNA helicase DDX5 OS=Macaca... [more]
sp|Q61656|DDX5_MOUSE7.953e-13055.24Probable ATP-dependent RNA helicase DDX5 OS=Mus mu... [more]
sp|A5A6J2|DDX5_PANTR2.200e-12955.50Probable ATP-dependent RNA helicase DDX5 OS=Pan tr... [more]
sp|P19109|DDX17_DROME9.586e-12955.91ATP-dependent RNA helicase p62 OS=Drosophila melan... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448XGE63.406e-15062.78Uncharacterized protein (Fragment) OS=Protopolysto... [more]
A0A183TBL58.080e-14962.33Uncharacterized protein OS=Schistocephalus solidus... [more]
A0A0V0J4X63.972e-14862.36Uncharacterized protein (Fragment) OS=Schistocepha... [more]
A0A0X3QDI25.507e-14662.50Putative ATP-dependent RNA helicase DDX17 (Fragmen... [more]
A0A430QNF22.537e-14463.22ATP-dependent RNA helicase DDX17 OS=Schistosoma bo... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DDX51.248e-13755.87probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
DDX57.866e-13656.35probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ddx51.866e-13557.68probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
ddx431.520e-8444.05DEAD-box helicase 43 [Source:NCBI gene;Acc:1030214... [more]
ddx436.076e-8442.79DEAD-box helicase 43 [Source:NCBI gene;Acc:1030214... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx422.619e-7540.00DEAD (Asp-Glu-Ala-Asp) box helicase 42 [Source:ZFI... [more]
ddx462.665e-7538.25DEAD (Asp-Glu-Ala-Asp) box polypeptide 46 [Source:... [more]
ENSPMAT00000003898.11.327e-6737.50pep scaffold:Pmarinus_7.0:GL481305:13824:21767:-1 ... [more]
ddx232.108e-6338.90DEAD (Asp-Glu-Ala-Asp) box polypeptide 23 [Source:... [more]
ENSPMAT00000006773.13.876e-6346.32pep scaffold:Pmarinus_7.0:GL491147:244:6091:-1 gen... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
DBP25.570e-12652.14ATP-dependent RNA helicase of the DEAD-box protein... [more]
DBP32.771e-6536.96RNA-Dependent ATPase, member of DExD/H-box family;... [more]
DBP14.453e-6337.74Putative ATP-dependent RNA helicase of the DEAD-bo... [more]
DED15.292e-6338.55ATP-dependent DEAD (Asp-Glu-Ala-Asp)-box RNA helic... [more]
PRP55.458e-5936.15RNA helicase in the DEAD-box family; necessary for... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO380618.126e-13355.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO435573.490e-8341.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO396996.983e-8043.78Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428941.346e-7939.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO492473.577e-7341.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ddx58.915e-13757.41probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
DDX52.316e-13455.09probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
DDX51.884e-13355.56probable ATP-dependent RNA helicase DDX5 [Source:N... [more]
si:dkey-156n14.52.565e-13155.41probable ATP-dependent RNA helicase DDX17 [Source:... [more]
ENSORLT00000031911.13.232e-13155.29probable ATP-dependent RNA helicase DDX17 [Source:... [more]
back to top
BLAST of ATP-dependent RNA helicase DBP2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000012031.10.000e+0100.00SMESG000012031.1[more]
SMESG000012031.10.000e+099.23SMESG000012031.1[more]
SMESG000033916.12.755e-13657.30SMESG000033916.1[more]
SMESG000033908.12.866e-13657.30SMESG000033908.1[more]
SMESG000005969.16.404e-13657.42SMESG000005969.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023756 ID=SMED30023756|Name=ATP-dependent RNA helicase DBP2|organism=Schmidtea mediterranea sexual|type=transcript|length=3397bp
CAGGACTTCATATTAATATATGGGTCGTTTTTCTACATCATCTTCACCAT
CCAGTCCAAAACTAAAAAATGGTACTGTTGAAAACAAGCTTAAGCCACCA
GATTGGAATGATATTCAATTGATGAAATTTGAGAAAAATTTCTATAAAGA
AATTTCTGTTGTTAGAAATAGAAATGTTTCGGAAGTTGAAAAATTCAGGA
AAGAAAATAATATAACGATAATAGGTGAAAATGTCCCTAATCCAGTTTTA
TGTTTTGAAGAAGTTCAATTTCCAAATTTTATAATGAATGCAATTAAAGA
TAATAGATGGATTAAGCCGACTGCAATTCAAAGTCAAGGTTGGCCTATGG
CCTTAAGTGGTAGTGATGTAGTTGGAATAGCACAAACAGGATCCGGAAAA
ACCGCTTCCTTCCTGCTCCCCGCTATTGTGCATATAGAAGCACAACCACC
AGTGCAGAGTGGTGATGGTCCAATTTGTTTAATACTAGTTCCTACAAGAG
AACTAGCTCAGCAAGTGGAAAAAGTTGCAATTGAGTTTTCAGAATATGCT
AAAATTAAAATTGCCTGTTGCTATGGTGGTGCTTCGAGAAACAGTCAAAT
ACATCAACTAAACAAGAATCCAGAAGTAGTTATTGCAACTCCAGGGCGTC
TAATCGATTTCCTTAATGATAAAATAACTAATTTGCGACGTTGTACATAT
TTGGTTCTTGATGAAGCTGATCGAATGCTTGATATGGGCTTTGAGCCAGA
TATTCGGAAAATTGTGTCACAAGTGCGTCCAGACAGACAGACGCTTATGT
GGTCAGCAACATGGCCAAACGAAGTACAAAACTTAGCAAGTGATTTCCTG
AAGAATTATGTCCAAATTAATGTCGGATCTCTTTATCTACATGCTAATCC
TGATATTAAACAAAAAGTAGAAATTTTGGACGAAAAGGAAAAAGAAGAAA
GGTTGATTGAAATATTATGTGATAACAAACGAAAAAGATCTTTAGTATTC
TCGGAAACCAAAAGAAAAGTTGATGATCTATGTCGGATTATCGTTAGAAA
AGGAATCGATTGTATGGCAATGCACGGCGATAAAGTTCAAAGAGAAAGAG
AAAAGGTTTTACAAGATTTTCGTGATGGTCGATGCTATGTCTTAATAGCA
ACAGACGTGGCTTCAAGAGGACTCGACATACAAGCCGTTACAACAAAGCG
GCACATTTACGGGACTAAGCTGACATGTCCATAAATGGTCTATGTTAGCC
GTGTGCGCGCATATCTGTGTGCACCAACACGGTAATTTCTCACACGAGCC
GGTGGAGTGGTCTCGTTCATCGTGTTGCTGATAACCACCGAATATGGTTT
GCTGTTGCCAAATAGCTCATCAGCCTCAGAGATTTGTGTCGTCGACCGGG
GTGGTCGATGGAGCCACAGGTTTTGTCACTGGTTTCCCACCAAGAAAGCC
CGTGACACGACATCGCTTCGTGGTTCTGGTGATCACTCGGCGCGACTTCA
ATGACACACAGAAAGACACATAGACAACTGTCCGGTCTCTTATGGGAGTA
CGTGGGTGCGTATTAGAGTAATTGTCTAATCTATCTTCATTGTCATGATA
TGATCATCTTTGACAATTTGGTAACATGATTTCATTATCGTTATTACTAT
TATCATTATCAATATCAATAATTGTGTAGTATTACATTTAATCAGGGCCA
ATGGTTTTCCGCAGTTTCAAAATAATATGTATCACAGATGCTTGAAACTC
TAATTTCCGAGCACTGAAACTGGCAATTGGTATATGAGCATAAAAGGTCC
AAGGAGGCCCTTGCACCCGCATCCTTGAAAATTTTACTTGAATTTGAATA
TTGTATAACATATTTGAATTAAATTTCAGCTTTTCTGCGAGACTGGCAAC
AGTTTTGAGATTTTTTGAATTGTTTATAATAATCTATAAATTTAATTATT
CATAATCAATTATTTTTTATTTGTAAATATACTATATTTATGCTATTTCC
ATTAATATCCATTACAAACAGTCAATTTGTGATCTTTTACAGTAGGACTC
TTGTGATTGCATTTTAATTATTGATTTTCTCATGTTATTTCTCAAAGAAG
CTATAAAGTAATCACAACGATGGTGAAACGTTTTAAACGGTTTCTCTATT
ATAAAAATATTAATAAGAACAAAAATTATATTTAAATCTATCGTAACAAA
TAATAGTAGTTTAGATCTAACCAAATGTCTACTAGAACATATAAATGTAC
CCAACGTTCCTCAGATATCCATATAATAAAGGTGAATGCGCTTATTTCAT
TCAAAACCCGTGAAAGACGGAGAAAAATTATCTGAAATAATGCGAACTGT
AAAATTCCTTATATACATCCGTATGCACTTTTATTGAGCATTTACATTCA
AATTACACAATTCGTAGGTTAAATTAGTAATATAAACAAAAAAGAAATCT
TTAAACTAGAAATAAAAAATATTAGATAAAAAAACTCCGCGTTGTTCTCA
AATGGAGACTTTCCGTTAGTAATTGTTGTTTTTTAGATTCGATTTTTACA
ATATCGCCACCAAGTTGGTATTAGAGATTAGTTAAGTATTAATATAAATA
AATATTATGAGAATTAGGATAGACATAGATATTCTTGTATTTTAACTCTT
TAATGGACAATGACGTGTATACACGTCATACTACTGGGTTCTGTTGGGAC
ATGACGTGTATACACGTCAAAAATTCTACAAATTAAATTATTATAACTTC
ATTATCTTTAAAAATGTGAAAGATATGGCAAGTGACGTTCTGGGAACAGC
AACTTAAAAAGCGCGTCCGCGAAAGGGTTAAAAATAATAATCTTAAACAT
TTATGAAACCGCTCCCAAATGCAAAAAGACAAGACTCTTCCGTCCGAATC
CGAGTAAAATGATGGCTTTGGAAGGAAAAATTCTAGAAATTAAAATCTTA
AAATCATTAAAAAGATATTTAAACTAAGATATCATCCATTACGGACGTCC
CATGGGAAGGGGGAATGGGGTCTTCGCAAAAGGGGTCAAAATTGCTTATT
TTTAAGGACGTCCTTAATGGATGCTCCCTAAATTTAACCCTATTATTGTC
ATGGTACCTGACTAACGTAAACTGTCACAGTCTGAACAACACAGAGAATT
CATGTGTTGTATTGAAAAACAGAAAATGTAGTGCAAATAATGTGTTCAAC
TATTTATCTATACACGTTAGACAAATTAGTTCGAAATTTAATAGTGACCG
ACAGCCACCTCGTGAGGGAACATCCATTAAGGACGTCACTCAAAATAAGC
AATTTTCAATCACCCCTTGTCCATTTACACGAGCACTCCCCTCCGCGGGA
CATCCCTCCAAAAATAGAAATTTAAATAATTTATAACCATATAGACT
back to top

protein sequence of SMED30023756-orf-1

>SMED30023756-orf-1 ID=SMED30023756-orf-1|Name=SMED30023756-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=405bp
MGRFSTSSSPSSPKLKNGTVENKLKPPDWNDIQLMKFEKNFYKEISVVRN
RNVSEVEKFRKENNITIIGENVPNPVLCFEEVQFPNFIMNAIKDNRWIKP
TAIQSQGWPMALSGSDVVGIAQTGSGKTASFLLPAIVHIEAQPPVQSGDG
PICLILVPTRELAQQVEKVAIEFSEYAKIKIACCYGGASRNSQIHQLNKN
PEVVIATPGRLIDFLNDKITNLRRCTYLVLDEADRMLDMGFEPDIRKIVS
QVRPDRQTLMWSATWPNEVQNLASDFLKNYVQINVGSLYLHANPDIKQKV
EILDEKEKEERLIEILCDNKRKRSLVFSETKRKVDDLCRIIVRKGIDCMA
MHGDKVQREREKVLQDFRDGRCYVLIATDVASRGLDIQAVTTKRHIYGTK
LTCP*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003724RNA helicase activity
GO:0003676nucleic acid binding
GO:0005524ATP binding
GO:0000166nucleotide binding
GO:0003723RNA binding
GO:0004004ATP-dependent RNA helicase activity
GO:0004386helicase activity
GO:0008186RNA-dependent ATPase activity
GO:0016787hydrolase activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR001650Helicase_C
IPR014001Helicase_ATP-bd
IPR027417P-loop_NTPase
IPR011545DEAD/DEAH_box_helicase_dom
IPR000629RNA-helicase_DEAD-box_CS
IPR014014RNA_helicase_DEAD_Q_motif
Vocabulary: biological process
TermDefinition
GO:0000184nuclear-transcribed mRNA catabolic process, nonsense-mediated decay
GO:0006364rRNA processing
GO:0010501RNA secondary structure unwinding
GO:0042254ribosome biogenesis
GO:0071042nuclear polyadenylation-dependent mRNA catabolic process
GO:1990120messenger ribonucleoprotein complex assembly
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005730nucleolus
GO:0005737cytoplasm
GO:0005829cytosol
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR014001Helicase superfamily 1/2, ATP-binding domainSMARTSM00487ultradead3coord: 96..299
e-value: 1.3E-63
score: 227.4
IPR014001Helicase superfamily 1/2, ATP-binding domainPROSITEPS51192HELICASE_ATP_BIND_1coord: 108..283
score: 32.471
IPR001650Helicase, C-terminalSMARTSM00490helicmild6coord: 335..398
e-value: 5.0E-4
score: 29.4
IPR001650Helicase, C-terminalPFAMPF00271Helicase_Ccoord: 308..392
e-value: 6.7E-18
score: 65.0
IPR001650Helicase, C-terminalPROSITEPS51194HELICASE_CTERcoord: 295..404
score: 13.82
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 50..287
e-value: 1.9E-86
score: 291.1
NoneNo IPR availableGENE3DG3DSA:3.40.50.300coord: 288..395
e-value: 7.1E-30
score: 105.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..22
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..18
NoneNo IPR availablePANTHERPTHR24031:SF683coord: 26..390
NoneNo IPR availablePANTHERPTHR24031RNA HELICASEcoord: 26..390
NoneNo IPR availableCDDcd17966DEADc_DDX5_DDX17coord: 88..284
e-value: 5.41498E-128
score: 364.768
NoneNo IPR availableCDDcd18787SF2_C_DEADcoord: 296..391
e-value: 1.69831E-33
score: 119.92
IPR011545DEAD/DEAH box helicase domainPFAMPF00270DEADcoord: 101..272
e-value: 2.8E-49
score: 167.3
IPR000629ATP-dependent RNA helicase DEAD-box, conserved sitePROSITEPS00039DEAD_ATP_HELICASEcoord: 229..237
IPR014014RNA helicase, DEAD-box type, Q motifPROSITEPS51195Q_MOTIFcoord: 77..105
score: 9.234
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 60..286
IPR027417P-loop containing nucleoside triphosphate hydrolaseSUPERFAMILYSSF52540P-loop containing nucleoside triphosphate hydrolasescoord: 217..392