Lysophosphatidylcholine acyltransferase

Overview
NameLysophosphatidylcholine acyltransferase
Smed IDSMED30023749
Length (bp)1820
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Lysophosphatidylcholine acyltransferase (SMED30023749) t-SNE clustered cells

Violin plots show distribution of expression levels for Lysophosphatidylcholine acyltransferase (SMED30023749) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Lysophosphatidylcholine acyltransferase (SMED30023749) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Lysophosphatidylcholine acyltransferase (SMED30023749) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023749

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023749SMESG000069978.1 Contig4628GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023749SMESG000003820.1 Contig4628GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
protonephridiaSMED30023749SMESG000003820.1 dd_Smed_v4_2022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023749SMESG000003820.1 dd_Smed_v4_2022_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023749SMESG000003820.1 dd_Smed_v4_2022_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Human
Match: LPCAT1 (lysophosphatidylcholine acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:25718])

HSP 1 Score: 307.76 bits (787), Expect = 6.021e-97
Identity = 160/424 (37.74%), Postives = 251/424 (59.20%), Query Frame = 1
Query:  187 RTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQ 1455
            R   P   NPF++   +   Q  ++ ++T+T+ P+R++       + + ++ +A  G ++ +   P + WRK +   L  I  R  +F G  H + VKGR+    EA IL LAPHS++ D++ V  + M+S++ K E+ +  I G L++  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNR+CLI FK GAFIPG  VQPVVLR+PNKLD+ITWTW GPG   +LW+   Q H  VEIEFLP+Y PSEEEKRNP L+A NVR +MA+AL V  T++++EDC+      +  LP    ++EF+RL  R L L+ + +           R+     + + E    + +  ++ L+E +F  +D++ +G +D++     LS+   P      LD I  A+++   ++    G+
Sbjct:   22 RLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIM-RTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVT-MTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARL-VRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSD-LLEDMFSLFDESGSGEVDLRECVVALSVVCRPAR---TLDTIQLAFKMYGAQEDGSVGE 438          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Human
Match: LPCAT1 (lysophosphatidylcholine acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:25718])

HSP 1 Score: 307.76 bits (787), Expect = 6.021e-97
Identity = 160/424 (37.74%), Postives = 251/424 (59.20%), Query Frame = 1
Query:  187 RTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQ 1455
            R   P   NPF++   +   Q  ++ ++T+T+ P+R++       + + ++ +A  G ++ +   P + WRK +   L  I  R  +F G  H + VKGR+    EA IL LAPHS++ D++ V  + M+S++ K E+ +  I G L++  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNR+CLI FK GAFIPG  VQPVVLR+PNKLD+ITWTW GPG   +LW+   Q H  VEIEFLP+Y PSEEEKRNP L+A NVR +MA+AL V  T++++EDC+      +  LP    ++EF+RL  R L L+ + +           R+     + + E    + +  ++ L+E +F  +D++ +G +D++     LS+   P      LD I  A+++   ++    G+
Sbjct:   22 RLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIM-RTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVT-MTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARL-VRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSD-LLEDMFSLFDESGSGEVDLRECVVALSVVCRPAR---TLDTIQLAFKMYGAQEDGSVGE 438          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Human
Match: LPCAT1 (lysophosphatidylcholine acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:25718])

HSP 1 Score: 298.516 bits (763), Expect = 6.954e-94
Identity = 154/400 (38.50%), Postives = 241/400 (60.25%), Query Frame = 1
Query:  259 MVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQ 1455
            + ++T+T+ P+R++       + + ++ +A  G ++ +   P + WRK +   L  I  R  +F G  H + VKGR+    EA IL LAPHS++ D++ V  + M+S++ K E+ +  I G L++  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNR+CLI FK GAFIPG  VQPVVLR+PNKLD+ITWTW GPG   +LW+   Q H  VEIEFLP+Y PSEEEKRNP L+A NVR +MA+AL V  T++++EDC+      +  LP    ++EF+RL  R L L+ + +           R+     + + E    + +  ++ L+E +F  +D++ +G +D++     LS+   P      LD I  A+++   ++    G+
Sbjct:    1 VALMTLTLFPVRLLVAAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIM-RTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVT-MTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARL-VRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSD-LLEDMFSLFDESGSGEVDLRECVVALSVVCRPAR---TLDTIQLAFKMYGAQEDGSVGE 393          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Human
Match: LPCAT1 (lysophosphatidylcholine acyltransferase 1 [Source:HGNC Symbol;Acc:HGNC:25718])

HSP 1 Score: 298.516 bits (763), Expect = 6.954e-94
Identity = 154/400 (38.50%), Postives = 241/400 (60.25%), Query Frame = 1
Query:  259 MVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQ 1455
            + ++T+T+ P+R++       + + ++ +A  G ++ +   P + WRK +   L  I  R  +F G  H + VKGR+    EA IL LAPHS++ D++ V  + M+S++ K E+ +  I G L++  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNR+CLI FK GAFIPG  VQPVVLR+PNKLD+ITWTW GPG   +LW+   Q H  VEIEFLP+Y PSEEEKRNP L+A NVR +MA+AL V  T++++EDC+      +  LP    ++EF+RL  R L L+ + +           R+     + + E    + +  ++ L+E +F  +D++ +G +D++     LS+   P      LD I  A+++   ++    G+
Sbjct:    1 VALMTLTLFPVRLLVAAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIM-RTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVT-MTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARL-VRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSD-LLEDMFSLFDESGSGEVDLRECVVALSVVCRPAR---TLDTIQLAFKMYGAQEDGSVGE 393          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Human
Match: LPCAT2 (lysophosphatidylcholine acyltransferase 2 [Source:HGNC Symbol;Acc:HGNC:26032])

HSP 1 Score: 282.337 bits (721), Expect = 4.895e-87
Identity = 152/400 (38.00%), Postives = 238/400 (59.50%), Query Frame = 1
Query:  253 LKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETAN-SCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDL-KDGNI 1446
            +++V++ I ++PIR++   +   + +  + I+     +     P++GWR+ I         R   FF     + VKG+  +  EAP+ V APHS F D +  V  G+ S++ + E A    IG LL+  QP+LV+R DP+SR+ TI+EI +R+  G  WPQ+L+FPEGTCTNRSCLI FK GAFIPG  VQPV+LR+PNKLD++TWTW G     L  + F Q+ T VE+EF+P+  P++EEK +P LFA+ VR +MA+AL +P T+H+YEDCR M  A +  LP    +VEF+++ ++ L L  D +        +I      G + ++E   ++ +  ++ L  ++F  +D+ + G ID +     L++   P N +   + I  A++L D+ +DG I
Sbjct:   56 VQIVLLGIILLPIRVLLVALILLLAWPFAAISTVCCPEK-LTHPITGWRRKITQTALKFLGR-AMFFSMGFIVAVKGKIASPLEAPVFVAAPHSTFFDGIACVVAGLPSMVSRNENAQVPLIGRLLRAVQPVLVSRVDPDSRKNTINEIIKRTTSGGEWPQILVFPEGTCTNRSCLITFKPGAFIPGVPVQPVLLRYPNKLDTVTWTWQGYTFIQLCMLTFCQLFTKVEVEFMPVQVPNDEEKNDPVLFANKVRNLMAEALGIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFTKISRK-LKLDWDGVRKHLDEYASIASSSKGGRIGIEEFAKYLKLPVSDVL-RQLFALFDRNHDGSIDFREYVIGLAVLCNPSNTE---EIIQVAFKLFDVDEDGYI 448          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Celegans
Match: acl-4 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q9N5S9])

HSP 1 Score: 62.003 bits (149), Expect = 4.889e-10
Identity = 49/206 (23.79%), Postives = 94/206 (45.63%), Query Frame = 1
Query:  280 IMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNI----MLPLFLIFAR---LTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI--GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWT 870
            ++P+R   F +  G+ +LIS  AL G        P+  W+K +    ML  + I +R      +F   H+         + +A  + +A H++ +D+L +    + ++IG+       I    L + +  I   R +   R     ++K      +  P +LIFPEGTC N + ++ FK G+F  G ++ P+ +++ ++     W 
Sbjct:   54 MLPLRFTVFCI--GLVFLISSTALIG------LVPIGNWKKALNHKCMLICYRILSRSLTAVVYFHDEHY---------KAQAQGICVANHTSPIDALILSIDNVYALIGQKHEGLLGIVQRALSRASSHIWFERSEAKDRLVVAQKLKEHCTNPDKLP-ILIFPEGTCINNTSVMMFKKGSFEIGTTIYPIAMKYDSRFGDAFWN 241          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Celegans
Match: acl-4 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q9N5S9])

HSP 1 Score: 62.3882 bits (150), Expect = 6.456e-10
Identity = 49/205 (23.90%), Postives = 94/205 (45.85%), Query Frame = 1
Query:  280 IMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNI----MLPLFLIFAR---LTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI--GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITW 867
            ++P+R   F +  G+ +LIS  AL G        P+  W+K +    ML  + I +R      +F   H+         + +A  + +A H++ +D+L +    + ++IG+       I    L + +  I   R +   R     ++K      +  P +LIFPEGTC N + ++ FK G+F  G ++ P+ +++ ++     W
Sbjct:  264 MLPLRFTVFCI--GLVFLISSTALIG------LVPIGNWKKALNHKCMLICYRILSRSLTAVVYFHDEHY---------KAQAQGICVANHTSPIDALILSIDNVYALIGQKHEGLLGIVQRALSRASSHIWFERSEAKDRLVVAQKLKEHCTNPDKLP-ILIFPEGTCINNTSVMMFKKGSFEIGTTIYPIAMKYDSRFGDAFW 450          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Celegans
Match: acl-5 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q21812])

HSP 1 Score: 59.3066 bits (142), Expect = 4.563e-9
Identity = 39/175 (22.29%), Postives = 78/175 (44.57%), Query Frame = 1
Query:  514 LVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCIGYLL----KMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAK 1026
            + +A H++ +D + +      ++IG+ +     +G+L     +    I   R +   R   +D ++   +     P ++IFPEGTC N + ++ FK G+F  G ++ P+ +++  +L    W          LW +        ++ +LP     E E  +   FA  V+  +AK
Sbjct:  239 ICVANHTSPIDVMVLSCDNCYAMIGQKQAG--FLGFLQTTLSRSEHHIWFERGEAGDRAKVMDRMREHVNDENKLP-IIIFPEGTCINNTSVMMFKKGSFEIGSTIYPIAVKYDTRLTDAFWNSSAQSYGRYLWSMMTSWAIICDVWYLPAMTRGENE--DSISFAKRVKRAIAK 408          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Celegans
Match: acl-5 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q21812])

HSP 1 Score: 59.3066 bits (142), Expect = 4.563e-9
Identity = 39/175 (22.29%), Postives = 78/175 (44.57%), Query Frame = 1
Query:  514 LVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCIGYLL----KMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAK 1026
            + +A H++ +D + +      ++IG+ +     +G+L     +    I   R +   R   +D ++   +     P ++IFPEGTC N + ++ FK G+F  G ++ P+ +++  +L    W          LW +        ++ +LP     E E  +   FA  V+  +AK
Sbjct:  239 ICVANHTSPIDVMVLSCDNCYAMIGQKQAG--FLGFLQTTLSRSEHHIWFERGEAGDRAKVMDRMREHVNDENKLP-IIIFPEGTCINNTSVMMFKKGSFEIGSTIYPIAVKYDTRLTDAFWNSSAQSYGRYLWSMMTSWAIICDVWYLPAMTRGENE--DSISFAKRVKRAIAK 408          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Celegans
Match: acl-5 (ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc:Q21812])

HSP 1 Score: 58.9214 bits (141), Expect = 5.970e-9
Identity = 39/175 (22.29%), Postives = 78/175 (44.57%), Query Frame = 1
Query:  514 LVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCIGYLL----KMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAK 1026
            + +A H++ +D + +      ++IG+ +     +G+L     +    I   R +   R   +D ++   +     P ++IFPEGTC N + ++ FK G+F  G ++ P+ +++  +L    W          LW +        ++ +LP     E E  +   FA  V+  +AK
Sbjct:  182 ICVANHTSPIDVMVLSCDNCYAMIGQKQAG--FLGFLQTTLSRSEHHIWFERGEAGDRAKVMDRMREHVNDENKLP-IIIFPEGTCINNTSVMMFKKGSFEIGSTIYPIAVKYDTRLTDAFWNSSAQSYGRYLWSMMTSWAIICDVWYLPAMTRGENE--DSISFAKRVKRAIAK 351          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Fly
Match: LPCAT (gene:FBgn0052699 transcript:FBtr0110850)

HSP 1 Score: 312.383 bits (799), Expect = 6.118e-99
Identity = 166/393 (42.24%), Postives = 246/393 (62.60%), Query Frame = 1
Query:  208 INPFIYTWNIPWY-QWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRS-PLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETAN-SCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRL-LYLRRDPISMLEWLLETINRIGTDGMVSLQELCH-HIYMTDNEALVERIFKFYDKTNTGFIDIK-----NLFCHL 1356
            INPF++   I  + +  K+ ++T+ ++PIR+VG +++    ++ + I LYG + +D ++ PL+GWRK  M  +     R+ Y FGS H++ +KGR  T KEAPILV+APHS+++DS+ VV  G  S++ K ETA+   +G ++   QPI V REDPNSRQ TI +I  R+   + WPQ++IF EGTCTNR+ LI FK GAF PG  VQPV+L++PNK D+ TWTWDGPGV  LLW+   Q +   EIE+LP+Y PSE+E  +  L+A+NVR +MAKAL VPT+++S+ED   M+ A+   +PF   IVE  R  ++L L   +    + +  L   N    D +++  EL    +  TD    + ++F   D   +G + +K     +LFC L
Sbjct:   50 INPFVHRIEIDSHIEVAKIYVLTVLLLPIRVVGCVLSLISAWMFACIGLYGMTLDDLKAKPLTGWRKQ-MQYMTACGMRMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVDSILVVASGPPSIVAKRETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQVVIFAEGTCTNRTALIKFKPGAFYPGVPVQPVLLKYPNKYDTFTWTWDGPGVLRLLWLTMTQFYNRCEIEYLPVYTPSEDEVADANLYANNVREVMAKALGVPTSDYSFEDVIVMSRARDMKIPFPGDIVEIERTIEKLGLNESQRDAELCKGFLRLSNTDRLD-IITFGELLQVDLKNTD----LHKLFALLDHRRSGTVSLKSFLLCSLFCKL 436          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Fly
Match: Gpat4 (gene:FBgn0034971 transcript:FBtr0072179)

HSP 1 Score: 57.7658 bits (138), Expect = 1.764e-8
Identity = 42/174 (24.14%), Postives = 81/174 (46.55%), Query Frame = 1
Query:  514 LVLAPHSAFLDSLFVVFLGMNSVIGKTETA--NSCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAW-PQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAK 1026
            + +A H++ +D L ++     S+IG+            L + +  I   R +   R    + +K+  H  +   P +LIFPEGTC N + ++ FK G+F  G  + PV +++  +     W      +   L+M+        ++ +LP  +  E E  +   FA+ V++++AK
Sbjct:  250 ICVANHTSPIDVLVLMCDSTYSLIGQRHGGFLGVLQRALARASPHIWFERGEAKDRHLVAERLKQ--HVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVGGVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYRQEGE--SAIDFANRVKSVIAK 419          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Fly
Match: Gpat4 (gene:FBgn0034971 transcript:FBtr0343336)

HSP 1 Score: 57.7658 bits (138), Expect = 2.025e-8
Identity = 42/174 (24.14%), Postives = 81/174 (46.55%), Query Frame = 1
Query:  514 LVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI--GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAW-PQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAK 1026
            + +A H++ +D L ++     S+IG+       +    L + +  I   R +   R    + +K+  H  +   P +LIFPEGTC N + ++ FK G+F  G  + PV +++  +     W      +   L+M+        ++ +LP  +  E E      FA+ V++++AK
Sbjct:  329 ICVANHTSPIDVLVLMCDSTYSLIGQRHGGFLGVLQRALARASPHIWFERGEAKDRHLVAERLKQ--HVSDPNNPPILIFPEGTCINNTSVMQFKKGSFEVGGVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYRQEGESAID--FANRVKSVIAK 498          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Fly
Match: Gpat4 (gene:FBgn0034971 transcript:FBtr0302165)

HSP 1 Score: 55.4546 bits (132), Expect = 8.422e-8
Identity = 29/100 (29.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  727 PQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAK 1026
            P +LIFPEGTC N + ++ FK G+F  G  + PV +++  +     W      +   L+M+        ++ +LP  +  E E  +   FA+ V++++AK
Sbjct:  323 PPILIFPEGTCINNTSVMQFKKGSFEVGGVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYRQEGE--SAIDFANRVKSVIAK 420          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Fly
Match: Gpat4 (gene:FBgn0034971 transcript:FBtr0343337)

HSP 1 Score: 55.0694 bits (131), Expect = 9.762e-8
Identity = 29/100 (29.00%), Postives = 52/100 (52.00%), Query Frame = 1
Query:  727 PQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAK 1026
            P +LIFPEGTC N + ++ FK G+F  G  + PV +++  +     W      +   L+M+        ++ +LP  +  E E  +   FA+ V++++AK
Sbjct:  244 PPILIFPEGTCINNTSVMQFKKGSFEVGGVIYPVAIKYDPRFGDAFWNSAKYSMMQYLYMMMTSWAIVCDVWYLPPMYRQEGE--SAIDFANRVKSVIAK 341          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Zebrafish
Match: lpcat1 (lysophosphatidylcholine acyltransferase 1 [Source:NCBI gene;Acc:555969])

HSP 1 Score: 315.079 bits (806), Expect = 4.077e-100
Identity = 172/424 (40.57%), Postives = 256/424 (60.38%), Query Frame = 1
Query:  211 NPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELC----------HHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLK-DGNI 1446
            NPF++       Q LK+ ++T+T+ P+R++       + +  +F+A  G+S+N    PLS WR  + L L  I  R  +F G  HW++VKGR     EAPIL +APHS++ D++ V  + M S++ K E+ +  + G L+K  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNRSCLI FK GAFIPG  VQPVVLR+PN+LD+I+WTW GPG + +LW+   Q+H FVEIE+LP Y PSEEEK++P LFA NVR IMAKAL +P  ++S+EDC+         LP    ++EF+RL  RLL L+           +  + +  +   S ++LC           +++    EA V+ IF  +++   G +D++     LS+   PF     LD +  A+R+ + + DG I
Sbjct:   25 NPFVHELRFTTLQKLKIAVMTVTLFPVRLLFAAFMMLLAWPFAFVATVGRSENAV-EPLSWWRWLVDLALKAIM-RAMWFSGGFHWVRVKGRPALPSEAPILTMAPHSSYFDAIPVT-MTMASIVMKAESKDIPVWGTLIKFIRPVFVSRSDQDSRRKTVEEIKRRASSNGEWPQIMIFPEGTCTNRSCLIAFKPGAFIPGVPVQPVVLRYPNELDTISWTWQGPGAFKILWLTLCQLHNFVEIEYLPTYTPSEEEKKDPALFASNVRRIMAKALGLPIIDYSFEDCQLAMAKGPLRLPKHTCLLEFARL-VRLLGLK----------TKVTDEVLQEEACSARQLCGRRLDMEGFAQYLHQPMTEA-VQDIFSLFEE--HGMMDVREYVIALSVVCRPFRY---LDTVKLAFRMFEAQEDGAI 428          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Zebrafish
Match: lpcat1 (lysophosphatidylcholine acyltransferase 1 [Source:NCBI gene;Acc:555969])

HSP 1 Score: 315.079 bits (806), Expect = 4.077e-100
Identity = 172/424 (40.57%), Postives = 256/424 (60.38%), Query Frame = 1
Query:  211 NPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELC----------HHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLK-DGNI 1446
            NPF++       Q LK+ ++T+T+ P+R++       + +  +F+A  G+S+N    PLS WR  + L L  I  R  +F G  HW++VKGR     EAPIL +APHS++ D++ V  + M S++ K E+ +  + G L+K  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNRSCLI FK GAFIPG  VQPVVLR+PN+LD+I+WTW GPG + +LW+   Q+H FVEIE+LP Y PSEEEK++P LFA NVR IMAKAL +P  ++S+EDC+         LP    ++EF+RL  RLL L+           +  + +  +   S ++LC           +++    EA V+ IF  +++   G +D++     LS+   PF     LD +  A+R+ + + DG I
Sbjct:   25 NPFVHELRFTTLQKLKIAVMTVTLFPVRLLFAAFMMLLAWPFAFVATVGRSENAV-EPLSWWRWLVDLALKAIM-RAMWFSGGFHWVRVKGRPALPSEAPILTMAPHSSYFDAIPVT-MTMASIVMKAESKDIPVWGTLIKFIRPVFVSRSDQDSRRKTVEEIKRRASSNGEWPQIMIFPEGTCTNRSCLIAFKPGAFIPGVPVQPVVLRYPNELDTISWTWQGPGAFKILWLTLCQLHNFVEIEYLPTYTPSEEEKKDPALFASNVRRIMAKALGLPIIDYSFEDCQLAMAKGPLRLPKHTCLLEFARL-VRLLGLK----------TKVTDEVLQEEACSARQLCGRRLDMEGFAQYLHQPMTEA-VQDIFSLFEE--HGMMDVREYVIALSVVCRPFRY---LDTVKLAFRMFEAQEDGAI 428          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Zebrafish
Match: lpcat2 (lysophosphatidylcholine acyltransferase 2 [Source:NCBI gene;Acc:553683])

HSP 1 Score: 300.827 bits (769), Expect = 1.780e-94
Identity = 161/430 (37.44%), Postives = 255/430 (59.30%), Query Frame = 1
Query:  199 PDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSS 1485
            P VINPF++  ++      K  ++ I ++P+R +  L+   + + +S I  +G+S      P++GWR+ +   +     R+ YFFG    + VKG++ +  EAPIL +APHS+F D++  +  G+ S + + E+  + I G  L+  QP+LV+R DP+SR+ TI EI+RR+     WPQ+LIFPEGTCTNRSCLI FK G F+PG  VQPV++R+PNKLD++TWTW GP    LL +   Q+ T VE+EFLP   P+E EK+ P  FA +VRA+MAK+L +P T+H+YEDCR M  A +  LP    +VEF+++ ++ L L+ D +         I      G ++++E    + +  + AL +++F  +D+   G ID +     +++   P N +   + I  A++L D+ + N   Q    S + S+
Sbjct:   19 PAVINPFVHDLSLSTADITKCFLLGIILVPLRAIFLLLVLMVMWPVSVIITFGQSLKGVVEPMTGWRRFLHRRVMTFLGRM-YFFGMGFKVVVKGKKASTLEAPILAVAPHSSFFDAIACIESGLPSTVSRIESLEAPIFGRFLRCVQPVLVSRTDPDSRRNTIIEIERRAKSAGHWPQVLIFPEGTCTNRSCLITFKQGGFVPGVPVQPVLIRYPNKLDTVTWTWQGPKSARLLLLTLCQLCTTVEVEFLPPQVPTEMEKKCPLKFAQSVRAVMAKSLKLPVTDHTYEDCRLMIAAGELTLPMEAGLVEFTKISRK-LELKWDNVKKELESFANIACSCKGGRITVEEFASFLKLPISPAL-QQLFALFDRNGDGTIDFREYVIGVTVLCRPANNE---EVIQTAFKLFDIDEDNCITQEEFSSLLRSA 442          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Zebrafish
Match: lpcat2 (lysophosphatidylcholine acyltransferase 2 [Source:NCBI gene;Acc:553683])

HSP 1 Score: 300.827 bits (769), Expect = 1.780e-94
Identity = 161/430 (37.44%), Postives = 255/430 (59.30%), Query Frame = 1
Query:  199 PDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSS 1485
            P VINPF++  ++      K  ++ I ++P+R +  L+   + + +S I  +G+S      P++GWR+ +   +     R+ YFFG    + VKG++ +  EAPIL +APHS+F D++  +  G+ S + + E+  + I G  L+  QP+LV+R DP+SR+ TI EI+RR+     WPQ+LIFPEGTCTNRSCLI FK G F+PG  VQPV++R+PNKLD++TWTW GP    LL +   Q+ T VE+EFLP   P+E EK+ P  FA +VRA+MAK+L +P T+H+YEDCR M  A +  LP    +VEF+++ ++ L L+ D +         I      G ++++E    + +  + AL +++F  +D+   G ID +     +++   P N +   + I  A++L D+ + N   Q    S + S+
Sbjct:   19 PAVINPFVHDLSLSTADITKCFLLGIILVPLRAIFLLLVLMVMWPVSVIITFGQSLKGVVEPMTGWRRFLHRRVMTFLGRM-YFFGMGFKVVVKGKKASTLEAPILAVAPHSSFFDAIACIESGLPSTVSRIESLEAPIFGRFLRCVQPVLVSRTDPDSRRNTIIEIERRAKSAGHWPQVLIFPEGTCTNRSCLITFKQGGFVPGVPVQPVLIRYPNKLDTVTWTWQGPKSARLLLLTLCQLCTTVEVEFLPPQVPTEMEKKCPLKFAQSVRAVMAKSLKLPVTDHTYEDCRLMIAAGELTLPMEAGLVEFTKISRK-LELKWDNVKKELESFANIACSCKGGRITVEEFASFLKLPISPAL-QQLFALFDRNGDGTIDFREYVIGVTVLCRPANNE---EVIQTAFKLFDIDEDNCITQEEFSSLLRSA 442          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Zebrafish
Match: lpcat4 (lysophosphatidylcholine acyltransferase 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5777])

HSP 1 Score: 237.654 bits (605), Expect = 1.139e-70
Identity = 133/397 (33.50%), Postives = 225/397 (56.68%), Query Frame = 1
Query:  181 KNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETAN-SCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYS 1368
            KN+ QT    +PFI+  N+   Q ++ +++ + + P+RI   ++ F + + I+ + L G  ++    P+ GWR+ +   + +  +R  +F     W++VKGR+   KEAP+L +APHS+FLD L +   G+  V+ ++E A    IG LL+  Q +LV+R+DP SR+  + +I  R      WPQML+FPEGT TN   LI FK GAF+ G  VQPV+L + ++ D++ WTW G      LW   +QI++ + +EFLP+Y PS EEK+NP+L+A+NV+ +MA+AL VP T++  E      L     LP      E  RL  +  + +    S+++ ++++ +  G   MV+  +L   + + + +    +I   Y K +   +D++ +   +S  S
Sbjct:    3 KNKGQT---AHPFIHEVNLTALQRIQGLVLGVFLFPVRITLAVLFFLLMWPIARLRLAGLPESRRAEPVRGWRRWLFHHVMVFLSRAVFFCVGFLWVRVKGRQAGLKEAPVLAVAPHSSFLDMLVLSVTGLPIVVSRSENAKLPVIGALLEFNQSVLVSRKDPESRKKCVSQICERVTSDGHWPQMLMFPEGTTTNGRALIKFKPGAFVAGVPVQPVLLHYCSQPDTVRWTWKGLSWLGALWHTTSQIYSSITVEFLPVYTPSAEEKQNPELYAENVQKLMARALGVPATDYMMEGFPVQKLGNL-SLPLEPPAQETLRLLHQQGFSKSRVESVMKDMIDSCHS-GEITMVTADQLTTVLGLEEKQT-AAKICSLYSKDD--MVDLRQICLSVSAVS 391          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Xenopus
Match: lgi2 (leucine-rich repeat LGI family member 2 [Source:Xenbase;Acc:XB-GENE-995134])

HSP 1 Score: 332.798 bits (852), Expect = 1.418e-106
Identity = 174/416 (41.83%), Postives = 253/416 (60.82%), Query Frame = 1
Query:  205 VINPFIYTWNIPWYQWLKMVIVTITIMPIRI--VGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGN 1443
            V NPF++       Q  K++ +T+T+ PIR+    F+M     +  +FIA  G+++ D   PLS WRK + L L  I  R  +F G  HW+ VKG++    EAPIL LAPHS++ D++ V  + M S++ K E+ +  + G L+   +P+ V+R D +SR+ T++EI+RRSH    WPQ++IFPEGTCTNRSCLI FK GAFIPG  VQPVVLR+PNK D+ITWTW GPG   +LW+   Q H +VEIEFLP+Y PSEEEK+NP L+A+NVR +MAKAL V  T++++EDC+      +  LP    ++EF+RL + L          L+   E+  R      ++L E   ++Y+ D E L + +F  +D+   G ID++     LS+   P      L+ I  A+++   +DG 
Sbjct:   28 VRNPFVHDLRFSPLQKAKILFMTLTVFPIRLFFAAFMMLLAWPF--AFIAAMGRTEKDLEKPLSWWRKVLDLLLKAIM-RTMWFAGGFHWVTVKGQQALPAEAPILTLAPHSSYFDAIPVT-MTMASIVMKAESKDIPVWGTLINYIRPVFVSRSDQDSRKKTVEEIRRRSHSNGRWPQVMIFPEGTCTNRSCLITFKPGAFIPGVPVQPVVLRYPNKADTITWTWQGPGAMKILWLSLCQFHNYVEIEFLPIYTPSEEEKKNPALYANNVRRVMAKALGVSVTDYTFEDCQLALAEGQLRLPSDTSLLEFARLVRSLGLKPEKLEKELDAFCESA-RKRNGKKITLHEFAAYLYVPDTEKLAD-LFALFDENEEGTIDLREYVIALSVVCRPSK---TLETIKLAFKMYQSEDGK 434          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Xenopus
Match: ackr4 (atypical chemokine receptor 4 [Source:Xenbase;Acc:XB-GENE-6258927])

HSP 1 Score: 324.709 bits (831), Expect = 3.321e-103
Identity = 169/418 (40.43%), Postives = 262/418 (62.68%), Query Frame = 1
Query:  199 PDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDL-KDGNI 1446
            P + NPF++  N+     LKMV+  + ++P+R++ F++   +++L++ IA     + +   PL GWR+ +   L     RL +F    H ++VKG+  T  +APIL++APHS+F D++ V+  GM S + + E  +  I G +L+  QP+LV+R DP+SR+ TI+EIK+R+  G  WPQ+LIFPEGTCTNRSCLI+FK GAF PG  VQP++LR+PN  D++TWTW G  V  LL +   QI T V +EFLP+Y PSEEEK++P L+A NVR  MA+AL +P T+H+YEDCR M  A +  LP    +VEF+++ K+ L L+ D I     +  +I      G + ++E  +H+ +  ++ L E +F  +D+   G ID +     +++   P N +   + I  A++L D+ +DG+I
Sbjct:   41 PQIPNPFVHEINLSPVNKLKMVLCGLFLLPLRVILFMIVLLVSWLVAAIATCCCPEKN-EKPLEGWRRKVTQTLIGSLGRLLFFSMGFH-VRVKGKPATPSDAPILLVAPHSSFFDAIAVIVSGMPSSVSRAENISVPIFGRILRALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQVLIFPEGTCTNRSCLISFKPGAFHPGVPVQPILLRYPNIQDTVTWTWQGFSVEKLLLLTLCQICTNVTVEFLPVYVPSEEEKKDPFLYAHNVRHTMAQALGLPVTDHTYEDCRLMMTAGELTLPMETGLVEFTKISKK-LNLKWDSIKKQLEVFASIAGSCKGGRIGIEEFANHLKLPVSDVLRE-LFSLFDRNKDGTIDFREYVIGVAILCNPANTE---ETIKMAFKLFDVDEDGSI 451          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Xenopus
Match: ackr4 (atypical chemokine receptor 4 [Source:Xenbase;Acc:XB-GENE-6258927])

HSP 1 Score: 323.939 bits (829), Expect = 3.954e-103
Identity = 169/418 (40.43%), Postives = 262/418 (62.68%), Query Frame = 1
Query:  199 PDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDL-KDGNI 1446
            P + NPF++  N+     LKMV+  + ++P+R++ F++   +++L++ IA     + +   PL GWR+ +   L     RL +F    H ++VKG+  T  +APIL++APHS+F D++ V+  GM S + + E  +  I G +L+  QP+LV+R DP+SR+ TI+EIK+R+  G  WPQ+LIFPEGTCTNRSCLI+FK GAF PG  VQP++LR+PN  D++TWTW G  V  LL +   QI T V +EFLP+Y PSEEEK++P L+A NVR  MA+AL +P T+H+YEDCR M  A +  LP    +VEF+++ K+ L L+ D I     +  +I      G + ++E  +H+ +  ++ L E +F  +D+   G ID +     +++   P N +   + I  A++L D+ +DG+I
Sbjct:   26 PQIPNPFVHEINLSPVNKLKMVLCGLFLLPLRVILFMIVLLVSWLVAAIATCCCPEKN-EKPLEGWRRKVTQTLIGSLGRLLFFSMGFH-VRVKGKPATPSDAPILLVAPHSSFFDAIAVIVSGMPSSVSRAENISVPIFGRILRALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQVLIFPEGTCTNRSCLISFKPGAFHPGVPVQPILLRYPNIQDTVTWTWQGFSVEKLLLLTLCQICTNVTVEFLPVYVPSEEEKKDPFLYAHNVRHTMAQALGLPVTDHTYEDCRLMMTAGELTLPMETGLVEFTKISKK-LNLKWDSIKKQLEVFASIAGSCKGGRIGIEEFANHLKLPVSDVLRE-LFSLFDRNKDGTIDFREYVIGVAILCNPANTE---ETIKMAFKLFDVDEDGSI 436          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Xenopus
Match: ackr4 (atypical chemokine receptor 4 [Source:Xenbase;Acc:XB-GENE-6258927])

HSP 1 Score: 323.553 bits (828), Expect = 1.662e-102
Identity = 169/418 (40.43%), Postives = 262/418 (62.68%), Query Frame = 1
Query:  199 PDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDL-KDGNI 1446
            P + NPF++  N+     LKMV+  + ++P+R++ F++   +++L++ IA     + +   PL GWR+ +   L     RL +F    H ++VKG+  T  +APIL++APHS+F D++ V+  GM S + + E  +  I G +L+  QP+LV+R DP+SR+ TI+EIK+R+  G  WPQ+LIFPEGTCTNRSCLI+FK GAF PG  VQP++LR+PN  D++TWTW G  V  LL +   QI T V +EFLP+Y PSEEEK++P L+A NVR  MA+AL +P T+H+YEDCR M  A +  LP    +VEF+++ K+ L L+ D I     +  +I      G + ++E  +H+ +  ++ L E +F  +D+   G ID +     +++   P N +   + I  A++L D+ +DG+I
Sbjct:   54 PQIPNPFVHEINLSPVNKLKMVLCGLFLLPLRVILFMIVLLVSWLVAAIATCCCPEKN-EKPLEGWRRKVTQTLIGSLGRLLFFSMGFH-VRVKGKPATPSDAPILLVAPHSSFFDAIAVIVSGMPSSVSRAENISVPIFGRILRALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQVLIFPEGTCTNRSCLISFKPGAFHPGVPVQPILLRYPNIQDTVTWTWQGFSVEKLLLLTLCQICTNVTVEFLPVYVPSEEEKKDPFLYAHNVRHTMAQALGLPVTDHTYEDCRLMMTAGELTLPMETGLVEFTKISKK-LNLKWDSIKKQLEVFASIAGSCKGGRIGIEEFANHLKLPVSDVLRE-LFSLFDRNKDGTIDFREYVIGVAILCNPANTE---ETIKMAFKLFDVDEDGSI 464          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Xenopus
Match: ackr4 (atypical chemokine receptor 4 [Source:Xenbase;Acc:XB-GENE-6258927])

HSP 1 Score: 300.056 bits (767), Expect = 4.263e-94
Identity = 163/418 (39.00%), Postives = 254/418 (60.77%), Query Frame = 1
Query:  199 PDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDL-KDGNI 1446
            P + NPF++  N+     LKMV+  + ++P+R++ F++   +++L++ IA     + +   PL GWR+ +   L     RL +F    H ++VKG+  T  +APIL++APHS+F D++ V+  GM S + + E  +  I G +L+  QP+LV+R DP+SR+ TI+EIK+R+  G  WPQ+LIFPEGTCTNRSCLI+FK GAF PG  VQP++LR+PN             V  LL +   QI T V +EFLP+Y PSEEEK++P L+A NVR  MA+AL +P T+H+YEDCR M  A +  LP    +VEF+++ K+ L L+ D I     +  +I      G + ++E  +H+ +  ++ L E +F  +D+   G ID +     +++   P N +   + I  A++L D+ +DG+I
Sbjct:   23 PQIPNPFVHEINLSPVNKLKMVLCGLFLLPLRVILFMIVLLVSWLVAAIATCCCPEKN-EKPLEGWRRKVTQTLIGSLGRLLFFSMGFH-VRVKGKPATPSDAPILLVAPHSSFFDAIAVIVSGMPSSVSRAENISVPIFGRILRALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQVLIFPEGTCTNRSCLISFKPGAFHPGVPVQPILLRYPNI-----------QVEKLLLLTLCQICTNVTVEFLPVYVPSEEEKKDPFLYAHNVRHTMAQALGLPVTDHTYEDCRLMMTAGELTLPMETGLVEFTKISKK-LNLKWDSIKKQLEVFASIAGSCKGGRIGIEEFANHLKLPVSDVLRE-LFSLFDRNKDGTIDFREYVIGVAILCNPANTE---ETIKMAFKLFDVDEDGSI 422          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Mouse
Match: Lpcat1 (lysophosphatidylcholine acyltransferase 1 [Source:MGI Symbol;Acc:MGI:2384812])

HSP 1 Score: 311.997 bits (798), Expect = 1.190e-98
Identity = 180/485 (37.11%), Postives = 269/485 (55.46%), Query Frame = 1
Query:  166 STFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSSDEAMEIISFTKFHQSPGQPFLNTLDTIMSIGGPFNMYSDYHSEY 1617
            S+     R   P   NPF++   +   Q  ++  +T+T+ PIR++       + +  + +A  G  D +   PL+ WRK +   L  I  R  +F G  H + VKGR+    EA IL LAPHS++ D++ V  + M+S++ K E+ +  I G L++  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNR+CLI FK GAFIPG  VQPVVLR+PNKLD+ITWTW GPG   +LW+   Q    VEIEFLP+Y PSEEEKRNP L+A NVR +MAKAL V  T++++EDC+      +  LP    ++EF+RL + L     +    L+   E+  R+     + L E   ++ +  ++AL E +F  +D++  G ID++     LS+   P      +    K Y     +DG+I    L  S +L +   +  ++ T   Q+  Q     + T     G   MY DY  +Y
Sbjct:   15 SSGAGDARRLAPPGRNPFVHELRLSALQKAQVAFMTLTLFPIRLLFAAFMMLLAWPFALLASLGPPDKEPEQPLALWRKVVDFLLKAIM-RTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVT-MTMSSIVMKAESRDIPIWGTLIRYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGVPVQPVVLRYPNKLDTITWTWQGPGALKILWLTLCQFQNQVEIEFLPVYCPSEEEKRNPALYASNVRRVMAKALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPENLEKDLDKYSESA-RMKRGEKIRLPEFAAYLEVPVSDAL-EDMFSLFDESGGGEIDLREYVVALSVVCRPSQTLATIQLAFKMY--GSPEDGSIDEANL--SCILKTALGVSELTVTDLFQAIDQEDKGRI-TFDDFCGFAEMYPDYAEDY 490          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Mouse
Match: Lpcat1 (lysophosphatidylcholine acyltransferase 1 [Source:MGI Symbol;Acc:MGI:2384812])

HSP 1 Score: 301.597 bits (771), Expect = 2.712e-95
Identity = 173/451 (38.36%), Postives = 256/451 (56.76%), Query Frame = 1
Query:  268 VTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSSDEAMEIISFTKFHQSPGQPFLNTLDTIMSIGGPFNMYSDYHSEY 1617
            +T+T+ PIR++       + +  + +A  G  D +   PL+ WRK +   L  I  R  +F G  H + VKGR+    EA IL LAPHS++ D++ V  + M+S++ K E+ +  I G L++  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNR+CLI FK GAFIPG  VQPVVLR+PNKLD+ITWTW GPG   +LW+   Q    VEIEFLP+Y PSEEEKRNP L+A NVR +MAKAL V  T++++EDC+      +  LP    ++EF+RL + L     +    L+   E+  R+     + L E   ++ +  ++AL E +F  +D++  G ID++     LS+   P      +    K Y     +DG+I    L  S +L +   +  ++ T   Q+  Q     + T     G   MY DY  +Y
Sbjct:    1 MTLTLFPIRLLFAAFMMLLAWPFALLASLGPPDKEPEQPLALWRKVVDFLLKAIM-RTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVT-MTMSSIVMKAESRDIPIWGTLIRYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGVPVQPVVLRYPNKLDTITWTWQGPGALKILWLTLCQFQNQVEIEFLPVYCPSEEEKRNPALYASNVRRVMAKALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPENLEKDLDKYSESA-RMKRGEKIRLPEFAAYLEVPVSDAL-EDMFSLFDESGGGEIDLREYVVALSVVCRPSQTLATIQLAFKMY--GSPEDGSIDEANL--SCILKTALGVSELTVTDLFQAIDQEDKGRI-TFDDFCGFAEMYPDYAEDY 442          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Mouse
Match: Lpcat2 (lysophosphatidylcholine acyltransferase 2 [Source:MGI Symbol;Acc:MGI:3606214])

HSP 1 Score: 301.212 bits (770), Expect = 1.854e-94
Identity = 162/402 (40.30%), Postives = 239/402 (59.45%), Query Frame = 1
Query:  253 LKMVIVTITIMPIR--IVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANS-CIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDL-KDGNI 1446
            L+M ++ I ++P+R  +VG ++     + +   A           P+S WR+ I  P     AR   FF     + VKG+  +  EAPI V+APHS F D +  V  G+ S++ + E A +  +G LL+  QP+LV+R DP+SR+ TI+EIK+R+  G  WPQ+L+FPEGTCTNRSCLI FK GAFIPG  VQPV+LR+PNKLD++TWTW G     L  + F Q+ T VEIEF+P+  PSEEEK +P LFA  +R +MA+AL +P T+H+YEDCR M  A +  LP    +VEFS++ ++ L L  D I        +I      G + ++E   ++ +  ++ L  ++F  +D+ N G ID +     L++   P N +   + I  A++L D+ +DG I
Sbjct:   56 LQMFLLGIILLPVRALLVGIILLLAWPFAVISTAC---CPEKLTHPISNWRRKITRPALTFLAR-AMFFSMGFTVTVKGKVASPLEAPIFVVAPHSTFFDGIACVVAGLPSLVSRNENAQTPLVGRLLRALQPVLVSRVDPDSRKNTINEIKKRATSGGEWPQILVFPEGTCTNRSCLITFKPGAFIPGVPVQPVLLRYPNKLDTVTWTWQGYTFLQLCVLTFCQLFTKVEIEFMPVQAPSEEEKNDPVLFASRIRNLMAEALEIPVTDHTYEDCRLMISAGQLTLPMEAGLVEFSKISRK-LKLDWDGIRKHLDEYASIASSSKGGRIGIEEFAEYLKLPVSDVL-RQLFALFDRNNDGSIDFREYVIGLAVLCNPANTE---EIIQVAFKLFDVDEDGYI 448          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Mouse
Match: Lpcat2b (lysophosphatidylcholine acyltransferase 2B [Source:MGI Symbol;Acc:MGI:1918152])

HSP 1 Score: 286.96 bits (733), Expect = 2.751e-89
Identity = 155/422 (36.73%), Postives = 243/422 (57.58%), Query Frame = 1
Query:  199 PDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVL 1461
            P V +PF    ++  ++W   +I+   ++P+R+   +    + + ++ ++         + P+  WRK+++    +   RL +FF     +KVKG++ TR+EAPI V APHS F D++ VV  G+ SV+  ++ A   + G  + +TQP+LV REDPNSR+TT +EI RR      WPQ+LIFPEG CTNRSCL+ FK GAF PG  VQPV+LR+PN LD++TWTW+G   + +  +  +Q+ T VE+EF+P+Y PSEEEK++P LFA+ VR  MA AL +P T+HS EDC+ M  A    LP    +VEF+++ ++ L L  D I        +       G + ++    ++ +  +E L  ++F  +D+   G ID +     L++   P N +  L    K + L +  DG +  + L
Sbjct:   34 PAVDSPFTLNTHLSAWRWACTIILGTVLVPVRVSCIVFLLILLWPVAVLSAINLPTQPTK-PIRRWRKHLIKSALVFLFRLGFFFAGF-LVKVKGKKATREEAPIFVSAPHSTFFDAIAVVVAGLPSVVSDSQLARVPLAGKCILVTQPVLVKREDPNSRKTTRNEILRRVKSKMKWPQILIFPEGLCTNRSCLVTFKLGAFSPGVPVQPVLLRYPNSLDTVTWTWNGFSGFQVCMLTLSQLFTRVEVEFMPVYIPSEEEKKDPILFANTVRIKMANALKLPVTDHSLEDCKLMISAGALQLPMEAGLVEFTKISQK-LKLDWDNIHKHLDQYASFAVSSKGGKIGIEAFSRYLKLPISEPL-RQLFSLFDRNQDGTIDFREYVIGLTVLCNPSNTEKILQMSFKLFDLDE--DGYVTEREL 449          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Mouse
Match: Lpcat4 (lysophosphatidylcholine acyltransferase 4 [Source:MGI Symbol;Acc:MGI:2138993])

HSP 1 Score: 232.646 bits (592), Expect = 1.419e-68
Identity = 125/394 (31.73%), Postives = 224/394 (56.85%), Query Frame = 1
Query:  211 NPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETAN-SCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKI 1389
            NPF++  ++   Q +K  ++ + + PIR++   +   + +  +++ + G ++   + P++GWRK +     L  +RL +F      I+V+G+R +R EAP+LV APHS F D + ++   +  V+ + E  +   IG LL+  Q ILV+R DP SR+  ++E++RR+  G  WPQ+L FPEGTC+N+  L+ FK GAFI G  VQPV++R+PN LD+ +W W GPGV  +LW+  +Q  + V++EFLP+Y PS EE ++P L+A+NV+ +MA+AL +P T   +     + +  +  +     + E +++ ++          +    ++     G   M+S +     + ++D +  V   F ++ +   G +D +N+   L+L +L   R +
Sbjct:   23 NPFVHELHLSGLQRVKFCLLGVLLAPIRVLLAFIVLFLLWPFAWLQVAGLTEEQLQEPITGWRKTVCHNGVLGLSRLLFFLLGFLRIRVRGQRASRLEAPVLVAAPHSTFFDPIVLLPCDLPKVVSRAENLSVPVIGALLRFNQAILVSRHDPASRRRVVEEVRRRATSGGKWPQVLFFPEGTCSNKKALLKFKPGAFIAGVPVQPVLIRYPNSLDTTSWAWRGPGVLKVLWLTASQPCSIVDVEFLPVYQPSLEESKDPTLYANNVQRVMAQALGIPATECEFVGSLPVIVVGQLKVALEPQLWELAKVLQK--------AGLSPGFVDMGAEPGRSRMISQEAFAQQLQLSDPQT-VAGAFSYFQQDAKGLVDFRNV--ALALAALDGGRSL 405          
BLAST of Lysophosphatidylcholine acyltransferase vs. UniProt/SwissProt
Match: sp|Q1LWG4|PCAT1_DANRE (Lysophosphatidylcholine acyltransferase 1 OS=Danio rerio OX=7955 GN=lpcat1 PE=2 SV=1)

HSP 1 Score: 315.079 bits (806), Expect = 3.077e-99
Identity = 172/424 (40.57%), Postives = 256/424 (60.38%), Query Frame = 1
Query:  211 NPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELC----------HHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLK-DGNI 1446
            NPF++       Q LK+ ++T+T+ P+R++       + +  +F+A  G+S+N    PLS WR  + L L  I  R  +F G  HW++VKGR     EAPIL +APHS++ D++ V  + M S++ K E+ +  + G L+K  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNRSCLI FK GAFIPG  VQPVVLR+PN+LD+I+WTW GPG + +LW+   Q+H FVEIE+LP Y PSEEEK++P LFA NVR IMAKAL +P  ++S+EDC+         LP    ++EF+RL  RLL L+           +  + +  +   S ++LC           +++    EA V+ IF  +++   G +D++     LS+   PF     LD +  A+R+ + + DG I
Sbjct:   25 NPFVHELRFTTLQKLKIAVMTVTLFPVRLLFAAFMMLLAWPFAFVATVGRSENAV-EPLSWWRWLVDLALKAIM-RAMWFSGGFHWVRVKGRPALPSEAPILTMAPHSSYFDAIPVT-MTMASIVMKAESKDIPVWGTLIKFIRPVFVSRSDQDSRRKTVEEIKRRASSNGEWPQIMIFPEGTCTNRSCLIAFKPGAFIPGVPVQPVVLRYPNELDTISWTWQGPGAFKILWLTLCQLHNFVEIEYLPTYTPSEEEKKDPALFASNVRRIMAKALGLPIIDYSFEDCQLAMAKGPLRLPKHTCLLEFARL-VRLLGLK----------TKVTDEVLQEEACSARQLCGRRLDMEGFAQYLHQPMTEA-VQDIFSLFEE--HGMMDVREYVIALSVVCRPFRY---LDTVKLAFRMFEAQEDGAI 428          
BLAST of Lysophosphatidylcholine acyltransferase vs. UniProt/SwissProt
Match: sp|Q0KHU5|PCAT_DROME (Lysophosphatidylcholine acyltransferase OS=Drosophila melanogaster OX=7227 GN=LPCAT PE=2 SV=1)

HSP 1 Score: 312.383 bits (799), Expect = 6.133e-98
Identity = 166/393 (42.24%), Postives = 246/393 (62.60%), Query Frame = 1
Query:  208 INPFIYTWNIPWY-QWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRS-PLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETAN-SCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRL-LYLRRDPISMLEWLLETINRIGTDGMVSLQELCH-HIYMTDNEALVERIFKFYDKTNTGFIDIK-----NLFCHL 1356
            INPF++   I  + +  K+ ++T+ ++PIR+VG +++    ++ + I LYG + +D ++ PL+GWRK  M  +     R+ Y FGS H++ +KGR  T KEAPILV+APHS+++DS+ VV  G  S++ K ETA+   +G ++   QPI V REDPNSRQ TI +I  R+   + WPQ++IF EGTCTNR+ LI FK GAF PG  VQPV+L++PNK D+ TWTWDGPGV  LLW+   Q +   EIE+LP+Y PSE+E  +  L+A+NVR +MAKAL VPT+++S+ED   M+ A+   +PF   IVE  R  ++L L   +    + +  L   N    D +++  EL    +  TD    + ++F   D   +G + +K     +LFC L
Sbjct:   50 INPFVHRIEIDSHIEVAKIYVLTVLLLPIRVVGCVLSLISAWMFACIGLYGMTLDDLKAKPLTGWRKQ-MQYMTACGMRMVYTFGSFHYVTMKGRAATAKEAPILVVAPHSSYVDSILVVASGPPSIVAKRETADIPLLGKIINYAQPIYVQREDPNSRQNTIRDIVDRARSTDDWPQVVIFAEGTCTNRTALIKFKPGAFYPGVPVQPVLLKYPNKYDTFTWTWDGPGVLRLLWLTMTQFYNRCEIEYLPVYTPSEDEVADANLYANNVREVMAKALGVPTSDYSFEDVIVMSRARDMKIPFPGDIVEIERTIEKLGLNESQRDAELCKGFLRLSNTDRLD-IITFGELLQVDLKNTD----LHKLFALLDHRRSGTVSLKSFLLCSLFCKL 436          
BLAST of Lysophosphatidylcholine acyltransferase vs. UniProt/SwissProt
Match: sp|Q3TFD2|PCAT1_MOUSE (Lysophosphatidylcholine acyltransferase 1 OS=Mus musculus OX=10090 GN=Lpcat1 PE=1 SV=1)

HSP 1 Score: 311.997 bits (798), Expect = 8.322e-98
Identity = 180/485 (37.11%), Postives = 269/485 (55.46%), Query Frame = 1
Query:  166 STFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSSDEAMEIISFTKFHQSPGQPFLNTLDTIMSIGGPFNMYSDYHSEY 1617
            S+     R   P   NPF++   +   Q  ++  +T+T+ PIR++       + +  + +A  G  D +   PL+ WRK +   L  I  R  +F G  H + VKGR+    EA IL LAPHS++ D++ V  + M+S++ K E+ +  I G L++  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNR+CLI FK GAFIPG  VQPVVLR+PNKLD+ITWTW GPG   +LW+   Q    VEIEFLP+Y PSEEEKRNP L+A NVR +MAKAL V  T++++EDC+      +  LP    ++EF+RL + L     +    L+   E+  R+     + L E   ++ +  ++AL E +F  +D++  G ID++     LS+   P      +    K Y     +DG+I    L  S +L +   +  ++ T   Q+  Q     + T     G   MY DY  +Y
Sbjct:   15 SSGAGDARRLAPPGRNPFVHELRLSALQKAQVAFMTLTLFPIRLLFAAFMMLLAWPFALLASLGPPDKEPEQPLALWRKVVDFLLKAIM-RTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVT-MTMSSIVMKAESRDIPIWGTLIRYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGVPVQPVVLRYPNKLDTITWTWQGPGALKILWLTLCQFQNQVEIEFLPVYCPSEEEKRNPALYASNVRRVMAKALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPENLEKDLDKYSESA-RMKRGEKIRLPEFAAYLEVPVSDAL-EDMFSLFDESGGGEIDLREYVVALSVVCRPSQTLATIQLAFKMY--GSPEDGSIDEANL--SCILKTALGVSELTVTDLFQAIDQEDKGRI-TFDDFCGFAEMYPDYAEDY 490          
BLAST of Lysophosphatidylcholine acyltransferase vs. UniProt/SwissProt
Match: sp|Q1HAQ0|PCAT1_RAT (Lysophosphatidylcholine acyltransferase 1 OS=Rattus norvegicus OX=10116 GN=Lpcat1 PE=2 SV=2)

HSP 1 Score: 311.612 bits (797), Expect = 1.030e-97
Identity = 179/485 (36.91%), Postives = 269/485 (55.46%), Query Frame = 1
Query:  166 STFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSSDEAMEIISFTKFHQSPGQPFLNTLDTIMSIGGPFNMYSDYHSEY 1617
            S+     R   P   NPF++   +   Q  ++  +T+T+ PIR++       + +  + +A  G  D +   PL+ WRK +   L  I  R  +F G  H + VKGR+    EA IL LAPHS++ D++ V  + M+S++ K E+ +  I G L++  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNR+CLI FK GAFIPG  VQPVVLR+PNKLD+ITWTW GPG   +LW+   Q    VEIEFLP+Y PSEEEKRNP L+A NVR +MAKAL V  T++++EDC+      +  LP    ++EF+RL + L     +    L+   E+  R+     + L E   ++ +  ++AL E +F  +D++  G ID++     LS+   P      +    K Y     +DG+I    L  S +L +   +  ++ T   Q+  Q     + T     G   MY D+  +Y
Sbjct:   15 SSGAGDARRLAPPGRNPFVHELRLSALQKAQVAFMTLTLFPIRLLFAAFMMLLAWPFALVASLGPPDKEPEQPLALWRKVVDFLLKAIM-RTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVT-MTMSSIVMKAESRDIPIWGTLIRYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGVPVQPVVLRYPNKLDTITWTWQGPGALKILWLTLCQFQNQVEIEFLPVYCPSEEEKRNPALYASNVRRVMAKALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARLVRGLGLKPENLEKDLDKYSESA-RMKRGEKIRLPEFAAYLEVPVSDAL-EDMFSLFDESGGGEIDLREYVVALSVVCRPSQTLATIQLAFKMY--GSPEDGSIDEADL--SCILKTALGISELTVTDLFQAIDQEERGRI-TFDDFCGFAEMYPDFAEDY 490          
BLAST of Lysophosphatidylcholine acyltransferase vs. UniProt/SwissProt
Match: sp|Q8NF37|PCAT1_HUMAN (Lysophosphatidylcholine acyltransferase 1 OS=Homo sapiens OX=9606 GN=LPCAT1 PE=1 SV=2)

HSP 1 Score: 307.76 bits (787), Expect = 2.891e-96
Identity = 160/424 (37.74%), Postives = 251/424 (59.20%), Query Frame = 1
Query:  187 RTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQ 1455
            R   P   NPF++   +   Q  ++ ++T+T+ P+R++       + + ++ +A  G ++ +   P + WRK +   L  I  R  +F G  H + VKGR+    EA IL LAPHS++ D++ V  + M+S++ K E+ +  I G L++  +P+ V+R D +SR+ T++EIKRR+     WPQ++IFPEGTCTNR+CLI FK GAFIPG  VQPVVLR+PNKLD+ITWTW GPG   +LW+   Q H  VEIEFLP+Y PSEEEKRNP L+A NVR +MA+AL V  T++++EDC+      +  LP    ++EF+RL  R L L+ + +           R+     + + E    + +  ++ L+E +F  +D++ +G +D++     LS+   P      LD I  A+++   ++    G+
Sbjct:   22 RLLAPPGRNPFVHELRLSALQKAQVALMTLTLFPVRLLVAAAMMLLAWPLALVASLGSAEKEPEQPPALWRKVVDFLLKAIM-RTMWFAGGFHRVAVKGRQALPTEAAILTLAPHSSYFDAIPVT-MTMSSIVMKAESRDIPIWGTLIQYIRPVFVSRSDQDSRRKTVEEIKRRAQSNGKWPQIMIFPEGTCTNRTCLITFKPGAFIPGAPVQPVVLRYPNKLDTITWTWQGPGALEILWLTLCQFHNQVEIEFLPVYSPSEEEKRNPALYASNVRRVMAEALGVSVTDYTFEDCQLALAEGQLRLPADTCLLEFARL-VRGLGLKPEKLEKDLDRYSERARMKGGEKIGIAEFAASLEVPVSD-LLEDMFSLFDESGSGEVDLRECVVALSVVCRPAR---TLDTIQLAFKMYGAQEDGSVGE 438          
BLAST of Lysophosphatidylcholine acyltransferase vs. TrEMBL
Match: K1QLU4 (Lysophosphatidylcholine acyltransferase 2 OS=Crassostrea gigas OX=29159 GN=CGI_10011210 PE=4 SV=1)

HSP 1 Score: 385.571 bits (989), Expect = 1.986e-124
Identity = 196/432 (45.37%), Postives = 278/432 (64.35%), Query Frame = 1
Query:  256 KMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANS-CIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIA-------GQVLKKSFMLSSDEAMEIISFTKFHQ 1527
            ++V ++ITI P+R+V   + FG+ +L++ I+L  ++  + + PL GWR N + PL +  +R  +F G  HW+ VKG + T KEAPI+ LAPHS+FLD+L +V+L +++V+ K ET+ +  +G L++ TQP+LV REDPNSR  TI EI +R+H G  WPQ++IFPEGTCTNRSCLINFK+GAF PG  VQPV++R+PN+LD++TWTW+GPG + LLW    Q  T VEIEFLP+Y PSEEEK+N  LFA NVRA MA+AL VP T+HSY+DCR M  A K  LP +  IVEF +L K+L     D   +L+         G D  ++  E   ++++  ++AL E +F  YD+  +G ID +     LSL S P N +   D I  A++L D  +GN         G +L K+F +   +A  +      +Q
Sbjct:   29 QIVFMSITIAPVRLVSLALLFGLAWLLAAISLAYRTPEEKKKPLEGWR-NSLRPLVVFVSRCVFFVGGFHWLTVKGEQHTAKEAPIIALAPHSSFLDALVIVYLNLSTVVAKQETSRAPVLGTLIEYTQPVLVKREDPNSRTNTIKEIHKRAHSGGKWPQIIIFPEGTCTNRSCLINFKSGAFYPGTPVQPVLIRYPNQLDTVTWTWEGPGAFALLWYTLCQFRTNVEIEFLPVYTPSEEEKKNAALFASNVRAKMAEALGVPVTDHSYDDCRLMQKAAKLKLPKSAGIVEFMKLNKKLGLKFDDANDLLDKYYAIAKDSGGD--ITYDEFAKYLHLPKSDAL-EEVFNLYDRNGSGTIDFREYVIGLSLVSSPENTE---DTIKFAFQLFD--EGNKGYITKEELGIILHKAFNMDGLDADALFEEVDLNQ 451          
BLAST of Lysophosphatidylcholine acyltransferase vs. TrEMBL
Match: A0A2R2MM86 (lysophosphatidylcholine acyltransferase 2 OS=Lingula unguis OX=7574 GN=LOC106159406 PE=4 SV=1)

HSP 1 Score: 377.096 bits (967), Expect = 7.516e-121
Identity = 192/439 (43.74%), Postives = 273/439 (62.19%), Query Frame = 1
Query:  199 PDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISF--IALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETAN-SCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSD------LKDGNIAGQVLKKSFMLSSD 1488
            P+VINPF++   + W++ L++ I+++TI PIR+V   +   + + ++   +A   K + +   P+ GWR+ I+  L     R  +F G  HWI  +G+R +  EAPILV APHS+F+D L  +   M +V+ K++T N    G L   TQPI V+REDPNSRQ TI EIKRR+     WPQ+++FPEGTCTNRSCLI FK G F PG  VQPV LR+PN+LD+ TWTW+GPG +TL W+   QIH   E+E+LP+Y P+EEE  +PKLFA NVR  M K LNVP T+H+++DCR MT A K  LP    IVEF+++ K+L        +MLE   +     G +G +++QEL  H+ +  +EAL E +F  YD+ N+G ID +     LSL S P N +   D I  A++L D      L + ++A Q+L  +F +  +
Sbjct:   16 PEVINPFVHDLQLTWWEKLQVAIMSVTIAPIRLVSLCVILLLAWPVAAFAVAFRSKEEKEQIVPVRGWRR-ILHKLCCFLYRSVFFLGGFHWIPFRGQRASAAEAPILVAAPHSSFVDVLLSIVTDMTTVVAKSDTKNIPLFGTLATFTQPIWVSREDPNSRQNTIKEIKRRAQSKGEWPQIIVFPEGTCTNRSCLITFKPGGFYPGVPVQPVCLRFPNRLDTYTWTWEGPGAFTLFWLTLCQIHNRFEVEYLPVYKPNEEEIADPKLFAKNVREQMTKCLNVPATDHTFDDCRLMTYAAKLKLPMASGIVEFNKVNKKLGITFEAAKAMLEKFRQI--HTGKEGKITVQELAEHLNLPVSEAL-EDVFNMYDRDNSGTIDFREYVIGLSLVSGPANTE---DTIQLAFQLFDSEGKGYLSESDLA-QMLHNAFGMDEE 446          
BLAST of Lysophosphatidylcholine acyltransferase vs. TrEMBL
Match: A0A1S3H618 (lysophosphatidylcholine acyltransferase 2-like isoform X2 OS=Lingula unguis OX=7574 GN=LOC106152427 PE=4 SV=1)

HSP 1 Score: 374.015 bits (959), Expect = 1.123e-119
Identity = 190/439 (43.28%), Postives = 273/439 (62.19%), Query Frame = 1
Query:  199 PDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISF--IALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETAN-SCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSD------LKDGNIAGQVLKKSFMLSSD 1488
            P+VINPF++   + W++ L++ I+++TI PIR+V   +   + + ++   +A   K + +   P+ GWR+ I+  +     R  +F G  HWI  +G+R +  EAPILV APHS+F+D L  +   M +V+ K++T      G L   TQPI V+REDPNSRQ TI EIKRR+     WPQ+++FPEGTCTNRSCLI FK G F PG  VQPV LR+PN+LD+ TWTW+GPG +TL W+   QIH   E+E+LP+Y P+EEE  +PKLFA NVR  M K LNVP T+H+++DCR MT A K  LP    IVEF+++ K+L        +MLE   +     G +G +++QEL  H+ +  +EAL E +F  YD+ N+G ID +     LSL S P N +   D I  A++L D      L + ++A Q+L  +F ++ +
Sbjct:   16 PEVINPFVHDLQLTWWEKLQVAIMSVTIAPIRLVSLCVILLLAWPVAAFAVAFRSKEEKEQIVPVRGWRR-ILHKVCCFLYRSVFFVGGFHWIPFRGQRASAAEAPILVAAPHSSFVDVLLSIVTDMTTVVAKSDTKKIPLFGTLATFTQPIWVSREDPNSRQNTIKEIKRRAQSKGEWPQIIVFPEGTCTNRSCLITFKPGGFYPGVPVQPVCLRFPNRLDTYTWTWEGPGAFTLFWLTLCQIHNRFEVEYLPVYKPNEEEIADPKLFAKNVREQMTKCLNVPATDHTFDDCRLMTYAAKLKLPMASGIVEFNKVNKKLGITFEAAKAMLEKFRQI--HTGKEGKITVQELAEHLNLPVSEAL-EDVFTMYDRDNSGTIDFREYVIGLSLVSEPANTE---DTIQLAFQLFDSEGKGYLSESDLA-QMLHNAFGMNEE 446          
BLAST of Lysophosphatidylcholine acyltransferase vs. TrEMBL
Match: A0A2T7NJC3 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_19441 PE=4 SV=1)

HSP 1 Score: 372.859 bits (956), Expect = 3.421e-119
Identity = 187/437 (42.79%), Postives = 280/437 (64.07%), Query Frame = 1
Query:  196 TPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQ----VLKKSFMLSSDE 1491
            +P V+NPF++  ++     +++ I+++TI P+R++   +     + ++ IA+  +S  D   PLSGWR+ +M PL ++  R  +F G  HWI V+G+R + KEAPILV++PHS+F DSL +V+L + SV+ K+E+++  I G +++ +QP+LV REDPNSR +TI EI+RRS  G  WPQ+ IFPEGTCTNRSCLI FK GAFIPG  VQPV LR+ NKLD+ITWTWDGPG +  LW    Q    +EIEFLP+Y P+++E  NP+LFA+NVRA+MA+ L +P T+H+Y+DCR M  A+   LP    IVEF +L+K+L +   D    L+       R    G ++L E   ++++  + A VE +F  YD+  +G ID +     LSL S P N +  L +  + +   + K G I  Q    +L+ +F ++ ++
Sbjct:   15 SPVVLNPFVHRLHLSILDIIQIAIMSVTIAPLRLLMVGLLLLAVWPLAAIAIAFRSPEDRSKPLSGWRR-MMTPLIVLLCRGVFFMGGFHWITVRGKRASAKEAPILVVSPHSSFFDSLSLVYLDLTSVVAKSESSSVPIFGSIIEFSQPVLVRREDPNSRLSTIKEIQRRSQSGGQWPQIFIFPEGTCTNRSCLITFKGGAFIPGVPVQPVCLRYGNKLDTITWTWDGPGAYQCLWFTLCQFQNHLEIEFLPVYKPNQQEIENPRLFAENVRAVMAECLQIPVTDHTYDDCRLMRRAEALHLPMQAGIVEFQKLKKKLGWNFEDMQRRLDQFRSMDVRKA--GNITLSEFAAYLHLPVSSA-VEELFALYDRDGSGSIDFREYLIGLSLVSQPANTENTLRFAFELF--DEEKTGYIHKQSFKRILQSAFQITDED 445          
BLAST of Lysophosphatidylcholine acyltransferase vs. TrEMBL
Match: A0A1S3H634 (lysophosphatidylcholine acyltransferase 2-like isoform X1 OS=Lingula unguis OX=7574 GN=LOC106152427 PE=4 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 2.115e-115
Identity = 188/441 (42.63%), Postives = 273/441 (61.90%), Query Frame = 1
Query:  199 PDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISF--IALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSL--FVVFLGMNSVIGKTETANS-CIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSD------LKDGNIAGQVLKKSFMLSSD 1488
            P+VINPF++   + W++ L++ I+++TI PIR+V   +   + + ++   +A   K + +   P+ GWR+     L     R  +F    H++ +KG   +  +AP+LV+APHS+F D L  FV+  G+ S + + E+A +  IG L   TQPI V+REDPNSRQ TI EIKRR+     WPQ+++FPEGTCTNRSCLI FK G F PG  VQPV LR+PN+LD+ TWTW+GPG +TL W+   QIH   E+E+LP+Y P+EEE  +PKLFA NVR  M K LNVP T+H+++DCR MT A K  LP    IVEF+++ K+L        +MLE   +     G +G +++QEL  H+ +  +EAL E +F  YD+ N+G ID +     LSL S P N +   D I  A++L D      L + ++A Q+L  +F ++ +
Sbjct:   16 PEVINPFVHDLQLTWWEKLQVAIMSVTIAPIRLVSLCVILLLAWPVAAFAVAFRSKEEKEQIVPVRGWRRRCSGRLLEFMGRACFFVMGFHYVNIKGIPASDIDAPLLVVAPHSSFFDVLVFFVLKNGLPSGVSRIESAGTMLIGTLATFTQPIWVSREDPNSRQNTIKEIKRRAQSKGEWPQIIVFPEGTCTNRSCLITFKPGGFYPGVPVQPVCLRFPNRLDTYTWTWEGPGAFTLFWLTLCQIHNRFEVEYLPVYKPNEEEIADPKLFAKNVREQMTKCLNVPATDHTFDDCRLMTYAAKLKLPMASGIVEFNKVNKKLGITFEAAKAMLEKFRQI--HTGKEGKITVQELAEHLNLPVSEAL-EDVFTMYDRDNSGTIDFREYVIGLSLVSEPANTE---DTIQLAFQLFDSEGKGYLSESDLA-QMLHNAFGMNEE 449          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Cavefish
Match: lpcat1 (lysophosphatidylcholine acyltransferase 1 [Source:NCBI gene;Acc:103025479])

HSP 1 Score: 321.627 bits (823), Expect = 7.439e-103
Identity = 180/452 (39.82%), Postives = 263/452 (58.19%), Query Frame = 1
Query:   97 FSKTQTTTDFDYLKFLLQLNGRFSTFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDL-KDGNI 1446
            F K Q  T  D          R +    ++   +   INPFI+   +   Q +K+ ++T+T+ P+R++       + +  +F+A  G S+ D   PLS WR  + L L  I  R  +F G  HW++VKGR     EAPIL LAPHS++ D++ V    M S++ K E+ N  + G L+K  +P+ V+R D +SR+ T++EIKRR+     WPQM++FPEGTCTNRSCLI FK GAFIPG  VQPVVLR+PN++D+I+WTW GPG + +LW+   Q+H  +EIE+LP Y PSEEEKR+P LFA NVR IMAKAL +PTT++S+EDCR         LP    ++EFSRL +RL    R     L        ++    + SL+    ++ +   EAL + IF  +++ +   +D++     LS+   P      L+ I  A+R+ +  +DG I
Sbjct:   22 FQKQQLYTRGDCGNMRFAKRKRLTLADGEDSQLSAQFINPFIHELRLTALQKVKIAVMTVTLFPVRLLFAAFMMLLAWPFAFVATVGCSE-DAVEPLSWWRWLVDLALKAIM-RAMWFSGGFHWVRVKGRPALPSEAPILTLAPHSSYFDAIPVT-RTMASIVMKAESRNVPVWGTLIKFIRPVFVSRSDQDSRRKTVEEIKRRAFSAGEWPQMMVFPEGTCTNRSCLIAFKPGAFIPGVPVQPVVLRYPNEMDTISWTWQGPGAFKILWLTLCQLHNSIEIEYLPTYTPSEEEKRDPALFASNVRCIMAKALQLPTTDYSFEDCRLAMAKGPLCLPSHTCLLEFSRLVRRLGLNGRVTDQFLHEESSRARKLCGHKL-SLEAFAEYVNLPITEAL-QDIFALFEEHDQ--MDVREYVIALSVVCRPVRY---LETIQLAFRMFEAEEDGAI 463          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Cavefish
Match: lpcat1 (lysophosphatidylcholine acyltransferase 1 [Source:NCBI gene;Acc:103025479])

HSP 1 Score: 321.627 bits (823), Expect = 2.587e-102
Identity = 180/452 (39.82%), Postives = 263/452 (58.19%), Query Frame = 1
Query:   97 FSKTQTTTDFDYLKFLLQLNGRFSTFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDL-KDGNI 1446
            F K Q  T  D          R +    ++   +   INPFI+   +   Q +K+ ++T+T+ P+R++       + +  +F+A  G S+ D   PLS WR  + L L  I  R  +F G  HW++VKGR     EAPIL LAPHS++ D++ V    M S++ K E+ N  + G L+K  +P+ V+R D +SR+ T++EIKRR+     WPQM++FPEGTCTNRSCLI FK GAFIPG  VQPVVLR+PN++D+I+WTW GPG + +LW+   Q+H  +EIE+LP Y PSEEEKR+P LFA NVR IMAKAL +PTT++S+EDCR         LP    ++EFSRL +RL    R     L        ++    + SL+    ++ +   EAL + IF  +++ +   +D++     LS+   P      L+ I  A+R+ +  +DG I
Sbjct:   22 FQKQQLYTRGDCGNMRFAKRKRLTLADGEDSQLSAQFINPFIHELRLTALQKVKIAVMTVTLFPVRLLFAAFMMLLAWPFAFVATVGCSE-DAVEPLSWWRWLVDLALKAIM-RAMWFSGGFHWVRVKGRPALPSEAPILTLAPHSSYFDAIPVT-RTMASIVMKAESRNVPVWGTLIKFIRPVFVSRSDQDSRRKTVEEIKRRAFSAGEWPQMMVFPEGTCTNRSCLIAFKPGAFIPGVPVQPVVLRYPNEMDTISWTWQGPGAFKILWLTLCQLHNSIEIEYLPTYTPSEEEKRDPALFASNVRCIMAKALQLPTTDYSFEDCRLAMAKGPLCLPSHTCLLEFSRLVRRLGLNGRVTDQFLHEESSRARKLCGHKL-SLEAFAEYVNLPITEAL-QDIFALFEEHDQ--MDVREYVIALSVVCRPVRY---LETIQLAFRMFEAEEDGAI 463          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Cavefish
Match: LPCAT1 (lysophosphatidylcholine acyltransferase 1-like [Source:NCBI gene;Acc:103025629])

HSP 1 Score: 319.316 bits (817), Expect = 9.666e-102
Identity = 162/391 (41.43%), Postives = 241/391 (61.64%), Query Frame = 1
Query:  205 VINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLP 1374
            V NPF++      +Q L++ ++T+T+ PIR+        + +  +FIA  G+S+     P   WR+ + + L  I  R+ +F G  HWI VKGR+    EAPIL LAPHS++ D++ V  + M +++ K E+ +  + G L+K  +P+ V+R D +SR+ T++EIKRR+H G  WPQ++IFPEGTCTNRSCLI FK G FIP   VQPVV+R+PNKLD+ITWTW GPG + +LW+   Q H   EIEFLP+Y PSEEEKRNP LFA NVR +MAKAL VP T++S+EDC+      +  LP    ++EF++L +RL   R     +L+   +   ++      +L+E    + +  ++ L + +F  +D+   G +DI+      S+   P
Sbjct:   21 VTNPFVHDLRFTPWQKLQIGVMTLTLFPIRLFVAASMMLLAWPFAFIATMGRSEEAV-EPQCLWRRVVDIILRTIM-RVMWFAGGFHWISVKGRQALPAEAPILTLAPHSSYFDAMPVT-MTMATIVMKAESKDIPLWGTLIKYIRPVFVSRSDQDSRKKTVEEIKRRAHSGGEWPQIMIFPEGTCTNRSCLITFKPGGFIPAVPVQPVVIRYPNKLDTITWTWQGPGAFKILWLTLCQFHNEFEIEFLPIYTPSEEEKRNPPLFAHNVRRLMAKALEVPVTDYSFEDCQLAMAEGQFRLPVDTCLLEFAKLVRRLGLKRESSDKLLKEYGKRARKLQGQKQ-TLEEFAQFLDLPMSDVLRD-MFALFDEHEDGTVDIREFVIAFSVVCRP 406          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Cavefish
Match: lpcat1 (lysophosphatidylcholine acyltransferase 1 [Source:NCBI gene;Acc:103025479])

HSP 1 Score: 304.294 bits (778), Expect = 2.226e-96
Identity = 168/401 (41.90%), Postives = 243/401 (60.60%), Query Frame = 1
Query:  265 IVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDL-KDGNIAGQVL 1461
            ++T+T+ P+R++       + +  +F+A  G S+ D   PLS WR  + L L  I  R  +F G  HW++VKGR     EAPIL LAPHS++ D++ V    M S++ K E+ N  + G L+K  +P+ V+R D +SR+ T++EIKRR+     WPQM++FPEGTCTNRSCLI FK GAFIPG  VQPVVLR+PN++D+I+WTW GPG + +LW+   Q+H  +EIE+LP Y PSEEEKR+P LFA NVR IMAKAL +PTT++S+EDCR         LP    ++EFSRL +RL    R     L        ++    + SL+    ++ +   EAL + IF  +++ +   +D++     LS+   P      L+ I  A+R+ +  +DG I    L
Sbjct:   18 LMTVTLFPVRLLFAAFMMLLAWPFAFVATVGCSE-DAVEPLSWWRWLVDLALKAIM-RAMWFSGGFHWVRVKGRPALPSEAPILTLAPHSSYFDAIPVT-RTMASIVMKAESRNVPVWGTLIKFIRPVFVSRSDQDSRRKTVEEIKRRAFSAGEWPQMMVFPEGTCTNRSCLIAFKPGAFIPGVPVQPVVLRYPNEMDTISWTWQGPGAFKILWLTLCQLHNSIEIEYLPTYTPSEEEKRDPALFASNVRCIMAKALQLPTTDYSFEDCRLAMAKGPLCLPSHTCLLEFSRLVRRLGLNGRVTDQFLHEESSRARKLCGHKL-SLEAFAEYVNLPITEAL-QDIFALFEEHDQ--MDVREYVIALSVVCRPVRY---LETIQLAFRMFEAEEDGAIVEDEL 408          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Cavefish
Match: lpcat4 (lysophosphatidylcholine acyltransferase 4 [Source:ZFIN;Acc:ZDB-GENE-030131-5777])

HSP 1 Score: 238.424 bits (607), Expect = 3.888e-71
Identity = 140/395 (35.44%), Postives = 214/395 (54.18%), Query Frame = 1
Query:  202 DVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETAN-SCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNL---FCHLSLYSLP 1374
            +  +PFI+   +        +I+   + PIRI   ++ F + + I+ + L G S+ D   P+ GWR+  + P+ L  +R  +FF    WIKVKGR+ +            + FLD L +   G+ +V+ ++E +    IG LL+  Q +LV+R+DP SR+  + +IK R      WPQML+FPEGT TN   LI FK GAF+ G  VQPV+L +PNKLDS+ WTW G      LW   +Q++T V +EFLP+Y PS+EE+ NP+L+ADNV+ +MAKALNVP TN+  E     T      LP        S  ++ L  LR D +  +   +        D +V++++L   + +T  +    +I   Y K +T  +D++ L    C  + +S P
Sbjct:    7 NTTHPFIHEVELS-----TAIILGCVLFPIRITLAVLFFLVVWPIARLRLAGLSEADRARPVEGWRQWFLHPIALFLSRGVFFFTGFVWIKVKGRQAS------------NGFLDMLVLCMSGLPTVVSRSENSKLPVIGALLEFNQAVLVSRKDPESRRKCVSQIKERLTSNGYWPQMLMFPEGTTTNGRALIKFKPGAFLAGVPVQPVLLHYPNKLDSVRWTWKGTSWLECLWYTTSQLYTNVTVEFLPVYTPSQEERENPELYADNVQKLMAKALNVPATNYVMEGLFPATKLGGLSLPLE------SPAKETLKLLRTDQVETVVNSMVDYCHSKQDTVVNVEQLTSLLGLTAKKT-AAKICSLYSKNDT--LDLRQLCLSVCAAACFSSP 375          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Nematostella
Match: EDO41615 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3X7])

HSP 1 Score: 236.113 bits (601), Expect = 4.818e-74
Identity = 112/226 (49.56%), Postives = 145/226 (64.16%), Query Frame = 1
Query:  475 VKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETAN-SCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRL 1149
            V+G     +EAPIL +APHS F+D+L +  +G  S + + E      IG ++   QPI V R DPNSRQ TI EIK+R+     WP + IFPEGTCTNR CLI FK GAF  G  VQP++L++PN LD++TWTW GPG   LLW+   Q H F+EIE LP+Y+P  EE  + KLFA NVR  M+ AL VP T H++ED R M  A    LP +  +VE+ +L  +L
Sbjct:    1 VRGTLKPPEEAPILAVAPHSTFIDALALAVIGTPSGVSRKENDKIPIIGSVIGTLQPIYVARTDPNSRQNTISEIKKRALSHGKWPHLCIFPEGTCTNRQCLITFKPGAFYAGSPVQPIILKYPNHLDTVTWTWSGPGALKLLWLTMCQFHNFLEIEILPVYYPCTEEINDAKLFARNVRMQMSSALGVPMTEHTFEDTRLMLEATHKKLPASTGLVEYQKLSSKL 226          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Nematostella
Match: EDO47389 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMR0])

HSP 1 Score: 217.624 bits (553), Expect = 9.982e-66
Identity = 116/297 (39.06%), Postives = 171/297 (57.58%), Query Frame = 1
Query:  463 HWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLG-MNSVIGKTET-ANSCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEA-WPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRL-LYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKN 1341
            H+++VKG+  + +EAPI V APHS+FLD L    L  + S + K E   N  +G L   ++ I V+R+   SR  +++E+K R+      WP + + PEGTCTNR  LI FK GAFIPGC VQP++ ++P   D  TW  DGP  + LL  +  Q+H   E+EFLP++ P+ EE  NPKLFA+NV+  MAKAL +PTT HS+ED   M      GLP    +VEF ++  +L + L      +  ++    NR   DG+++L +   H  +  + AL +++F   D  N G +  + 
Sbjct:    4 HYVRVKGKLASPQEAPICVYAPHSSFLDVLLASVLDEVPSGLSKAENFRNPFLGALFMASESIGVSRDSAKSRLQSVEEVKYRTVVTRGQWPHLGVCPEGTCTNRKALITFKAGAFIPGCPVQPILFKYPGTPDVYTWVNDGPSGFQLLMFIMCQLHHPAEVEFLPVWQPNNEEMENPKLFAENVQNSMAKALGIPTTGHSFEDVLLMKEGSNLGLPDDAAVVEFQKVSSKLGMNLDYMKARLGMFVAIDTNR---DGLITLTDFARHYRLPISSAL-KQMFSALDPDNKGHVTFRQ 296          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Nematostella
Match: EDO37111 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SGS1])

HSP 1 Score: 56.225 bits (134), Expect = 2.344e-8
Identity = 64/256 (25.00%), Postives = 109/256 (42.58%), Query Frame = 1
Query:  277 TIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNI----MLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETA-NSCIGYLLKMTQP-ILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFL-PLYHPSEEEKRNPKLFADNVRAIMA 1023
             ++P+R+  F  + G+T L    A   +       P S +RK +    ML  F I ++ T        I+   +    K   I V A H++ +D L +      S++G+ +      I  +L+ TQ  I   R +   R      +K         P +LIFPEGTC N + ++ FK G+F  G  + PV +++ +      W          L+ L        ++ +L P+Y   + E  +P  FA+ V+A +A
Sbjct:  164 VLLPVRVTIF--SIGLTVLTLSTAFLSQL------PQSSFRKKLERVFMLASFRILSKATSAV-----IRSHNKENMAKGGGICV-ANHTSPIDVLILQCDNCYSMVGQRQPGLFGFIEKVLEKTQDHIWFERSEMKDRIIVTRRLKEHVEDDTKNP-ILIFPEGTCINNTSVMMFKKGSFEIGGVIYPVAIKYDSTFGDAFWNSSSESFGQYLFSLMTSWALVCDVWYLKPMY---KREDESPVQFANRVKAEIA 401          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Medaka
Match: LPCAT1 (lysophosphatidylcholine acyltransferase 1 [Source:NCBI gene;Acc:101159130])

HSP 1 Score: 314.694 bits (805), Expect = 8.594e-100
Identity = 169/404 (41.83%), Postives = 248/404 (61.39%), Query Frame = 1
Query:  178 NKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGM--TYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRI-GTDGM-VSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLP 1374
             K   Q P + NPF++       +  K+ ++T+T+ PIR+  F+  F M   +  +F+A  G+S+     P   WR+ + + L LI  R  +F G  HW+ +KG+R    EAPIL LAPHS++ D++ V  + M+S++ K E+ +  + G L+K  +P+ V+R D NSR+ T++EIKRR+H    WPQ++IFPEGTCTNRSCLI FK GAFIP   VQPVV+R+PNKLDSITWTW GPG + +LW+   Q+H    IEFLP+Y PSEEEK+NP LFA NVR +MA+AL VP T++S+EDC+      +  LP    ++EF+RL +RL      P +  + L +  NR    +G  + LQ   H + +  ++ L + +F  +D+     +DI+     LS+   P
Sbjct:   15 GKKMDQAPPIRNPFVHVLKFTTLEKTKIALMTVTLFPIRL--FMAAFMMLLAWPFAFLATIGRSETTV-EPQCLWRRLVDVILKLIM-RAMWFAGGFHWMTIKGQRALPTEAPILTLAPHSSYFDAIPVT-MTMSSIVMKAESKDIPLWGTLIKYIRPVFVSRSDQNSRKKTVEEIKRRAHSRGEWPQIMIFPEGTCTNRSCLITFKPGAFIPAVPVQPVVIRYPNKLDSITWTWQGPGAFAILWLTLCQLHNEFVIEFLPIYTPSEEEKKNPALFAVNVRRVMAQALGVPITDYSFEDCQLAMAEGQLKLPVETCLLEFARLVRRLGL---KPANSEKVLQDYGNRARKLEGQKLDLQGFAHFLDVPVSDMLRD-MFALFDEDEDNSMDIREYVIALSVVCRP 409          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Medaka
Match: LPCAT1 (lysophosphatidylcholine acyltransferase 1 [Source:NCBI gene;Acc:101159130])

HSP 1 Score: 298.516 bits (763), Expect = 9.957e-94
Identity = 161/372 (43.28%), Postives = 233/372 (62.63%), Query Frame = 1
Query:  274 ITIMPIRIVGFLMTFGM--TYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI-GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRI-GTDGM-VSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLP 1374
            +T+ PIR+  F+  F M   +  +F+A  G+S+     P   WR+ + + L LI  R  +F G  HW+ +KG+R    EAPIL LAPHS++ D++ V  + M+S++ K E+ +  + G L+K  +P+ V+R D NSR+ T++EIKRR+H    WPQ++IFPEGTCTNRSCLI FK GAFIP   VQPVV+R+PNKLDSITWTW GPG + +LW+   Q+H    IEFLP+Y PSEEEK+NP LFA NVR +MA+AL VP T++S+EDC+      +  LP    ++EF+RL +RL      P +  + L +  NR    +G  + LQ   H + +  ++ L + +F  +D+     +DI+     LS+   P
Sbjct:   31 LTLFPIRL--FMAAFMMLLAWPFAFLATIGRSETTVE-PQCLWRRLVDVILKLIM-RAMWFAGGFHWMTIKGQRALPTEAPILTLAPHSSYFDAIPVT-MTMSSIVMKAESKDIPLWGTLIKYIRPVFVSRSDQNSRKKTVEEIKRRAHSRGEWPQIMIFPEGTCTNRSCLITFKPGAFIPAVPVQPVVIRYPNKLDSITWTWQGPGAFAILWLTLCQLHNEFVIEFLPIYTPSEEEKKNPALFAVNVRRVMAQALGVPITDYSFEDCQLAMAEGQLKLPVETCLLEFARLVRRLGL---KPANSEKVLQDYGNRARKLEGQKLDLQGFAHFLDVPVSDMLRD-MFALFDEDEDNSMDIREYVIALSVVCRP 393          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Medaka
Match: lpcat2 (lysophosphatidylcholine acyltransferase 2 [Source:NCBI gene;Acc:101172965])

HSP 1 Score: 294.664 bits (753), Expect = 2.809e-92
Identity = 177/499 (35.47%), Postives = 269/499 (53.91%), Query Frame = 1
Query:  160 RFSTFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTET-ANSCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSSDEAMEIISFTKFHQSP-GQPFLNT---LDTIMSIGGPFNMYSDY------HSEYNK 1623
            R S    +     P VINPF+    +     LK V +   ++P+R +   +   +T+ ISF+  +         P++GWR+ +   +     R  YF      I +KG++ +  EAPIL +APHS F D +  V  G+ S + + E  A    G  L+  QP+LV+R+DPNSR+ TI EI+ R+     WPQ+LIFPEGTCTNR+CLI FK GAFIPG  VQPV++R+PNK+D++TWTW G    TLL +   Q++T VEIEFLP + P+EEEK++P L+A+ VR  MA+AL VP T+H+YEDCR M  A +  LP    +VEF+++ ++ L L+ D +        ++ R    G ++L E    + +   +AL E +F  +D+   G ID +     +++   P N +   D +  A++L D  +                DE + ++ FT   +S  G   LN     + I + G  F  ++++      H EY K
Sbjct:    5 RVSALPRQQSLLQPAVINPFVQDTRLSRAAVLKCVFLGTFLVPLRAILISLVLMVTWPISFMITFRHPLKGAVEPMTGWRRLMCRRVMPALGRAYYFCMGFRVI-IKGKQVSSSEAPILAVAPHSTFFDGIVCVVAGLPSTVSRVENLATPIFGRFLRCMQPVLVSRKDPNSRKNTIHEIETRAKSEGRWPQVLIFPEGTCTNRACLITFKQGAFIPGVPVQPVLIRYPNKMDTVTWTWQGYSSMTLLLLTLCQLYTTVEIEFLPPHVPTEEEKKSPALYANRVRETMAQALRVPVTDHTYEDCRLMISAGELTLPMEAGLVEFTKISRK-LNLKWDNVKKELENFASMARSCKGGRITLDEFARFLKLPVTQAL-EELFALFDRDGDGTIDFREYVIGVTILCRPANTE---DLLRMAFKLFDTDE----------------DEKITLVEFTSLLRSALGVSDLNVNMLFEEIDADGSGFITFNEFQAFARTHPEYAK 481          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Medaka
Match: lpcat4 (lysophospholipid acyltransferase LPCAT4 [Source:NCBI gene;Acc:101161012])

HSP 1 Score: 192.586 bits (488), Expect = 4.608e-54
Identity = 150/531 (28.25%), Postives = 254/531 (47.83%), Query Frame = 1
Query:  202 DVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTE-TANSCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKL------DSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTD---GMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSSDEAMEIISFTKFHQSPGQPFLNTLDTIMS--IGGPFNMYSDYHSEYNKSIKSGALSKSQQFKVANSNPNDITTFENYSKSQINMQLPNHQLIN 1758
            D  +PFI+   +   Q +K  ++   + P+R+   ++ F + + ++ + L G S+ +   P++GWR+ +  P   + +R  +F     W++VKGRR   +EAP+LV+APHS F D L +    + +V+ ++E T+   IG LL+  Q +LV+R+DP SR+  + ++ +R      WPQML+FPEGT TN   LI FK     PG SV+P ++            D+       P     L +LF     +  ++FLP+Y PSEEEK++P L+ADNV+ +MA AL VP T++  E    + ++K  GL     +   +R   + L    +  + ++ +   I+R G D     VS++EL   + + D +A V  +   Y K  +  +D++ L                    L    LS LKD    G +L  +F L          F + H+  G      L  +M   +G P     D  + Y ++   G L++ +  +V   +       E    S+ ++ LP  + +N
Sbjct:   12 DCAHPFIHEVKLSAAQRIKGGLLGCILFPLRVALAVLFFLIMWPLARLRLAGLSEEERAKPVTGWRRWLFHPPIWLLSRAVFFSLGFLWVRVKGRRADLREAPVLVVAPHSGFFDMLVLCPTQLATVVSRSENTSLPVIGALLEFNQSVLVSRKDPESRKKAVAQLIQRLTSDGYWPQMLMFPEGTTTNGRSLIKFK-----PGVSVEPPLISMTRAAFQFASNDNEACRLTSP-----LLLLF-----YFSLQFLPVYKPSEEEKKDPNLYADNVQKLMAGALGVPATDYVMEG--RVPVSKLGGLSLP--LESPARDALKELLGEHEIQAAIDRI---IDRCGEDTEGSTVSVEELASLLGLRDRQAAVH-LCSLYSKGES--VDLRQLG-------------------LSVLALSGLKD---FGSLLHSAFTL----------FDREHR--GSLSAQQLSDLMGALLGVP---QQDTTALYTEACSGGPLTEEKLLRVLAQHQTYRKVKEFLESSEASVTLPKAKGVN 480          
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Medaka
Match: agpat9l (glycerol-3-phosphate acyltransferase 3-like [Source:NCBI gene;Acc:101167873])

HSP 1 Score: 56.6102 bits (135), Expect = 4.962e-8
Identity = 61/257 (23.74%), Postives = 112/257 (43.58%), Query Frame = 1
Query:  280 IMPIRIVGFLMTFGMTYLISFIALYGK-SDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCIGYLLKMTQPILV--------TREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMA 1023
            + P+RI   L   G+T+L+   +  G   D   +S +S W   + +  + I AR      +IH+     R    K+  I V A H++ +D + +   G  +++G+        G L+ + Q  +V         R +   R      ++   +  +  P +LIFPEGTC N + ++ FK G+F  G ++ PV +++  K     W      + + L  +         + +LP  H  E E  +   FA+ V++ +A
Sbjct:  165 LAPLRIT--LACIGLTWLVIGTSAVGLLPDWRIKSWISEW---VHVMCYRICAR--GLSATIHY---HNRENKPKKGGICV-ANHTSPIDIVILCNDGCYAMVGQVH------GGLMGVVQRAMVRSCPHVWFERAEMKDRHLVTKRLRDHVNDKKKLP-ILIFPEGTCINNTSVMMFKKGSFEIGGTIYPVAIKYDPKFGDAFWNSSKYSMVSYLLRMMTSWALVCNVWYLPPMHQKEGE--DAVQFANRVKSAIA 401          
BLAST of Lysophosphatidylcholine acyltransferase vs. Planmine SMEST
Match: SMESG000003820.1 (SMESG000003820.1)

HSP 1 Score: 1164.06 bits (3010), Expect = 0.000e+0
Identity = 560/561 (99.82%), Postives = 560/561 (99.82%), Query Frame = 1
Query:   91 MTFSKTQTTTDFDYLKFLLQLNGRFSTFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSSDEAMEIISFTKFHQSPGQPFLNTLDTIMSIGGPFNMYSDYHSEYNKSIKSGALSKSQQFKVANSNPNDITTFENYSKSQINMQLPNHQLINRLKLE 1773
            MTFSKTQTTTDFDYLKFLLQLNGRFSTFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHC EAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSSDEAMEIISFTKFHQSPGQPFLNTLDTIMSIGGPFNMYSDYHSEYNKSIKSGALSKSQQFKVANSNPNDITTFENYSKSQINMQLPNHQLINRLKLE
Sbjct:    1 MTFSKTQTTTDFDYLKFLLQLNGRFSTFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCCEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDGNIAGQVLKKSFMLSSDEAMEIISFTKFHQSPGQPFLNTLDTIMSIGGPFNMYSDYHSEYNKSIKSGALSKSQQFKVANSNPNDITTFENYSKSQINMQLPNHQLINRLKLE 561          
BLAST of Lysophosphatidylcholine acyltransferase vs. Planmine SMEST
Match: SMESG000045185.1 (SMESG000045185.1)

HSP 1 Score: 547.354 bits (1409), Expect = 0.000e+0
Identity = 264/503 (52.49%), Postives = 353/503 (70.18%), Query Frame = 1
Query:  127 DYLKFLLQLNGRFSTFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYM-TDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYR-LSDLKDGNIAGQVLKKSFMLSSDEAMEIISFTKFHQSPGQPFLNTLDTIMS-IGGPFNMYSDYHSEYNKS 1626
            DY KF+ Q+NG+ S  FN+ + +   ++NPFIY WN+PWYQW+KM I++I ++PIR++ F + F +T LIS+I     +  D  +P+ GWRK +M+PLF+  AR+ +F G  HWI VKG+RC+R   PILV+APHSAF+D+L VV+LGMNSV+GKT+TANS +G LLKMTQP+LV RED NSRQ TIDEI RR    E WPQMLIFPEGTCTNR+ LINFK GAF  G  VQPV+LRWPN +D+ TWTW+GPGV  LLWM   Q HT VE+EFLP Y PS EEK NP LFA+NVR +MA+ L +PT ++SYEDCR+MTLAK++GLPF++IIVEFS++ K LL    D   M++ L+ TI   GT   ++L E C   ++  ++ ++++ IFKFYDK  +G I +++   H++LYS   NRK+   Y  +A++  S+  D  I  + L+  FMLSSD+  E+ +  +     G   L+T+D  M  I  PFNMY DY  +YN S
Sbjct:   11 DYTKFVFQINGKLSMLFNRRKKEPLSIVNPFIYVWNVPWYQWIKMFILSIILLPIRVIFFSVFFLLTLLISYIT---TASQDCNTPMCGWRKKLMMPLFIATARVAFFCGGFHWITVKGKRCSRDYVPILVIAPHSAFVDALIVVYLGMNSVVGKTQTANSSVGCLLKMTQPVLVNREDANSRQKTIDEINRRCTLTENWPQMLIFPEGTCTNRTSLINFKTGAFTSGQPVQPVILRWPNYVDNTTWTWEGPGVCMLLWMTLTQFHTRVEMEFLPAYFPSPEEKFNPSLFANNVRLLMAEKLKIPTIDYSYEDCRHMTLAKRNGLPFSDIIVEFSKVVKFLLSSLGDEEEMMKQLINTIQTYGTRK-ITLAEFCAKFHVPPESVSMMDAIFKFYDKAKSGSIHLRDFVSHVALYSFSHNRKLGFTYAFQAFKESSNQDDCEIYNETLRHVFMLSSDDINEVFTIIQAQYDHGSINLDTIDEGMQVIVDPFNMYKDYVYKYNWS 509          
BLAST of Lysophosphatidylcholine acyltransferase vs. Planmine SMEST
Match: SMESG000045185.1 (SMESG000045185.1)

HSP 1 Score: 339.732 bits (870), Expect = 1.887e-113
Identity = 153/254 (60.24%), Postives = 195/254 (76.77%), Query Frame = 1
Query:  127 DYLKFLLQLNGRFSTFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCIGYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGV 888
            DY KF+ Q+NG+ S  FN+ + +   ++NPFIY WN+PWYQW+KM I++I ++PIR++ F + F +T LIS+I     +  D  +P+ GWRK +M+PLF+  AR+ +F G  HWI VKG+RC+R   PILV+APHSAF+D+L VV+LGMNSV+GKT+TANS +G LLKMTQP+LV RED NSRQ TIDEI RR    E WPQMLIFPEGTCTNR+ LINFK GAF  G  VQPV+LRWPN +D+ TWTW+GPGV
Sbjct:   11 DYTKFVFQINGKLSMLFNRRKKEPLSIVNPFIYVWNVPWYQWIKMFILSIILLPIRVIFFSVFFLLTLLISYIT---TASQDCNTPMCGWRKKLMMPLFIATARVAFFCGGFHWITVKGKRCSRDYVPILVIAPHSAFVDALIVVYLGMNSVVGKTQTANSSVGCLLKMTQPVLVNREDANSRQKTIDEINRRCTLTENWPQMLIFPEGTCTNRTSLINFKTGAFTSGQPVQPVILRWPNYVDNTTWTWEGPGV 261          
BLAST of Lysophosphatidylcholine acyltransferase vs. Planmine SMEST
Match: SMESG000009198.1 (SMESG000009198.1)

HSP 1 Score: 302.753 bits (774), Expect = 1.573e-95
Identity = 168/443 (37.92%), Postives = 261/443 (58.92%), Query Frame = 1
Query:  160 RFSTFFNKNRTQTPDVINPFIYTWNIPWYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLSGWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAFLDSLFVVFLGMNSVIGKTETANSCI---GYLLKMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQKRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVERIFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLS-DLKDGNIAGQVLKKSFM 1476
            R S    +     P ++NPF     +PWY+W+K+  +++TI P+R V  ++TFG+T + + +     +++ F   L  WRK +      +  RL +FF   H+++V+GRR    EA ILV APHS+F D L V  L   ++ G ++  NS I   G L K+ QPI V RED NSR  T++ +  RS      PQ+++FPEGT TNR+CLINFK GAFIPG  VQPV++R+PN++D ITWT +   V    WM+  Q H    +E+LP+Y P+E+EK + KLF +NVR  MA++L+VP T+HS+ED + M LAKK+ LP    IVEFS+L ++L     +    +++  E    +   G ++++    ++ +  +   VE++F  YD+  TG+ID +     LSL ++P N + +L       RL+ ++ D +  G+V +  F+
Sbjct:   20 RLSNVVRQGSFIEPVILNPFSNYLRLPWYEWVKVSFMSVTIAPVRFVLIVITFGITSIFASVGCLFSTESTFIGTLPWWRKTLRYSCRKLM-RLIFFFCGFHYLEVRGRRANPNEAMILVAAPHSSFCDILAV--LSGRTLSGISKIENSYIPGFGSLGKLLQPIWVNREDVNSRLRTVELLSERSKYAGKMPQIVVFPEGTTTNRTCLINFKAGAFIPGVPVQPVLIRFPNRVDCITWTNEQLPVLLTSWMMLCQFHNRCIVEYLPVYVPNEKEKHDAKLFGNNVRDQMARSLDVPVTDHSFEDVKLMWLAKKYKLPQAAGIVEFSKLSRKLTLNFGNISEFIKYFAEISREL--KGKITIEAFAEYLGLPISPE-VEKLFNMYDRNRTGYIDFREYVIGLSLVTMPANTEQSL-------RLAFEMLDPDKTGEVSEYEFI 449          
BLAST of Lysophosphatidylcholine acyltransferase vs. Planmine SMEST
Match: SMESG000061821.1 (SMESG000061821.1)

HSP 1 Score: 58.9214 bits (141), Expect = 6.217e-9
Identity = 36/134 (26.87%), Postives = 63/134 (47.01%), Query Frame = 1
Query:  628 KMTQPILVTREDPNSRQTTIDEIKRRSHCGEAWP-QMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRWPNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPKLFADNVRAIMAK 1026
            + T  I   R +   R+     +  R H  E     +LIFPEGTC N + ++ FK G+F  G ++ PV +++ ++     W      +   L+M+ +      ++ +LP  H  E E  N   FA+ V+  +A+
Sbjct:  281 RATSTIWFERSETRDREGVTKRL--RDHIKEPGSLPILIFPEGTCINNTSVMMFKKGSFEVGGTIYPVAVKYDSRFADCFWNSSKYSLLEYLFMMMSSWAIVADVWYLPPEHQKESE--NAIEFANRVKRNIAQ 410          
The following BLAST results are available for this feature:
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LPCAT16.021e-9737.74lysophosphatidylcholine acyltransferase 1 [Source:... [more]
LPCAT16.021e-9737.74lysophosphatidylcholine acyltransferase 1 [Source:... [more]
LPCAT16.954e-9438.50lysophosphatidylcholine acyltransferase 1 [Source:... [more]
LPCAT16.954e-9438.50lysophosphatidylcholine acyltransferase 1 [Source:... [more]
LPCAT24.895e-8738.00lysophosphatidylcholine acyltransferase 2 [Source:... [more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acl-44.889e-1023.79ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-46.456e-1023.90ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-54.563e-922.29ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-54.563e-922.29ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
acl-55.970e-922.29ACyLtransferase-like [Source:UniProtKB/TrEMBL;Acc... [more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LPCAT6.118e-9942.24gene:FBgn0052699 transcript:FBtr0110850[more]
Gpat41.764e-824.14gene:FBgn0034971 transcript:FBtr0072179[more]
Gpat42.025e-824.14gene:FBgn0034971 transcript:FBtr0343336[more]
Gpat48.422e-829.00gene:FBgn0034971 transcript:FBtr0302165[more]
Gpat49.762e-829.00gene:FBgn0034971 transcript:FBtr0343337[more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lpcat14.077e-10040.57lysophosphatidylcholine acyltransferase 1 [Source:... [more]
lpcat14.077e-10040.57lysophosphatidylcholine acyltransferase 1 [Source:... [more]
lpcat21.780e-9437.44lysophosphatidylcholine acyltransferase 2 [Source:... [more]
lpcat21.780e-9437.44lysophosphatidylcholine acyltransferase 2 [Source:... [more]
lpcat41.139e-7033.50lysophosphatidylcholine acyltransferase 4 [Source:... [more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lgi21.418e-10641.83leucine-rich repeat LGI family member 2 [Source:Xe... [more]
ackr43.321e-10340.43atypical chemokine receptor 4 [Source:Xenbase;Acc:... [more]
ackr43.954e-10340.43atypical chemokine receptor 4 [Source:Xenbase;Acc:... [more]
ackr41.662e-10240.43atypical chemokine receptor 4 [Source:Xenbase;Acc:... [more]
ackr44.263e-9439.00atypical chemokine receptor 4 [Source:Xenbase;Acc:... [more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Lpcat11.190e-9837.11lysophosphatidylcholine acyltransferase 1 [Source:... [more]
Lpcat12.712e-9538.36lysophosphatidylcholine acyltransferase 1 [Source:... [more]
Lpcat21.854e-9440.30lysophosphatidylcholine acyltransferase 2 [Source:... [more]
Lpcat2b2.751e-8936.73lysophosphatidylcholine acyltransferase 2B [Source... [more]
Lpcat41.419e-6831.73lysophosphatidylcholine acyltransferase 4 [Source:... [more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q1LWG4|PCAT1_DANRE3.077e-9940.57Lysophosphatidylcholine acyltransferase 1 OS=Danio... [more]
sp|Q0KHU5|PCAT_DROME6.133e-9842.24Lysophosphatidylcholine acyltransferase OS=Drosoph... [more]
sp|Q3TFD2|PCAT1_MOUSE8.322e-9837.11Lysophosphatidylcholine acyltransferase 1 OS=Mus m... [more]
sp|Q1HAQ0|PCAT1_RAT1.030e-9736.91Lysophosphatidylcholine acyltransferase 1 OS=Rattu... [more]
sp|Q8NF37|PCAT1_HUMAN2.891e-9637.74Lysophosphatidylcholine acyltransferase 1 OS=Homo ... [more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
K1QLU41.986e-12445.37Lysophosphatidylcholine acyltransferase 2 OS=Crass... [more]
A0A2R2MM867.516e-12143.74lysophosphatidylcholine acyltransferase 2 OS=Lingu... [more]
A0A1S3H6181.123e-11943.28lysophosphatidylcholine acyltransferase 2-like iso... [more]
A0A2T7NJC33.421e-11942.79Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A1S3H6342.115e-11542.63lysophosphatidylcholine acyltransferase 2-like iso... [more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lpcat17.439e-10339.82lysophosphatidylcholine acyltransferase 1 [Source:... [more]
lpcat12.587e-10239.82lysophosphatidylcholine acyltransferase 1 [Source:... [more]
LPCAT19.666e-10241.43lysophosphatidylcholine acyltransferase 1-like [So... [more]
lpcat12.226e-9641.90lysophosphatidylcholine acyltransferase 1 [Source:... [more]
lpcat43.888e-7135.44lysophosphatidylcholine acyltransferase 4 [Source:... [more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO416154.818e-7449.56Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473899.982e-6639.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO371112.344e-825.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LPCAT18.594e-10041.83lysophosphatidylcholine acyltransferase 1 [Source:... [more]
LPCAT19.957e-9443.28lysophosphatidylcholine acyltransferase 1 [Source:... [more]
lpcat22.809e-9235.47lysophosphatidylcholine acyltransferase 2 [Source:... [more]
lpcat44.608e-5428.25lysophospholipid acyltransferase LPCAT4 [Source:NC... [more]
agpat9l4.962e-823.74glycerol-3-phosphate acyltransferase 3-like [Sourc... [more]
back to top
BLAST of Lysophosphatidylcholine acyltransferase vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000003820.10.000e+099.82SMESG000003820.1[more]
SMESG000045185.10.000e+052.49SMESG000045185.1[more]
SMESG000045185.11.887e-11360.24SMESG000045185.1[more]
SMESG000009198.11.573e-9537.92SMESG000009198.1[more]
SMESG000061821.16.217e-926.87SMESG000061821.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023749 ID=SMED30023749|Name=Lysophosphatidylcholine acyltransferase|organism=Schmidtea mediterranea sexual|type=transcript|length=1820bp
CTTGGGTTTAAATTGTCATTGTTTGAGGAATTTTGAATCATTTTAATTTT
TAATATAAATGAGAATGGATTGAAAGACACTGGATTTAGAATGACATTTA
GTAAAACCCAGACAACCACTGATTTCGATTATTTAAAATTCTTGTTGCAA
TTAAATGGAAGATTTTCCACATTTTTCAATAAAAATAGAACTCAAACTCC
AGATGTTATCAATCCATTTATTTATACGTGGAACATACCATGGTATCAAT
GGCTTAAAATGGTCATTGTAACTATCACGATAATGCCAATTAGAATTGTC
GGATTTTTAATGACATTTGGCATGACTTACTTGATATCTTTTATTGCATT
ATATGGTAAATCTGACAATGATTTTAGATCTCCATTGAGCGGATGGAGAA
AGAACATAATGCTACCTTTGTTCTTAATTTTTGCGCGACTAACATATTTT
TTTGGTTCAATCCATTGGATAAAAGTGAAGGGACGGCGATGCACCAGAAA
AGAAGCTCCAATACTCGTACTGGCTCCTCATTCGGCTTTTTTGGATTCAC
TGTTTGTCGTGTTTCTAGGAATGAATTCAGTCATTGGTAAAACAGAAACA
GCTAATTCTTGTATTGGATATTTGTTGAAAATGACTCAACCAATACTTGT
CACAAGAGAAGATCCAAATTCCAGGCAAACTACTATTGATGAAATCAAGC
GTCGGTCCCATTGCGGTGAAGCATGGCCCCAAATGCTGATTTTCCCGGAA
GGAACTTGCACTAATCGATCCTGCTTAATTAATTTCAAAAACGGTGCTTT
TATTCCTGGATGTTCTGTTCAACCAGTCGTACTTCGTTGGCCCAATAAAT
TGGATTCTATCACTTGGACTTGGGATGGCCCAGGAGTGTGGACTTTGCTA
TGGATGCTTTTCGCTCAAATACATACGTTTGTTGAAATTGAGTTTCTACC
GCTGTATCATCCTAGTGAAGAAGAAAAGCGTAATCCAAAATTATTCGCTG
ATAATGTGCGAGCCATAATGGCAAAAGCTTTAAATGTTCCTACAACTAAT
CACTCATACGAGGATTGTCGGTACATGACTTTAGCTAAAAAACACGGATT
GCCATTTACAGAAATAATTGTCGAGTTTTCCAGATTGCAGAAGCGTTTAT
TATATCTCCGTCGTGACCCTATATCAATGCTGGAATGGTTGTTAGAAACA
ATAAATCGCATTGGAACGGATGGCATGGTTTCTCTGCAGGAATTATGTCA
TCACATTTACATGACAGACAACGAAGCTCTTGTTGAACGTATTTTCAAAT
TCTATGACAAGACAAATACAGGCTTCATAGACATTAAAAATCTATTTTGT
CACCTTTCTCTGTATTCTCTACCCTTTAATCGAAAAATTGCTCTTGATTA
TATTCTGAAAGCCTATAGGTTATCTGATCTAAAAGATGGTAACATAGCTG
GTCAAGTATTGAAGAAGTCATTCATGCTGTCCTCAGATGAAGCTATGGAA
ATTATTTCTTTTACCAAATTTCATCAATCGCCTGGACAGCCTTTCTTAAA
TACTTTGGATACCATTATGTCGATTGGTGGTCCTTTCAATATGTATTCTG
ATTATCATAGTGAATACAATAAATCTATTAAATCTGGTGCCTTGTCCAAG
TCCCAGCAATTCAAGGTAGCTAACAGTAATCCGAATGACATTACTACATT
CGAGAACTATTCCAAATCCCAAATAAATATGCAATTACCAAATCATCAGT
TAATAAACCGATTAAAACTGGAATGATATTTGTTGAGAATTGATTAATAA
ATGTATTATTACTATTAAAA
back to top

protein sequence of SMED30023749-orf-1

>SMED30023749-orf-1 ID=SMED30023749-orf-1|Name=SMED30023749-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=562bp
MTFSKTQTTTDFDYLKFLLQLNGRFSTFFNKNRTQTPDVINPFIYTWNIP
WYQWLKMVIVTITIMPIRIVGFLMTFGMTYLISFIALYGKSDNDFRSPLS
GWRKNIMLPLFLIFARLTYFFGSIHWIKVKGRRCTRKEAPILVLAPHSAF
LDSLFVVFLGMNSVIGKTETANSCIGYLLKMTQPILVTREDPNSRQTTID
EIKRRSHCGEAWPQMLIFPEGTCTNRSCLINFKNGAFIPGCSVQPVVLRW
PNKLDSITWTWDGPGVWTLLWMLFAQIHTFVEIEFLPLYHPSEEEKRNPK
LFADNVRAIMAKALNVPTTNHSYEDCRYMTLAKKHGLPFTEIIVEFSRLQ
KRLLYLRRDPISMLEWLLETINRIGTDGMVSLQELCHHIYMTDNEALVER
IFKFYDKTNTGFIDIKNLFCHLSLYSLPFNRKIALDYILKAYRLSDLKDG
NIAGQVLKKSFMLSSDEAMEIISFTKFHQSPGQPFLNTLDTIMSIGGPFN
MYSDYHSEYNKSIKSGALSKSQQFKVANSNPNDITTFENYSKSQINMQLP
NHQLINRLKLE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR002123Plipid/glycerol_acylTrfase
IPR011992EF-hand-dom_pair
IPR002048EF_hand_dom
Vocabulary: molecular function
TermDefinition
GO:0016746transferase activity, transferring acyl groups
GO:0005509calcium ion binding
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002123Phospholipid/glycerol acyltransferaseSMARTSM00563plsc_2coord: 141..251
e-value: 1.3E-10
score: 51.3
IPR002123Phospholipid/glycerol acyltransferasePFAMPF01553Acyltransferasecoord: 127..237
e-value: 3.0E-9
score: 36.6
NoneNo IPR availablePANTHERPTHR23063ACETYLTRANSFERASE-RELATEDcoord: 24..452
NoneNo IPR availablePANTHERPTHR23063:SF21LYSOPHOSPHATIDYLCHOLINE ACYLTRANSFERASE 2coord: 24..452
NoneNo IPR availableCDDcd07991LPLAT_LPCAT1-likecoord: 115..327
e-value: 5.81766E-80
score: 247.905
NoneNo IPR availableSUPERFAMILYSSF69593Glycerol-3-phosphate (1)-acyltransferasecoord: 97..316
NoneNo IPR availableTMHMMTMhelixcoord: 66..88
NoneNo IPR availableTMHMMTMhelixcoord: 139..161
NoneNo IPR availableTMHMMTMhelixcoord: 108..127
IPR002048EF-hand domainPROSITEPS50222EF_HAND_2coord: 393..428
score: 9.632
IPR011992EF-hand domain pairSUPERFAMILYSSF47473EF-handcoord: 371..452