Coactosin-like protein

Overview
NameCoactosin-like protein
Smed IDSMED30023751
Length (bp)714
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Coactosin-like protein (SMED30023751) t-SNE clustered cells

Violin plots show distribution of expression levels for Coactosin-like protein (SMED30023751) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Coactosin-like protein (SMED30023751) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Coactosin-like protein (SMED30023751) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023751

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 10

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30023751SMESG000073127.1 PL06005B1H09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30023751SMESG000073127.1 PL06005B1H09ncbi_smed_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023751SMESG000073127.1 Contig1384GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30023751SMESG000073127.1 dd_Smed_v4_63_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
protonephridiaSMED30023751SMESG000073127.1 dd_Smed_v4_63_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
gutSMED30023751SMESG000073127.1 dd_Smed_v4_63_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023751SMESG000073127.1 dd_Smed_v4_63_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30023751SMESG000073127.1 dd_Smed_v4_63_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
intestinal phagocyteSMED30023751SMESG000073127.1 dd_Smed_v6_63_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023751SMESG000073127.1 dd_Smed_v6_63_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Coactosin-like protein vs. Ensembl Human
Match: COTL1 (coactosin like F-actin binding protein 1 [Source:HGNC Symbol;Acc:HGNC:18304])

HSP 1 Score: 130.568 bits (327), Expect = 7.185e-38
Identity = 64/137 (46.72%), Postives = 87/137 (63.50%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M +KIDKEA   AY  VR+D +   W  F YD   I   + G+ Y+  + +  D+ R FAFVR  TGD MSKR+KFALITW G NVS +++A    DK+LVKE+V ++A +   SD+ E+ E  +++   KAGGANY
Sbjct:    1 MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANY 137          
BLAST of Coactosin-like protein vs. Ensembl Human
Match: COTL1 (coactosin like F-actin binding protein 1 [Source:HGNC Symbol;Acc:HGNC:18304])

HSP 1 Score: 76.6406 bits (187), Expect = 6.644e-18
Identity = 35/68 (51.47%), Postives = 49/68 (72.06%), Query Frame = 1
Query:  436 MSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            MSKR+KFALITW G NVS +++A    DK+LVKE+V ++A +   SD+ E+ E  +++   KAGGANY
Sbjct:    1 MSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANY 68          
BLAST of Coactosin-like protein vs. Ensembl Human
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 52.7582 bits (125), Expect = 1.718e-7
Identity = 40/132 (30.30%), Postives = 59/132 (44.70%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYDDKR--ICVIKTG-SSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+ EAY  V  + + T WALF Y+     I V  TG    E+++ E N  +  +AF R+   D  S   KF LI W G  V+ ++K       S +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK--DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Ensembl Human
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 52.7582 bits (125), Expect = 1.974e-7
Identity = 40/132 (30.30%), Postives = 59/132 (44.70%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYDDKR--ICVIKTG-SSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+ EAY  V  + + T WALF Y+     I V  TG    E+++ E N  +  +AF R+   D  S   KF LI W G  V+ ++K       S +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK--DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Ensembl Human
Match: DBNL (drebrin like [Source:HGNC Symbol;Acc:HGNC:2696])

HSP 1 Score: 52.373 bits (124), Expect = 2.046e-7
Identity = 40/132 (30.30%), Postives = 59/132 (44.70%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYDDKR--ICVIKTG-SSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+ EAY  V  + + T WALF Y+     I V  TG    E+++ E N  +  +AF R+   D  S   KF LI W G  V+ ++K       S +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALQEAYVRVVTEKSPTDWALFTYEGNSNDIRVAGTGEGGLEEMVEELNSGKVMYAFCRVK--DPNSGLPKFVLINWTGEGVNDVRKGACASHVSTMASFLKGAHVTINARAEEDVEPECIMEKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Ensembl Fly
Match: CG6891 (gene:FBgn0030955 transcript:FBtr0334453)

HSP 1 Score: 131.724 bits (330), Expect = 1.288e-38
Identity = 57/141 (40.43%), Postives = 94/141 (66.67%), Query Frame = 1
Query:  226 TMTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSA 648
             + + ++K++I EAYEDVR+D T T WA+F +D  +I V   G  +E+   +F D ER F ++R+  GDEMSKR KF  +TW G  V V+++A ++ DK+L+K++++++AV++    + E+     R A ++AGGANYG+ 
Sbjct:    2 PLATSLEKDSIREAYEDVRSDLTDTEWAVFKFDGAQIIVHARGQCFEEFRQQFGDSERAFGYIRIQMGDEMSKRKKFIFLTWIGQEVGVIQRAKMSTDKALIKDVLNNFAVELQAGVEAELDIELFREALNRAGGANYGTG 142          
BLAST of Coactosin-like protein vs. Ensembl Fly
Match: CG6891 (gene:FBgn0030955 transcript:FBtr0074632)

HSP 1 Score: 131.724 bits (330), Expect = 1.288e-38
Identity = 57/141 (40.43%), Postives = 94/141 (66.67%), Query Frame = 1
Query:  226 TMTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSA 648
             + + ++K++I EAYEDVR+D T T WA+F +D  +I V   G  +E+   +F D ER F ++R+  GDEMSKR KF  +TW G  V V+++A ++ DK+L+K++++++AV++    + E+     R A ++AGGANYG+ 
Sbjct:    2 PLATSLEKDSIREAYEDVRSDLTDTEWAVFKFDGAQIIVHARGQCFEEFRQQFGDSERAFGYIRIQMGDEMSKRKKFIFLTWIGQEVGVIQRAKMSTDKALIKDVLNNFAVELQAGVEAELDIELFREALNRAGGANYGTG 142          
BLAST of Coactosin-like protein vs. Ensembl Fly
Match: CG6891 (gene:FBgn0030955 transcript:FBtr0074631)

HSP 1 Score: 132.109 bits (331), Expect = 1.973e-38
Identity = 57/141 (40.43%), Postives = 94/141 (66.67%), Query Frame = 1
Query:  226 TMTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSA 648
             + + ++K++I EAYEDVR+D T T WA+F +D  +I V   G  +E+   +F D ER F ++R+  GDEMSKR KF  +TW G  V V+++A ++ DK+L+K++++++AV++    + E+     R A ++AGGANYG+ 
Sbjct:   19 PLATSLEKDSIREAYEDVRSDLTDTEWAVFKFDGAQIIVHARGQCFEEFRQQFGDSERAFGYIRIQMGDEMSKRKKFIFLTWIGQEVGVIQRAKMSTDKALIKDVLNNFAVELQAGVEAELDIELFREALNRAGGANYGTG 159          
BLAST of Coactosin-like protein vs. Ensembl Fly
Match: Abp1 (gene:FBgn0036372 transcript:FBtr0075819)

HSP 1 Score: 54.6842 bits (130), Expect = 2.088e-8
Identity = 32/90 (35.56%), Postives = 50/90 (55.56%), Query Frame = 1
Query:  244 DKEAIVEAYEDVRNDSTQTTWALFGYDDK--RICVIKTGSSYEDLLNE-FNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKA 504
            ++  IV A++DV +D + T W+LFGY+ +   + V+ TG    D LNE  N  +  +AFVR+   D  +   K+ LI W G    V++K 
Sbjct:    8 NRAQIVAAWKDVLDDKSDTNWSLFGYEGQTNELKVVATGDGGVDELNEDLNSGKIMYAFVRI--EDPKTGLNKYLLINWQGEGAPVLRKG 95          
BLAST of Coactosin-like protein vs. Ensembl Zebrafish
Match: cotl1 (coactosin-like F-actin binding protein 1 [Source:ZFIN;Acc:ZDB-GENE-030131-8325])

HSP 1 Score: 132.109 bits (331), Expect = 1.422e-38
Identity = 64/137 (46.72%), Postives = 88/137 (64.23%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M ++IDKEA  EAY  VR+DS+   WA F YD   I     GS YE+  ++   + R F FVR++TGD MSKR+KF  ITW G N++ +++A ++ DK+LVK+ V ++A +   SD  E+ E  LRT   KAGGANY
Sbjct:    1 MATRIDKEACREAYNLVRDDSSGICWACFKYDGSTIVPGGHGSDYEEFKSQCTVDSRVFGFVRIMTGDAMSKRSKFTFITWIGENITGLQRAKISTDKALVKDAVPTFAKEFMISDPKELEEEYLRTELKKAGGANY 137          
BLAST of Coactosin-like protein vs. Ensembl Xenopus
Match: cotl1 (coactosin-like F-actin binding protein 1 [Source:NCBI gene;Acc:549295])

HSP 1 Score: 130.568 bits (327), Expect = 6.800e-38
Identity = 62/137 (45.26%), Postives = 89/137 (64.96%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M +KIDKEA  EAY  VR+D+ +T+W  F YD   I   + G++YE+ ++   D+ R +A++R ITGD MSKR KF LITW G NV  +++A +  DK+LVK++  S+A +   +D  E+ E  +R    KAGGANY
Sbjct:    1 MATKIDKEACREAYNLVRDDTNETSWVTFIYDGHTIVPGEQGATYEEFVDTCKDDIRLYAYIRFITGDAMSKRTKFVLITWIGENVGGLQRAKIGTDKTLVKDVAQSFAKEFVITDHKELEEEYIRNELKKAGGANY 137          
BLAST of Coactosin-like protein vs. Ensembl Xenopus
Match: ap2s1 (adaptor related protein complex 2 subunit sigma 1 [Source:Xenbase;Acc:XB-GENE-999486])

HSP 1 Score: 51.6026 bits (122), Expect = 3.512e-7
Identity = 38/132 (28.79%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYDDKR--ICVIKTG-SSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+  AY+DV ++ T+T WAL+ Y+     I + +TG    E+L+ E +  +  +AF R+   D  S   KF L+ W G  V+  +K       S +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALQAAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRV--KDPNSGLPKFVLVNWTGEGVNDARKGVCANHVSTMANFLKGAHVTINARAEEDVEPDAIMEKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Ensembl Xenopus
Match: ap2s1 (adaptor related protein complex 2 subunit sigma 1 [Source:Xenbase;Acc:XB-GENE-999486])

HSP 1 Score: 51.6026 bits (122), Expect = 3.805e-7
Identity = 38/132 (28.79%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYDDKR--ICVIKTG-SSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+  AY+DV ++ T+T WAL+ Y+     I + +TG    E+L+ E +  +  +AF R+   D  S   KF L+ W G  V+  +K       S +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALQAAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRV--KDPNSGLPKFVLVNWTGEGVNDARKGVCANHVSTMANFLKGAHVTINARAEEDVEPDAIMEKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Ensembl Xenopus
Match: ap2s1 (adaptor related protein complex 2 subunit sigma 1 [Source:Xenbase;Acc:XB-GENE-999486])

HSP 1 Score: 51.6026 bits (122), Expect = 3.929e-7
Identity = 38/132 (28.79%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYDDKR--ICVIKTG-SSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+  AY+DV ++ T+T WAL+ Y+     I + +TG    E+L+ E +  +  +AF R+   D  S   KF L+ W G  V+  +K       S +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALQAAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRV--KDPNSGLPKFVLVNWTGEGVNDARKGVCANHVSTMANFLKGAHVTINARAEEDVEPDAIMEKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Ensembl Xenopus
Match: ap2s1 (adaptor related protein complex 2 subunit sigma 1 [Source:Xenbase;Acc:XB-GENE-999486])

HSP 1 Score: 51.6026 bits (122), Expect = 4.368e-7
Identity = 38/132 (28.79%), Postives = 62/132 (46.97%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYDDKR--ICVIKTG-SSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+  AY+DV ++ T+T WAL+ Y+     I + +TG    E+L+ E +  +  +AF R+   D  S   KF L+ W G  V+  +K       S +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALQAAYKDVLDEKTKTDWALYTYEGNSNDIRLAETGDGGLEELVEELSSGKVMYAFCRV--KDPNSGLPKFVLVNWTGEGVNDARKGVCANHVSTMANFLKGAHVTINARAEEDVEPDAIMEKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Ensembl Mouse
Match: Cotl1 (coactosin-like 1 (Dictyostelium) [Source:MGI Symbol;Acc:MGI:1919292])

HSP 1 Score: 129.028 bits (323), Expect = 1.746e-37
Identity = 64/137 (46.72%), Postives = 86/137 (62.77%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M +KIDKEA   AY  VR+D +   W  F YD   I     G+ Y+  + +  D+ R FAFVR  TGD MSKR+KFALITW G +VS +++A    DK+LVKE+V ++A +   SD+ E+ E  +R+   KAGGANY
Sbjct:    1 MATKIDKEACRAAYNLVRDDGSAVIWVTFRYDGATIVPGDQGADYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGEDVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIRSELKKAGGANY 137          
BLAST of Coactosin-like protein vs. Ensembl Mouse
Match: Cotl1 (coactosin-like 1 (Dictyostelium) [Source:MGI Symbol;Acc:MGI:1919292])

HSP 1 Score: 129.028 bits (323), Expect = 1.746e-37
Identity = 64/137 (46.72%), Postives = 86/137 (62.77%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M +KIDKEA   AY  VR+D +   W  F YD   I     G+ Y+  + +  D+ R FAFVR  TGD MSKR+KFALITW G +VS +++A    DK+LVKE+V ++A +   SD+ E+ E  +R+   KAGGANY
Sbjct:    1 MATKIDKEACRAAYNLVRDDGSAVIWVTFRYDGATIVPGDQGADYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGEDVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIRSELKKAGGANY 137          
BLAST of Coactosin-like protein vs. Ensembl Mouse
Match: Cotl1 (coactosin-like 1 (Dictyostelium) [Source:MGI Symbol;Acc:MGI:1919292])

HSP 1 Score: 72.4034 bits (176), Expect = 7.204e-16
Identity = 40/103 (38.83%), Postives = 55/103 (53.40%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALI------TWC-GANVSVMKKANLTV 516
            M +KIDKEA   AY  VR+D +   W  F YD   I     G+ Y+  + +  D+ R FAFVR  TGD MSKR+K A         WC G    ++ +A+L++
Sbjct:    1 MATKIDKEACRAAYNLVRDDGSAVIWVTFRYDGATIVPGDQGADYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKPAPPFVLKKSFWCQGHAYHLIPEASLSL 103          
BLAST of Coactosin-like protein vs. UniProt/SwissProt
Match: sp|Q2HJ57|COTL1_BOVIN (Coactosin-like protein OS=Bos taurus OX=9913 GN=COTL1 PE=2 SV=3)

HSP 1 Score: 133.65 bits (335), Expect = 2.548e-38
Identity = 66/137 (48.18%), Postives = 88/137 (64.23%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M +KIDKEA   AY  VR+DS+   W  F YD   I   + G+ Y+D + +  D+ R FAFVR  TGD MSKR+KFALITW G NVS +++A    DK+LVKE+V ++A +   SD+ E+ E  ++    KAGGANY
Sbjct:    1 MATKIDKEACRTAYNLVRDDSSAVIWVTFKYDGSTIVPGEQGAEYQDFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKNELKKAGGANY 137          
BLAST of Coactosin-like protein vs. UniProt/SwissProt
Match: sp|Q14019|COTL1_HUMAN (Coactosin-like protein OS=Homo sapiens OX=9606 GN=COTL1 PE=1 SV=3)

HSP 1 Score: 130.568 bits (327), Expect = 3.450e-37
Identity = 64/137 (46.72%), Postives = 87/137 (63.50%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M +KIDKEA   AY  VR+D +   W  F YD   I   + G+ Y+  + +  D+ R FAFVR  TGD MSKR+KFALITW G NVS +++A    DK+LVKE+V ++A +   SD+ E+ E  +++   KAGGANY
Sbjct:    1 MATKIDKEACRAAYNLVRDDGSAVIWVTFKYDGSTIVPGEQGAEYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGENVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIKSELKKAGGANY 137          
BLAST of Coactosin-like protein vs. UniProt/SwissProt
Match: sp|B0BNA5|COTL1_RAT (Coactosin-like protein OS=Rattus norvegicus OX=10116 GN=Cotl1 PE=1 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.006e-36
Identity = 64/137 (46.72%), Postives = 86/137 (62.77%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M +KIDKEA   AY  VR+D +   W  F YD   I     G+ Y+  + +  D+ R FAFVR  TGD MSKR+KFALITW G +VS +++A    DK+LVKE+V ++A +   SD+ E+ E  +R+   KAGGANY
Sbjct:    1 MATKIDKEACRAAYNLVRDDGSSVIWVTFKYDGATIVPGDQGADYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGEDVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIRSELKKAGGANY 137          
BLAST of Coactosin-like protein vs. UniProt/SwissProt
Match: sp|Q9CQI6|COTL1_MOUSE (Coactosin-like protein OS=Mus musculus OX=10090 GN=Cotl1 PE=1 SV=3)

HSP 1 Score: 129.028 bits (323), Expect = 1.222e-36
Identity = 64/137 (46.72%), Postives = 86/137 (62.77%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M +KIDKEA   AY  VR+D +   W  F YD   I     G+ Y+  + +  D+ R FAFVR  TGD MSKR+KFALITW G +VS +++A    DK+LVKE+V ++A +   SD+ E+ E  +R+   KAGGANY
Sbjct:    1 MATKIDKEACRAAYNLVRDDGSAVIWVTFRYDGATIVPGDQGADYQHFIQQCTDDVRLFAFVRFTTGDAMSKRSKFALITWIGEDVSGLQRAKTGTDKTLVKEVVQNFAKEFVISDRKELEEDFIRSELKKAGGANY 137          
BLAST of Coactosin-like protein vs. UniProt/SwissProt
Match: sp|P34121|COAA_DICDI (Coactosin OS=Dictyostelium discoideum OX=44689 GN=coaA PE=1 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 6.224e-24
Identity = 49/135 (36.30%), Postives = 83/135 (61.48%), Query Frame = 1
Query:  265 AYEDVRNDSTQTTWALFGYDDKRICVI--KTGSSYEDLLNEFNDE-ERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSAK*TS 660
            AY++V  DS  T W LF Y+ K   V+  K    + +L  E N   ER +A++R+++GD+ SKR+KF  I+WCG  V  + KAN++V K+ VK+++ +  V++  +  ++++E +L T   K+ GA+Y   K T+
Sbjct:   12 AYDEVLADSNDTNWCLFKYEGKNKIVLSGKGSGGFAELAQEINQPSERLYAYLRVVSGDDESKRSKFVFISWCGEEVGPLAKANVSVHKASVKQVIKNIGVEVHYTVADDLNEEELMTKVRKSSGADYSGNKSTN 146          
BLAST of Coactosin-like protein vs. TrEMBL
Match: B7SHS5 (Coactosin-like protein OS=Eisenia fetida OX=6396 PE=2 SV=1)

HSP 1 Score: 159.073 bits (401), Expect = 8.516e-46
Identity = 74/137 (54.01%), Postives = 100/137 (72.99%), Query Frame = 1
Query:  241 IDKEAIVEAYEDVRNDSTQTTWALFGYDDKR-ICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSA 648
            I KE+I EAY+DVRND T TTWAL GYDD   I ++ TGS YE+  ++F+D++R F FVR+  GDE+SKRAKF LITW G+N+S +K+A ++ DKS VK I+ ++A++I  SD  E+ E  +R A  KAGGA YG+ 
Sbjct:    4 IQKESIAEAYDDVRNDQTPTTWALLGYDDSNTIVLLGTGSEYEEFRSKFSDDDRLFGFVRLTAGDELSKRAKFVLITWIGSNISALKRAKVSTDKSTVKSILQNFALEIQISDLAELEEPNIREALKKAGGAQYGTG 140          
BLAST of Coactosin-like protein vs. TrEMBL
Match: K1QJC6 (Coactosin-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10027046 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 8.173e-43
Identity = 71/138 (51.45%), Postives = 99/138 (71.74%), Query Frame = 1
Query:  235 SKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSA 648
            + IDK+ I +AYE+VRNDS  T WA+  YD   I +  TGSS+ED  + F D++R + F+R+I GDE+SKR KFALI W G NVS +K+A +  DKS VKE++ SYAV++  ++K+E++E  +R A  KAGGANYG+ 
Sbjct:    2 ANIDKQTIRDAYEEVRNDSNDTNWAVLKYDGSHIVLGSTGSSFEDFASNFTDDDRVYGFLRVIAGDELSKRTKFALIVWLGKNVSGIKRARMGTDKSSVKEVIRSYAVELMINEKSELNEDFIREAIVKAGGANYGTG 139          
BLAST of Coactosin-like protein vs. TrEMBL
Match: T1G9N7 (ADF-H domain-containing protein OS=Helobdella robusta OX=6412 GN=20217783 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.741e-42
Identity = 71/134 (52.99%), Postives = 93/134 (69.40%), Query Frame = 1
Query:  241 IDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYG 642
            I K  I EAY DVRND++ TTWAL  YD+  I +  TGS YE+ L+ FN++ER F +VR   GDEMSKR KF LITW G+ V  +KKA ++ DK+ VK I  SYA++I TS+++E+    ++ A DK GGANYG
Sbjct:    4 IQKHEIHEAYLDVRNDNSPTTWALLSYDNNAIILNSTGSDYEEFLSNFNEQERFFGYVRFSAGDEMSKRVKFVLITWIGSEVGALKKARVSTDKAFVKSICKSYAIEIQTSERSELELDHIKKALDKVGGANYG 137          
BLAST of Coactosin-like protein vs. TrEMBL
Match: A0A2B4SSA2 (Coactosin-like protein OS=Stylophora pistillata OX=50429 GN=COTL1 PE=4 SV=1)

HSP 1 Score: 149.443 bits (376), Expect = 4.759e-42
Identity = 69/137 (50.36%), Postives = 100/137 (72.99%), Query Frame = 1
Query:  241 IDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSAK 651
            IDKEAI ++Y DVR+D ++T WA++ Y+DK I    +G+ YE+  + F + ER + FVR+ TGDE+SKRAKFA ITW G +VS M+KA ++ DK+ VK++V ++AV+I TSD  E+    +++A  KAGGANYG+ K
Sbjct:    4 IDKEAISQSYLDVRDDKSETNWAVYKYNDKTIVHAASGTDYEEFRSHFTESERVYGFVRIETGDELSKRAKFAFITWIGESVSSMQKAKVSTDKASVKQVVQNFAVEILTSDTEELDYDHVKSAVAKAGGANYGTGK 140          
BLAST of Coactosin-like protein vs. TrEMBL
Match: R7UI21 (ADF-H domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_159358 PE=4 SV=1)

HSP 1 Score: 147.517 bits (371), Expect = 2.781e-41
Identity = 66/138 (47.83%), Postives = 95/138 (68.84%), Query Frame = 1
Query:  235 SKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSA 648
            + +D EA+ EAY++VRND+++T+W    YDD+ I V   GS Y +  N F D+ER F FVR+++GDEMSKRAKF LITWCG  VS +K+A ++ DK  VK ++ S+++++  SD  E+  S +     KAGGANYG+ 
Sbjct:    2 ASMDVEAVREAYDEVRNDASETSWVFLNYDDQTIKVAAQGSEYSEFQNLFTDDERAFGFVRVVSGDEMSKRAKFVLITWCGNQVSPLKRARMSTDKIEVKRVIKSFSIELQVSDPEEVELSCVMAQVQKAGGANYGTG 139          
BLAST of Coactosin-like protein vs. Ensembl Cavefish
Match: cotl1 (coactosin like F-actin binding protein 1 [Source:NCBI gene;Acc:103037940])

HSP 1 Score: 137.117 bits (344), Expect = 2.209e-40
Identity = 67/142 (47.18%), Postives = 90/142 (63.38%), Query Frame = 1
Query:  214 FQSKTMTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            F    M ++IDKEA  EAY  VR+D+T   WA F YD   I     G+ Y D  ++ +D+ R F FVR+ TGD MSKRAKF LITW G NVS +++A ++ DK+LVK++V ++A +   SD  E+ E  +R    KAGGANY
Sbjct:   20 FYPSKMATRIDKEACREAYNLVRDDTTDINWAAFKYDGPMIVPAGHGTDYADFKSQCSDDNRLFGFVRITTGDAMSKRAKFTLITWIGENVSGLQRAKISTDKTLVKDVVQNFAKEFMVSDMRELEEDYIRNELKKAGGANY 161          
BLAST of Coactosin-like protein vs. Ensembl Cavefish
Match: cotl1 (coactosin like F-actin binding protein 1 [Source:NCBI gene;Acc:103037940])

HSP 1 Score: 135.576 bits (340), Expect = 3.993e-40
Identity = 66/137 (48.18%), Postives = 89/137 (64.96%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M ++IDKEA  EAY  VR+D+T   WA F YD   I     G+ Y D  ++ +D+ R F FVR+ TGD MSKRAKF LITW G NVS +++A ++ DK+LVK++V ++A +   SD  E+ E  +R    KAGGANY
Sbjct:    1 MATRIDKEACREAYNLVRDDTTDINWAAFKYDGPMIVPAGHGTDYADFKSQCSDDNRLFGFVRITTGDAMSKRAKFTLITWIGENVSGLQRAKISTDKTLVKDVVQNFAKEFMVSDMRELEEDYIRNELKKAGGANY 137          
BLAST of Coactosin-like protein vs. Ensembl Cavefish
Match: dbnlb (drebrin like [Source:NCBI gene;Acc:103021432])

HSP 1 Score: 49.2914 bits (116), Expect = 1.507e-6
Identity = 38/133 (28.57%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYD----DKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+  AY++V ++ + T WALF Y+    D R+     G   E+L+ E N  +  +AF R+   D  S   K+ LI W G  V   +K       S +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALTAAYKEVVDEKSDTNWALFTYEGNSNDIRLAEKGDG-GLEELVEELNSGKVMYAFCRV--QDPNSGLPKYVLINWTGEGVKDARKGLCANHVSSMANFLKGAHVTINARAEEDVEPESIMQKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Ensembl Cavefish
Match: dbnlb (drebrin like [Source:NCBI gene;Acc:103021432])

HSP 1 Score: 49.2914 bits (116), Expect = 1.510e-6
Identity = 38/133 (28.57%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYD----DKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+  AY++V ++ + T WALF Y+    D R+     G   E+L+ E N  +  +AF R+   D  S   K+ LI W G  V   +K       S +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALTAAYKEVVDEKSDTNWALFTYEGNSNDIRLAEKGDG-GLEELVEELNSGKVMYAFCRV--QDPNSGLPKYVLINWTGEGVKDARKGLCANHVSSMANFLKGAHVTINARAEEDVEPESIMQKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Ensembl Cavefish
Match: dbnlb (drebrin like [Source:NCBI gene;Acc:103021432])

HSP 1 Score: 48.9062 bits (115), Expect = 1.584e-6
Identity = 38/133 (28.57%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYD----DKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+  AY++V ++ + T WALF Y+    D R+     G   E+L+ E N  +  +AF R+   D  S   K+ LI W G  V   +K       S +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALTAAYKEVVDEKSDTNWALFTYEGNSNDIRLAEKGDG-GLEELVEELNSGKVMYAFCRVQ--DPNSGLPKYVLINWTGEGVKDARKGLCANHVSSMANFLKGAHVTINARAEEDVEPESIMQKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Ensembl Nematostella
Match: EDO36589 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI89])

HSP 1 Score: 143.665 bits (361), Expect = 1.390e-43
Identity = 63/141 (44.68%), Postives = 102/141 (72.34%), Query Frame = 1
Query:  232 TSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKR-ICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSAK 651
            + +++K ++ + Y DVRND T T WA+F YD+   IC+ K+G  Y++ L EF++ +R +A+VR+ TGDE+S+RAKFA ITW G +VS +KKA ++ DK+ VK+++ ++AV+I   DK+E+    +++   KAGGANYG+ +
Sbjct:    3 SGQVNKASVQDGYVDVRNDKTDTIWAVFTYDESNTICLHKSGKEYDEFLAEFDESDRAYAYVRIETGDELSRRAKFAFITWVGPSVSPLKKAKVSTDKAFVKQVLQNFAVEIQADDKSELQYDHVKSVVQKAGGANYGTGQ 143          
BLAST of Coactosin-like protein vs. Ensembl Nematostella
Match: EDO47220 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMX1])

HSP 1 Score: 53.5286 bits (127), Expect = 1.415e-8
Identity = 34/125 (27.20%), Postives = 56/125 (44.80%), Query Frame = 1
Query:  241 IDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSS----YEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKL 603
            ID     +   DVR+D +   W + G+      V+   +S     E++    ND+E  +A VR+    ++S   KF  I W G +V   KK    V    +KE +  Y   + TS K +++E  +
Sbjct:    8 IDPVPFDKGIGDVRSDVSPINWMVAGHVSMNPNVLGFRASGCGGLEEMATHLNDDEAMYALVRLQEKVDLSSTVKFVYIHWVGESVPFTKKGRYGVVHGSIKEKIGQYHCIVETSSKADLTEEAI 132          
BLAST of Coactosin-like protein vs. Ensembl Medaka
Match: cotl1 (coactosin like F-actin binding protein 1 [Source:NCBI gene;Acc:101171827])

HSP 1 Score: 139.428 bits (350), Expect = 1.325e-41
Identity = 67/137 (48.91%), Postives = 89/137 (64.96%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            M ++IDKEA  EAY DVR+DST+T WA F Y+   I     G+ YED      D+ R F FVR  TGD MSKR KF LITW G N+S +++A ++ DK+++K+IV ++A +   SD  E+ E  +RT   KAGGANY
Sbjct:    1 MATQIDKEACREAYNDVRDDSTETNWAAFKYEGSTIVPAGQGTDYEDFKKLCTDDSRLFGFVRFTTGDAMSKRVKFTLITWIGENISGLQRAKISTDKTMIKDIVQTFAKEFMVSDLRELDEEYIRTELKKAGGANY 137          
BLAST of Coactosin-like protein vs. Ensembl Medaka
Match: dbnlb (drebrin like [Source:NCBI gene;Acc:101155522])

HSP 1 Score: 47.7506 bits (112), Expect = 3.619e-6
Identity = 37/133 (27.82%), Postives = 59/133 (44.36%), Query Frame = 1
Query:  253 AIVEAYEDVRNDSTQTTWALFGYD----DKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANY 639
            A+  AY++V ++ + T WALF Y+    D R+   K     E+L+ E N  +  +AF R+   D  S   K+ LI W G  V+  +K         +   +    V I    + ++    +     KA GANY
Sbjct:   11 ALTAAYKEVVDEKSNTNWALFTYEGNSNDIRLAE-KGDGGLEELVEELNSGKVMYAFCRV--QDPNSGLPKYVLINWTGEGVNDARKGMCANHVLSMANFLKGAHVTINARAEEDVEPEAIMQKVAKASGANY 140          
BLAST of Coactosin-like protein vs. Planmine SMEST
Match: SMESG000073127.1 (SMESG000073127.1)

HSP 1 Score: 325.865 bits (834), Expect = 8.827e-115
Identity = 171/171 (100.00%), Postives = 171/171 (100.00%), Query Frame = 1
Query:  139 MSQRVTTNYSLYQYXXXXXXXXXXQFQSKTMTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSAK 651
            MSQRVTTNYSLYQYNNNCVLNNNLQFQSKTMTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSAK
Sbjct:    1 MSQRVTTNYSLYQYNNNCVLNNNLQFQSKTMTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSAK 171          
BLAST of Coactosin-like protein vs. Planmine SMEST
Match: SMESG000073127.1 (SMESG000073127.1)

HSP 1 Score: 286.96 bits (733), Expect = 7.288e-100
Identity = 141/141 (100.00%), Postives = 141/141 (100.00%), Query Frame = 1
Query:  229 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSAK 651
            MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSAK
Sbjct:    1 MTSKIDKEAIVEAYEDVRNDSTQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEMSKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEISESKLRTAFDKAGGANYGSAK 141          
The following BLAST results are available for this feature:
BLAST of Coactosin-like protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
COTL17.185e-3846.72coactosin like F-actin binding protein 1 [Source:H... [more]
COTL16.644e-1851.47coactosin like F-actin binding protein 1 [Source:H... [more]
DBNL1.718e-730.30drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
DBNL1.974e-730.30drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
DBNL2.046e-730.30drebrin like [Source:HGNC Symbol;Acc:HGNC:2696][more]
back to top
BLAST of Coactosin-like protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coactosin-like protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG68911.288e-3840.43gene:FBgn0030955 transcript:FBtr0334453[more]
CG68911.288e-3840.43gene:FBgn0030955 transcript:FBtr0074632[more]
CG68911.973e-3840.43gene:FBgn0030955 transcript:FBtr0074631[more]
Abp12.088e-835.56gene:FBgn0036372 transcript:FBtr0075819[more]
back to top
BLAST of Coactosin-like protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
cotl11.422e-3846.72coactosin-like F-actin binding protein 1 [Source:Z... [more]
back to top
BLAST of Coactosin-like protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cotl16.800e-3845.26coactosin-like F-actin binding protein 1 [Source:N... [more]
ap2s13.512e-728.79adaptor related protein complex 2 subunit sigma 1 ... [more]
ap2s13.805e-728.79adaptor related protein complex 2 subunit sigma 1 ... [more]
ap2s13.929e-728.79adaptor related protein complex 2 subunit sigma 1 ... [more]
ap2s14.368e-728.79adaptor related protein complex 2 subunit sigma 1 ... [more]
back to top
BLAST of Coactosin-like protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cotl11.746e-3746.72coactosin-like 1 (Dictyostelium) [Source:MGI Symbo... [more]
Cotl11.746e-3746.72coactosin-like 1 (Dictyostelium) [Source:MGI Symbo... [more]
Cotl17.204e-1638.83coactosin-like 1 (Dictyostelium) [Source:MGI Symbo... [more]
back to top
BLAST of Coactosin-like protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2HJ57|COTL1_BOVIN2.548e-3848.18Coactosin-like protein OS=Bos taurus OX=9913 GN=CO... [more]
sp|Q14019|COTL1_HUMAN3.450e-3746.72Coactosin-like protein OS=Homo sapiens OX=9606 GN=... [more]
sp|B0BNA5|COTL1_RAT1.006e-3646.72Coactosin-like protein OS=Rattus norvegicus OX=101... [more]
sp|Q9CQI6|COTL1_MOUSE1.222e-3646.72Coactosin-like protein OS=Mus musculus OX=10090 GN... [more]
sp|P34121|COAA_DICDI6.224e-2436.30Coactosin OS=Dictyostelium discoideum OX=44689 GN=... [more]
back to top
BLAST of Coactosin-like protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B7SHS58.516e-4654.01Coactosin-like protein OS=Eisenia fetida OX=6396 P... [more]
K1QJC68.173e-4351.45Coactosin-like protein OS=Crassostrea gigas OX=291... [more]
T1G9N71.741e-4252.99ADF-H domain-containing protein OS=Helobdella robu... [more]
A0A2B4SSA24.759e-4250.36Coactosin-like protein OS=Stylophora pistillata OX... [more]
R7UI212.781e-4147.83ADF-H domain-containing protein OS=Capitella telet... [more]
back to top
BLAST of Coactosin-like protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cotl12.209e-4047.18coactosin like F-actin binding protein 1 [Source:N... [more]
cotl13.993e-4048.18coactosin like F-actin binding protein 1 [Source:N... [more]
dbnlb1.507e-628.57drebrin like [Source:NCBI gene;Acc:103021432][more]
dbnlb1.510e-628.57drebrin like [Source:NCBI gene;Acc:103021432][more]
dbnlb1.584e-628.57drebrin like [Source:NCBI gene;Acc:103021432][more]
back to top
BLAST of Coactosin-like protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coactosin-like protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Coactosin-like protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO365891.390e-4344.68Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO472201.415e-827.20Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Coactosin-like protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cotl11.325e-4148.91coactosin like F-actin binding protein 1 [Source:N... [more]
dbnlb3.619e-627.82drebrin like [Source:NCBI gene;Acc:101155522][more]
back to top
BLAST of Coactosin-like protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000073127.18.827e-115100.00SMESG000073127.1[more]
SMESG000073127.17.288e-100100.00SMESG000073127.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023751 ID=SMED30023751|Name=Coactosin-like protein|organism=Schmidtea mediterranea sexual|type=transcript|length=714bp
TCTTCCGATCTTAGAAAGGCTGTTGCAATTATGCATGTACACAACTGCCA
CACACACACACAAATAATAAAAAAATTACAGACAGGCAGGTAAAAGTTTA
CAGACAACCTTTTGATTGTTTTGTGTTTGTGTGCGTCAATGAGTCAGCGA
GTTACAACCAATTACAGCTTGTATCAGTATAATAACAACTGTGTATTGAA
TAATAATTTACAATTCCAATCTAAAACCATGACTAGTAAAATTGACAAGG
AAGCTATCGTTGAAGCTTATGAAGATGTGAGAAACGATTCCACTCAAACA
ACTTGGGCTCTATTTGGATATGATGATAAAAGAATTTGCGTTATTAAAAC
CGGAAGTTCATATGAAGATCTACTCAATGAATTTAATGACGAAGAAAGAA
ATTTTGCATTTGTAAGAATGATTACTGGAGATGAAATGAGCAAACGAGCG
AAATTTGCTCTCATCACTTGGTGTGGTGCAAATGTGTCTGTAATGAAAAA
AGCTAACCTCACCGTTGACAAAAGTTTGGTAAAGGAAATAGTTTCAAGCT
ATGCTGTTGATATTTTTACGTCAGACAAAAATGAGATTAGTGAATCGAAA
TTACGAACGGCTTTCGATAAAGCTGGGGGAGCGAATTATGGTTCAGCTAA
ATGAACTTCATTTGATTCAAAGTGATTTATCTATCAATAATTAATTATTA
ATAAATTCTTTTCT
back to top

protein sequence of SMED30023751-orf-1

>SMED30023751-orf-1 ID=SMED30023751-orf-1|Name=SMED30023751-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=172bp
MSQRVTTNYSLYQYNNNCVLNNNLQFQSKTMTSKIDKEAIVEAYEDVRND
STQTTWALFGYDDKRICVIKTGSSYEDLLNEFNDEERNFAFVRMITGDEM
SKRAKFALITWCGANVSVMKKANLTVDKSLVKEIVSSYAVDIFTSDKNEI
SESKLRTAFDKAGGANYGSAK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000020protonephridia
PLANA:0000026gut
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR030502CLP
IPR002108ADF-H
IPR029006ADF-H/Gelsolin-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0005622intracellular
Vocabulary: molecular function
TermDefinition
GO:0003779actin binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002108Actin-depolymerising factor homology domainSMARTSM00102adf_2coord: 38..156
e-value: 1.6E-9
score: 47.6
IPR002108Actin-depolymerising factor homology domainPFAMPF00241Cofilin_ADFcoord: 41..156
e-value: 8.7E-22
score: 77.2
IPR002108Actin-depolymerising factor homology domainPROSITEPS51263ADF_Hcoord: 32..160
score: 26.382
IPR029006ADF-H/Gelsolin-like domain superfamilyGENE3DG3DSA:3.40.20.10coord: 32..170
e-value: 7.5E-40
score: 137.7
IPR030502Coactosin-like proteinPANTHERPTHR10829:SF29COACTOSIN-LIKE PROTEINcoord: 31..169
NoneNo IPR availablePANTHERPTHR10829CORTACTIN AND DREBRINcoord: 31..169
NoneNo IPR availableCDDcd11282ADF_coactosin_likecoord: 39..150
e-value: 1.24603E-40
score: 130.834
NoneNo IPR availableSUPERFAMILYSSF55753Actin depolymerizing proteinscoord: 31..169