SMED30023739

Overview
NameSMED30023739
Smed IDSMED30023739
Length (bp)3057
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30023739 (SMED30023739) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30023739 (SMED30023739) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30023739 (SMED30023739) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30023739 (SMED30023739) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023739

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 11

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30023739h1SMcG0017510 Contig1190GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30023739h1SMcG0017510 Contig1190GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
epidermisSMED30023739h1SMcG0017510 Contig1190GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
dorsal ventral margin of the whole animalSMED30023739h1SMcG0017510 Contig1190GPL15192PMID:23079596
Forsthoefel et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
intestinal phagocyteSMED30023739h1SMcG0017510 Contig1190GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
gutSMED30023739h1SMcG0017510 dd_Smed_v4_3277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023739h1SMcG0017510 dd_Smed_v4_3277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023739h1SMcG0017510 dd_Smed_v4_3277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30023739h1SMcG0017510 dd_Smed_v4_3277_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023739h1SMcG0017510 Contig30434uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
gutSMED30023739h1SMcG0017510 Contig30434newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Alignments
SMED30023739 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000816:10563..25097 +14773
Homology
BLAST of SMED30023739 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 104.375 bits (259), Expect = 5.549e-22
Identity = 56/196 (28.57%), Postives = 104/196 (53.06%), Query Frame = 2
Query:   89 FVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
             +LQN+     D+ +  ++N+  +  +   P+HIA + G   +A  ++N+    +++ +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH ++ + L+ +   L  +TK G + +H AA   H+E VK L++ K   D    D    + +A   GH  + KLL++ +      A +G  P
Sbjct:  189 LLLQNDHNA--DVQSKMMVNRTTE--SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 380          

HSP 2 Score: 98.5969 bits (244), Expect = 3.273e-20
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H+A  +G   M + ++++    +   ++G  PLH    +GH  +V+LLL +   +  +T +G+ P+H A    H E  K L+     +D  T    T++H AA  GH  V KLL++K+ N + +  +G  P+ IAC    I++++LL+
Sbjct:  248 PLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLV 397          

HSP 3 Score: 95.9005 bits (237), Expect = 2.325e-19
Identity = 47/166 (28.31%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  ++ K  +   + KNG+ PLH       + I   LL+   E N  T  G+ P+H A   GH ++   L+ K   + + TK G TS+H AA    + V  +L +   + D   K G  P+++AC YG++++V  L+          ++G  P
Sbjct:  578 PLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTP 743          

HSP 4 Score: 92.0485 bits (227), Expect = 3.613e-18
Identity = 56/199 (28.14%), Postives = 93/199 (46.73%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPS--VAGEIHLDKKCLEFLGGIQHS---KQIFSCL 763
            +H+A + G + + + +++K+ N      NG+ PLH  C    + +++LL+     I   T  G+ PIH A   GH  I   L+      D+   +G T++H AA  G +EVV+ L+      D + ++   P+ IA   G  EIV+LL+ +         +G  P    A E  +D   +    G  HS   K+ F+ L
Sbjct:  348 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPL 546          

HSP 5 Score: 88.5817 bits (218), Expect = 3.887e-17
Identity = 47/166 (28.31%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA   G  E+ + ++    + + +  NG+ PLH     G +D+  +LL      +  T  G  P+H A   G  ++AK L+ +    D   K G T +H AA   + +V  LL+EK  +     K+G  P+ IA     ++I   L+N    +    + GV P
Sbjct:  479 PLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTP 644          

HSP 6 Score: 86.6557 bits (213), Expect = 1.454e-16
Identity = 42/156 (26.92%), Postives = 75/156 (48.08%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            T    P+HI+  +G  ++A  ++        + K G+ PLH     G LD+ +LLL +    +    +G+ P+H A    + ++A  L+ K        K G+T +H AA    +++   L+     T+I  K G  P+ +A   GH ++V LL++
Sbjct:  507 TNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLD 662          

HSP 7 Score: 86.6557 bits (213), Expect = 1.570e-16
Identity = 47/173 (27.17%), Postives = 81/173 (46.82%), Query Frame = 2
Query:  167 TNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TN R    +H+A   G  E+   ++      +   +    PLH     G  +IVQLLL      +  T +G  P+H +   G  ++A  L+       + TK+G+T +H AA  G ++V KLL++++   D   K+G  P+ +A  Y + ++  LL+         A++G  P
Sbjct:  439 TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTP 611          

HSP 8 Score: 86.6557 bits (213), Expect = 1.611e-16
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N+NG   LH     GH+ +VQ LL +   ++  T  G   +H A   G  E+ K L+ +   ++ Q++ G+T ++ AA   HI+VVK L+E   N     +DG  P+ +A   GH + V +L+ N
Sbjct:   40 NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN 164          

HSP 9 Score: 85.5001 bits (210), Expect = 3.378e-16
Identity = 45/150 (30.00%), Postives = 71/150 (47.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+HIA  K   ++A  ++N         K G  PLH     GH D+V LLL K   I+  T  G+  +H A       +A  L       D  TK G+T +  A   G++++V  L+++  N + + K+G  P+  A   GH  I+ +L+
Sbjct:  611 PLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLL 760          

HSP 10 Score: 85.5001 bits (210), Expect = 3.678e-16
Identity = 41/166 (24.70%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   ++    + + +N  G   LH     G +++V+ LL     ++ +  +   P+H A   G  EI + L+      D  T  G+T +H +A  G ++V  +L+E      +  K G  P+ +A  YG +++ KLL+  +  +    ++G+ P
Sbjct:  413 PIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 578          

HSP 11 Score: 85.1149 bits (209), Expect = 5.213e-16
Identity = 43/166 (25.90%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K   ++ E +V    + +   ++G  P+H     GHL+IV LLL      +     G   +H A   G  E+ + L+    L+D + ++  T +H A+  G  E+V+LL++   + D    +G  P+ I+   G +++  +L+          + G  P
Sbjct:  380 PLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTP 545          

HSP 12 Score: 83.5741 bits (205), Expect = 1.536e-15
Identity = 41/125 (32.80%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+LD V   L    +IN    +G+  +H A   GH  + +EL+ +   +D  TK+G T++H A+  G  EVVK+L+++  N + Q ++G  P+ +A    HI++VK L+ N         DG  P
Sbjct:   21 GNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTP 145          

HSP 13 Score: 81.6481 bits (200), Expect = 5.274e-15
Identity = 63/258 (24.42%), Postives = 105/258 (40.70%), Query Frame = 2
Query:   35 NYCNLILIRMSESEIFKDFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLH--------------------------------HCCAN-GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N   L+L R +      DF  +N +  +   S   N N++  ++D    I   TR    P+H A   G  ++ E ++ +        KNG  PLH                                H  A+ GH  + +LLL K    N +  +G  P+H AC     ++ + L+     +   T+ G T IH AA  GH+ +V LL++   + D+ +  G   + +A   G +E+V+ L+ N  +    AR+   P
Sbjct:  226 NVATLLLNRGAAV----DFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 479          

HSP 14 Score: 78.1814 bits (191), Expect = 6.705e-14
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K  N   S K+G   LH       +++  +L     + +  T  G  P+  AC  G+ ++   L+ +   ++ +TK G+T +H AA  GH  ++ +L++     +    +G   + IA   G+I +V  L
Sbjct:  644 PLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 792          

HSP 15 Score: 75.8702 bits (185), Expect = 3.259e-13
Identity = 49/215 (22.79%), Postives = 87/215 (40.47%), Query Frame = 2
Query:  155 IDITT----NTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDK--------DGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            IDI T        +H+A  +G   + + ++ +  + + + K G   LH     G  ++V++L+ +   IN Q+ +G  P++ A    H ++ K L+         T+ G+T +  A   GH + V +L+E                                N D+Q K         G  P+ IA  YG++ +  LL+N        AR+G+ P
Sbjct:   34 IDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITP 248          
BLAST of SMED30023739 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 104.375 bits (259), Expect = 5.652e-22
Identity = 56/196 (28.57%), Postives = 104/196 (53.06%), Query Frame = 2
Query:   89 FVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
             +LQN+     D+ +  ++N+  +  +   P+HIA + G   +A  ++N+    +++ +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH ++ + L+ +   L  +TK G + +H AA   H+E VK L++ K   D    D    + +A   GH  + KLL++ +      A +G  P
Sbjct:  182 LLLQNDHNA--DVQSKMMVNRTTE--SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 373          

HSP 2 Score: 98.9821 bits (245), Expect = 3.049e-20
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H+A  +G   M + ++++    +   ++G  PLH    +GH  +V+LLL +   +  +T +G+ P+H A    H E  K L+     +D  T    T++H AA  GH  V KLL++K+ N + +  +G  P+ IAC    I++++LL+
Sbjct:  241 PLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLV 390          

HSP 3 Score: 95.9005 bits (237), Expect = 2.354e-19
Identity = 47/166 (28.31%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  ++ K  +   + KNG+ PLH       + I   LL+   E N  T  G+ P+H A   GH ++   L+ K   + + TK G TS+H AA    + V  +L +   + D   K G  P+++AC YG++++V  L+          ++G  P
Sbjct:  571 PLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTP 736          

HSP 4 Score: 92.4337 bits (228), Expect = 3.026e-18
Identity = 56/199 (28.14%), Postives = 93/199 (46.73%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPS--VAGEIHLDKKCLEFLGGIQHS---KQIFSCL 763
            +H+A + G + + + +++K+ N      NG+ PLH  C    + +++LL+     I   T  G+ PIH A   GH  I   L+      D+   +G T++H AA  G +EVV+ L+      D + ++   P+ IA   G  EIV+LL+ +         +G  P    A E  +D   +    G  HS   K+ F+ L
Sbjct:  341 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPL 539          

HSP 5 Score: 88.9669 bits (219), Expect = 3.660e-17
Identity = 47/166 (28.31%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA   G  E+ + ++    + + +  NG+ PLH     G +D+  +LL      +  T  G  P+H A   G  ++AK L+ +    D   K G T +H AA   + +V  LL+EK  +     K+G  P+ IA     ++I   L+N    +    + GV P
Sbjct:  472 PLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTP 637          

HSP 6 Score: 87.0409 bits (214), Expect = 1.322e-16
Identity = 42/156 (26.92%), Postives = 75/156 (48.08%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            T    P+HI+  +G  ++A  ++        + K G+ PLH     G LD+ +LLL +    +    +G+ P+H A    + ++A  L+ K        K G+T +H AA    +++   L+     T+I  K G  P+ +A   GH ++V LL++
Sbjct:  500 TNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLD 655          

HSP 7 Score: 87.0409 bits (214), Expect = 1.403e-16
Identity = 47/173 (27.17%), Postives = 81/173 (46.82%), Query Frame = 2
Query:  167 TNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TN R    +H+A   G  E+   ++      +   +    PLH     G  +IVQLLL      +  T +G  P+H +   G  ++A  L+       + TK+G+T +H AA  G ++V KLL++++   D   K+G  P+ +A  Y + ++  LL+         A++G  P
Sbjct:  432 TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTP 604          

HSP 8 Score: 87.0409 bits (214), Expect = 1.427e-16
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N+NG   LH     GH+ +VQ LL +   ++  T  G   +H A   G  E+ K L+ +   ++ Q++ G+T ++ AA   HI+VVK L+E   N     +DG  P+ +A   GH + V +L+ N
Sbjct:   33 NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN 157          

HSP 9 Score: 85.8853 bits (211), Expect = 3.284e-16
Identity = 41/166 (24.70%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   ++    + + +N  G   LH     G +++V+ LL     ++ +  +   P+H A   G  EI + L+      D  T  G+T +H +A  G ++V  +L+E      +  K G  P+ +A  YG +++ KLL+  +  +    ++G+ P
Sbjct:  406 PIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 571          

HSP 10 Score: 85.8853 bits (211), Expect = 3.284e-16
Identity = 45/152 (29.61%), Postives = 72/152 (47.37%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIA  K   ++A  ++N         K G  PLH     GH D+V LLL K   I+  T  G+  +H A       +A  L       D  TK G+T +  A   G++++V  L+++  N + + K+G  P+  A   GH  I+ +L+ +
Sbjct:  604 PLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQH 755          

HSP 11 Score: 85.5001 bits (210), Expect = 4.348e-16
Identity = 43/166 (25.90%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K   ++ E +V    + +   ++G  P+H     GHL+IV LLL      +     G   +H A   G  E+ + L+    L+D + ++  T +H A+  G  E+V+LL++   + D    +G  P+ I+   G +++  +L+          + G  P
Sbjct:  373 PLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTP 538          

HSP 12 Score: 83.5741 bits (205), Expect = 1.610e-15
Identity = 41/125 (32.80%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+LD V   L    +IN    +G+  +H A   GH  + +EL+ +   +D  TK+G T++H A+  G  EVVK+L+++  N + Q ++G  P+ +A    HI++VK L+ N         DG  P
Sbjct:   14 GNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTP 138          

HSP 13 Score: 82.0333 bits (201), Expect = 4.504e-15
Identity = 63/258 (24.42%), Postives = 105/258 (40.70%), Query Frame = 2
Query:   35 NYCNLILIRMSESEIFKDFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLH--------------------------------HCCAN-GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N   L+L R +      DF  +N +  +   S   N N++  ++D    I   TR    P+H A   G  ++ E ++ +        KNG  PLH                                H  A+ GH  + +LLL K    N +  +G  P+H AC     ++ + L+     +   T+ G T IH AA  GH+ +V LL++   + D+ +  G   + +A   G +E+V+ L+ N  +    AR+   P
Sbjct:  219 NVATLLLNRGAAV----DFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 472          

HSP 14 Score: 78.1814 bits (191), Expect = 6.548e-14
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K  N   S K+G   LH       +++  +L     + +  T  G  P+  AC  G+ ++   L+ +   ++ +TK G+T +H AA  GH  ++ +L++     +    +G   + IA   G+I +V  L
Sbjct:  637 PLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 785          

HSP 15 Score: 75.8702 bits (185), Expect = 3.374e-13
Identity = 49/215 (22.79%), Postives = 87/215 (40.47%), Query Frame = 2
Query:  155 IDITT----NTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDK--------DGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            IDI T        +H+A  +G   + + ++ +  + + + K G   LH     G  ++V++L+ +   IN Q+ +G  P++ A    H ++ K L+         T+ G+T +  A   GH + V +L+E                                N D+Q K         G  P+ IA  YG++ +  LL+N        AR+G+ P
Sbjct:   27 IDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITP 241          
BLAST of SMED30023739 vs. Ensembl Human
Match: ANK2 (ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493])

HSP 1 Score: 103.99 bits (258), Expect = 6.890e-22
Identity = 47/166 (28.31%), Postives = 83/166 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A   G  ++A+ ++ ++   + + KNG+ PLH       + I   LL+   E N  T  G+ P+H A   GH ++   L+ K   + + TK G TS+H AA    + V  +L +   + D   K G  P+++AC YG++++V  L+          ++G  P
Sbjct:  488 PLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTP 653          

HSP 2 Score: 103.99 bits (258), Expect = 7.009e-22
Identity = 51/166 (30.72%), Postives = 90/166 (54.22%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA + G   +A  ++N+    +++ +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH ++ + L+ +   L  +TK G + +H AA   H+E VK L++ K   D    D    + +A   GH  + KLL++ +      A  G+ P
Sbjct:  191 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTP 356          

HSP 3 Score: 103.219 bits (256), Expect = 1.341e-21
Identity = 49/152 (32.24%), Postives = 81/152 (53.29%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+H+A  +G   M + ++++    +   ++G  PLH    +GH  +V+LLL +   +  +T +G+ P+H A    H E  K L+     +D  T    T++H AA  GH  V KLL++K+ N + +   G  PI +A   GH+ IV LL+ N
Sbjct:  224 PLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQN 375          

HSP 4 Score: 93.2041 bits (230), Expect = 1.574e-18
Identity = 43/151 (28.48%), Postives = 74/151 (49.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            P+HIA   G  E+ + ++    + + +  NG+ PLH     G +D+  +LL      +  T  G  P+H A   G  ++AK L+ +    D   K G+T +H AA    +++   L+     T+I  K G  P+ +A   GH ++V LL++
Sbjct:  422 PLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLD 572          

HSP 5 Score: 91.2781 bits (225), Expect = 5.649e-18
Identity = 45/152 (29.61%), Postives = 85/152 (55.92%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA  K   + A  ++    N +  +K+G+ PLH     G++++  LLL++   ++    +G+ P+H A   G+  + K L+ +   +D +T+ G T +H AA +GH +VV+LL+E+      + K+G  P+ +A    H+E VK L+ ++
Sbjct:  159 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK 310          

HSP 6 Score: 88.5817 bits (218), Expect = 3.871e-17
Identity = 48/165 (29.09%), Postives = 78/165 (47.27%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA   G  E+ + +V +  N    ++NG+ PL+      H+D+V+ LL      +  T DG  P+  A   GH +    L+  D     + K    ++H AA     +   LL++   N D+Q K G  P+ IA  YG++ +  LL+N        AR+G+ P
Sbjct:   64 LHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDT----KGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITP 224          

HSP 7 Score: 87.8113 bits (216), Expect = 7.650e-17
Identity = 60/225 (26.67%), Postives = 102/225 (45.33%), Query Frame = 2
Query:   35 NYCNLILIRMSESEIFKDFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N   L+L R +      DF  +N +  +   S   N N++  ++D    I   TR    P+H A   G  ++ E ++ +        KNG  PLH      H++ V+ LL     ++  T D +  +H A   GH+ + K L+ K    + +   G T IH AA  GH+ +V LL++   + D+ +  G   + +A   G +E+V+ L+ N  +    AR+   P
Sbjct:  202 NVATLLLNRGAAV----DFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 422          

HSP 8 Score: 86.6557 bits (213), Expect = 1.618e-16
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N+NG   LH     GH+ +VQ LL +   ++  T  G   +H A   G  E+ K L+ +   ++ Q++ G+T ++ AA   HI+VVK L+E   N     +DG  P+ +A   GH + V +L+ N
Sbjct:   24 NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN 148          

HSP 9 Score: 85.5001 bits (210), Expect = 3.541e-16
Identity = 45/152 (29.61%), Postives = 72/152 (47.37%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIA  K   ++A  ++N         K G  PLH     GH D+V LLL K   I+  T  G+  +H A       +A  L       D  TK G+T +  A   G++++V  L+++  N + + K+G  P+  A   GH  I+ +L+ +
Sbjct:  521 PLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQH 672          

HSP 10 Score: 85.1149 bits (209), Expect = 4.977e-16
Identity = 48/173 (27.75%), Postives = 80/173 (46.24%), Query Frame = 2
Query:  167 TNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TN R    +H+A   G  E+   ++      +   +    PLH     G  +IVQLLL      +  T +G  P+H +   G  ++A  L+       + TK+G+T +H AA  G ++V KLL++++   D   K+G  P+ IA     ++I   L+N    +    + GV P
Sbjct:  382 TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTP 554          

HSP 11 Score: 84.7297 bits (208), Expect = 5.900e-16
Identity = 41/166 (24.70%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   ++    + + +N  G   LH     G +++V+ LL     ++ +  +   P+H A   G  EI + L+      D  T  G+T +H +A  G ++V  +L+E      +  K G  P+ +A  YG +++ KLL+  +  +    ++G  P
Sbjct:  356 PIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGYTP 521          

HSP 12 Score: 83.5741 bits (205), Expect = 1.638e-15
Identity = 41/125 (32.80%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+LD V   L    +IN    +G+  +H A   GH  + +EL+ +   +D  TK+G T++H A+  G  EVVK+L+++  N + Q ++G  P+ +A    HI++VK L+ N         DG  P
Sbjct:    5 GNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTP 129          

HSP 13 Score: 80.4925 bits (197), Expect = 1.306e-14
Identity = 40/165 (24.24%), Postives = 78/165 (47.27%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A + G + + + +++K+ N      +G  P+H     GHL+IV LLL      +     G   +H A   G  E+ + L+    L+D + ++  T +H A+  G  E+V+LL++   + D    +G  P+ I+   G +++  +L+          + G  P
Sbjct:  324 LHVAAHCGHYRVTKLLLDKRANPNARALSGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTP 488          

HSP 14 Score: 78.1814 bits (191), Expect = 6.914e-14
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K  N   S K+G   LH       +++  +L     + +  T  G  P+  AC  G+ ++   L+ +   ++ +TK G+T +H AA  GH  ++ +L++     +    +G   + IA   G+I +V  L
Sbjct:  554 PLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 702          

HSP 15 Score: 78.1814 bits (191), Expect = 7.400e-14
Identity = 42/195 (21.54%), Postives = 85/195 (43.59%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCE-----------------------------INCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+++A  +   ++ ++++    N   + ++G+ PL      GH   V +LL  D +                              + Q+  G  P+H A   G+  +A  L+ +   +D   + G T +H A+  G+  +VKLL+++    D + +DG  P+  A   GH ++V+LL+          ++G++P
Sbjct:   96 PLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSP 290          
BLAST of SMED30023739 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 102.449 bits (254), Expect = 3.121e-21
Identity = 56/183 (30.60%), Postives = 94/183 (51.37%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            ++PN+ N  ++      P+H+A   G  E+A++++  K       K+   PLH     GH ++V+LLL  +   N  T  G  P+H A   GH E    L+ K+      TK+G+T +H AA  G + V +LL+E+  + +   K+G  P+ +A  + +++IVKLL+        PA +G  P
Sbjct:  428 ASPNVSNVKVET-----PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTP 605          

HSP 2 Score: 97.4413 bits (241), Expect = 1.047e-19
Identity = 55/191 (28.80%), Postives = 96/191 (50.26%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQI 751
            P+H+A   G   +AE ++ +  +   + KNG  PLH    + +LDIV+LLL +    +    +G  P+H A      E+A+ L+      + ++ QG T +H AA  GH E+V LL+ K+ N ++ +K G  P+ +    GH+ +  +LI +  +     R G  P      + + K ++FL  +QH   +
Sbjct:  539 PLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL--LQHQADV 727          

HSP 3 Score: 97.0561 bits (240), Expect = 1.294e-19
Identity = 53/163 (32.52%), Postives = 84/163 (51.53%), Query Frame = 2
Query:  149 KIIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +I DIT +   P+H+A + G   +A+ +++K         NG+ PLH  C   H+ +++LLL     I+  T  G+ P+H A   GH  I K L+ +    ++   +  T +H AA  GH EV K L++ K   + + KD   P+  A   GH  +VKLL+ N
Sbjct:  330 EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLEN 492          

HSP 4 Score: 96.6709 bits (239), Expect = 1.573e-19
Identity = 53/166 (31.93%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + E ++    + +   ++G  PLH     GHL IV+ LL +    N        P+H A   GH E+AK L+     ++ + K   T +H AA  GH  +VKLL+E   N ++    G  P+ IA   GH+E V  L+  +    C  + G  P
Sbjct:  374 PLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTP 539          

HSP 5 Score: 96.2857 bits (238), Expect = 2.445e-19
Identity = 53/182 (29.12%), Postives = 95/182 (52.20%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            NP++++K     T   P+HIA +     +A+ ++N+  +  ++ +NG  PLH     G++ +V+LLL +  +I  +T D + P+H A  NGH  I++ L+     +  +TK G + IH AA   H++ V+LL++     D    D   P+ +A   GH  + K+L++        A +G  P
Sbjct:  198 NPDVLSK-----TGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTP 374          

HSP 6 Score: 95.5153 bits (236), Expect = 4.067e-19
Identity = 52/166 (31.33%), Postives = 83/166 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA  +   E+A  ++    +    +  G  PLH     GH ++V LLLSK    N     G+ P+H     GH  +A  LI    ++D  T+ G+T +H A+  G+I++VK L++ + + + + K G  P+  A   GH +IV LL+ N       + DG  P
Sbjct:  605 PLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTP 770          

HSP 7 Score: 95.1301 bits (235), Expect = 5.709e-19
Identity = 53/167 (31.74%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            L+++   I T T+    P+H A   G   ++E +++     +   KNG  P+H      HLD V+LLL  D EI+  T D + P+H A   GH  +AK L+ K    + +   G+T +H A    H+ V++LL++   + D   + G  P+ +A   GH+ IVK L+
Sbjct:  258 LLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLL 424          

HSP 8 Score: 92.0485 bits (227), Expect = 4.406e-18
Identity = 47/150 (31.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+HIA  +G   M   ++++    E   K+   PLH    NGH+ I ++LL     I  +T +G+ PIH A    H +  + L+  D  +D  T    T +H AA  GH  V K+L++K    + +  +G  P+ IAC   H+ +++LL+
Sbjct:  242 PLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLL 391          

HSP 9 Score: 90.8929 bits (224), Expect = 9.290e-18
Identity = 44/149 (29.53%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  EM   +++K+ N    NK+G  PLH     GH+ +  +L+     ++  T  G  P+H A   G+ ++ K L+     ++ +TK G++ +H AA  GH ++V LL++   + +    DG  P+ IA   G+I +  +L
Sbjct:  638 PLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 10 Score: 87.8113 bits (216), Expect = 9.083e-17
Identity = 54/201 (26.87%), Postives = 92/201 (45.77%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFL---GGIQHS 742
            ID  T +   P+H+A   G   + + ++ +  +   SN     PLH     GH ++ + LL    ++N +  D   P+H A   GH  + K L+  +   ++ T  G T +H AA  GH+E V  L+EK+ +     K G  P+ +A  YG + + +LL+          ++G+ P      H +   ++ L   GG  HS
Sbjct:  397 IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHS 597          

HSP 11 Score: 81.6481 bits (200), Expect = 7.251e-15
Identity = 42/124 (33.87%), Postives = 67/124 (54.03%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            N+NG   LH     GH+ +V  LL K+  +   T  G   +H A   G  E+ +EL+     ++ Q+++G+T ++ AA   H+EVVK L+E   N ++  +DG  P+ +A   GH  +V  LIN
Sbjct:   42 NQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN 165          

HSP 12 Score: 79.337 bits (194), Expect = 3.749e-14
Identity = 44/168 (26.19%), Postives = 86/168 (51.19%), Query Frame = 2
Query:  137 NLINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            N++  +I+  T  +     +HIA        A  ++    N +  +K G+ PLH      +L++ QLLL++   +N    +G+ P+H A   G+  + + L+ +   ++ +TK   T +H AA NGH+ + ++L++       + K+G  PI +A    H++ V+LL+
Sbjct:  158 NVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLL 325          

HSP 13 Score: 77.411 bits (189), Expect = 1.393e-13
Identity = 44/166 (26.51%), Postives = 75/166 (45.18%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G   M + ++    N   +   G  PLH     GH++ V  LL K+    C T  G  P+H A   G   +A+ L+ +D   +   K G T +H A  + ++++VKLL+ +  +      +G  P+ IA     +E+ + L+     +   +  GV P
Sbjct:  473 PLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTP 638          

HSP 14 Score: 77.0258 bits (188), Expect = 1.664e-13
Identity = 43/129 (33.33%), Postives = 69/129 (53.49%), Query Frame = 2
Query:  299 NGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN---NQNISFCPARDGVAP 676
            +G+LD     L    +IN    +G+  +H A   GH ++  EL+ K+ +L+  TK+G T++H AA  G  EVV+ L+    N + Q + G  P+ +A    H+E+VK L+    NQN++     DG  P
Sbjct:   22 SGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVA---TEDGFTP 147          

HSP 15 Score: 70.4774 bits (171), Expect = 1.749e-11
Identity = 55/218 (25.23%), Postives = 92/218 (42.20%), Query Frame = 2
Query:   98 QNNLKGIMDLSNP-------NLINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELI-----------------------------AKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            QN L G+   S          L++K I + T T+     +HIA   G  E+   +VN   N    ++ G+ PL+      HL++V+ LL      N  T DG  P+  A   GH  +   LI                               D   D+ +K G+T +H AA   ++ V +LL+ +  + +   ++G  P+ IA   G++ +V+LL++
Sbjct:   43 QNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLD 260          
BLAST of SMED30023739 vs. Ensembl Human
Match: ANK1 (ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492])

HSP 1 Score: 102.449 bits (254), Expect = 3.121e-21
Identity = 56/183 (30.60%), Postives = 94/183 (51.37%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            ++PN+ N  ++      P+H+A   G  E+A++++  K       K+   PLH     GH ++V+LLL  +   N  T  G  P+H A   GH E    L+ K+      TK+G+T +H AA  G + V +LL+E+  + +   K+G  P+ +A  + +++IVKLL+        PA +G  P
Sbjct:  428 ASPNVSNVKVET-----PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTP 605          

HSP 2 Score: 97.4413 bits (241), Expect = 1.047e-19
Identity = 55/191 (28.80%), Postives = 96/191 (50.26%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQI 751
            P+H+A   G   +AE ++ +  +   + KNG  PLH    + +LDIV+LLL +    +    +G  P+H A      E+A+ L+      + ++ QG T +H AA  GH E+V LL+ K+ N ++ +K G  P+ +    GH+ +  +LI +  +     R G  P      + + K ++FL  +QH   +
Sbjct:  539 PLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL--LQHQADV 727          

HSP 3 Score: 97.0561 bits (240), Expect = 1.294e-19
Identity = 53/163 (32.52%), Postives = 84/163 (51.53%), Query Frame = 2
Query:  149 KIIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +I DIT +   P+H+A + G   +A+ +++K         NG+ PLH  C   H+ +++LLL     I+  T  G+ P+H A   GH  I K L+ +    ++   +  T +H AA  GH EV K L++ K   + + KD   P+  A   GH  +VKLL+ N
Sbjct:  330 EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLEN 492          

HSP 4 Score: 96.6709 bits (239), Expect = 1.573e-19
Identity = 53/166 (31.93%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + E ++    + +   ++G  PLH     GHL IV+ LL +    N        P+H A   GH E+AK L+     ++ + K   T +H AA  GH  +VKLL+E   N ++    G  P+ IA   GH+E V  L+  +    C  + G  P
Sbjct:  374 PLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTP 539          

HSP 5 Score: 96.2857 bits (238), Expect = 2.445e-19
Identity = 53/182 (29.12%), Postives = 95/182 (52.20%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            NP++++K     T   P+HIA +     +A+ ++N+  +  ++ +NG  PLH     G++ +V+LLL +  +I  +T D + P+H A  NGH  I++ L+     +  +TK G + IH AA   H++ V+LL++     D    D   P+ +A   GH  + K+L++        A +G  P
Sbjct:  198 NPDVLSK-----TGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTP 374          

HSP 6 Score: 95.5153 bits (236), Expect = 4.067e-19
Identity = 52/166 (31.33%), Postives = 83/166 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA  +   E+A  ++    +    +  G  PLH     GH ++V LLLSK    N     G+ P+H     GH  +A  LI    ++D  T+ G+T +H A+  G+I++VK L++ + + + + K G  P+  A   GH +IV LL+ N       + DG  P
Sbjct:  605 PLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTP 770          

HSP 7 Score: 95.1301 bits (235), Expect = 5.710e-19
Identity = 53/167 (31.74%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            L+++   I T T+    P+H A   G   ++E +++     +   KNG  P+H      HLD V+LLL  D EI+  T D + P+H A   GH  +AK L+ K    + +   G+T +H A    H+ V++LL++   + D   + G  P+ +A   GH+ IVK L+
Sbjct:  258 LLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLL 424          

HSP 8 Score: 92.0485 bits (227), Expect = 4.407e-18
Identity = 47/150 (31.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+HIA  +G   M   ++++    E   K+   PLH    NGH+ I ++LL     I  +T +G+ PIH A    H +  + L+  D  +D  T    T +H AA  GH  V K+L++K    + +  +G  P+ IAC   H+ +++LL+
Sbjct:  242 PLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLL 391          

HSP 9 Score: 90.8929 bits (224), Expect = 9.292e-18
Identity = 44/149 (29.53%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  EM   +++K+ N    NK+G  PLH     GH+ +  +L+     ++  T  G  P+H A   G+ ++ K L+     ++ +TK G++ +H AA  GH ++V LL++   + +    DG  P+ IA   G+I +  +L
Sbjct:  638 PLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 10 Score: 87.8113 bits (216), Expect = 9.084e-17
Identity = 54/201 (26.87%), Postives = 92/201 (45.77%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFL---GGIQHS 742
            ID  T +   P+H+A   G   + + ++ +  +   SN     PLH     GH ++ + LL    ++N +  D   P+H A   GH  + K L+  +   ++ T  G T +H AA  GH+E V  L+EK+ +     K G  P+ +A  YG + + +LL+          ++G+ P      H +   ++ L   GG  HS
Sbjct:  397 IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHS 597          

HSP 11 Score: 81.6481 bits (200), Expect = 7.252e-15
Identity = 42/124 (33.87%), Postives = 67/124 (54.03%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            N+NG   LH     GH+ +V  LL K+  +   T  G   +H A   G  E+ +EL+     ++ Q+++G+T ++ AA   H+EVVK L+E   N ++  +DG  P+ +A   GH  +V  LIN
Sbjct:   42 NQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN 165          

HSP 12 Score: 79.337 bits (194), Expect = 3.750e-14
Identity = 44/168 (26.19%), Postives = 86/168 (51.19%), Query Frame = 2
Query:  137 NLINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            N++  +I+  T  +     +HIA        A  ++    N +  +K G+ PLH      +L++ QLLL++   +N    +G+ P+H A   G+  + + L+ +   ++ +TK   T +H AA NGH+ + ++L++       + K+G  PI +A    H++ V+LL+
Sbjct:  158 NVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLL 325          

HSP 13 Score: 77.411 bits (189), Expect = 1.393e-13
Identity = 44/166 (26.51%), Postives = 75/166 (45.18%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G   M + ++    N   +   G  PLH     GH++ V  LL K+    C T  G  P+H A   G   +A+ L+ +D   +   K G T +H A  + ++++VKLL+ +  +      +G  P+ IA     +E+ + L+     +   +  GV P
Sbjct:  473 PLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTP 638          

HSP 14 Score: 77.0258 bits (188), Expect = 1.664e-13
Identity = 43/129 (33.33%), Postives = 69/129 (53.49%), Query Frame = 2
Query:  299 NGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN---NQNISFCPARDGVAP 676
            +G+LD     L    +IN    +G+  +H A   GH ++  EL+ K+ +L+  TK+G T++H AA  G  EVV+ L+    N + Q + G  P+ +A    H+E+VK L+    NQN++     DG  P
Sbjct:   22 SGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVA---TEDGFTP 147          

HSP 15 Score: 70.4774 bits (171), Expect = 1.750e-11
Identity = 55/218 (25.23%), Postives = 92/218 (42.20%), Query Frame = 2
Query:   98 QNNLKGIMDLSNP-------NLINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELI-----------------------------AKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            QN L G+   S          L++K I + T T+     +HIA   G  E+   +VN   N    ++ G+ PL+      HL++V+ LL      N  T DG  P+  A   GH  +   LI                               D   D+ +K G+T +H AA   ++ V +LL+ +  + +   ++G  P+ IA   G++ +V+LL++
Sbjct:   43 QNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLD 260          
BLAST of SMED30023739 vs. Ensembl Celegans
Match: trp-4 (TRP (Transient receptor potential) channel family [Source:UniProtKB/TrEMBL;Acc:Q9GRV5])

HSP 1 Score: 94.3597 bits (233), Expect = 3.203e-19
Identity = 48/168 (28.57%), Postives = 86/168 (51.19%), Query Frame = 2
Query:  143 INKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKN-GWRPLHHCCANGHLDIVQLLLSKDCEINCQTN-DGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQN 640
            +NK         P+H+A   G   +   ++N+    + ++      PLH     GH+ +V +LLS+  +     +  G  P+H A  NGH+E+   LIA+   +++  + GWT +H+A   GH+ VVKL I+   +   + K+G  P+  A A+ HIE ++ L+  ++
Sbjct: 1196 VNKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAETKEGKVPLCFAAAHNHIECLRFLLKQKH 1363          

HSP 2 Score: 90.5077 bits (223), Expect = 4.828e-18
Identity = 52/173 (30.06%), Postives = 87/173 (50.29%), Query Frame = 2
Query:  233 NKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINC-QTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGW---TSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQH 739
            N   N E+S + G+ PLH    +GH  +V++LL++  +++   T   + P+H A   GH  +   L+++      Q  + W   T +H AA NGH E+V LLI +  N ++ D++G   +  A   GH+ +VKL I++        ++G  P      H   +CL FL   +H
Sbjct: 1193 NHHVNKEFSTEYGFTPLHLAAQSGHDSLVRMLLNQGVQVDATSTTMNVIPLHLAAQQGHIAVVGMLLSRST--QQQHAKDWRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAETKEGKVPLCFAAAHNHIECLRFLLKQKH 1363          

HSP 3 Score: 72.7886 bits (177), Expect = 1.306e-12
Identity = 38/131 (29.01%), Postives = 68/131 (51.91%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWR---PLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNT 547
            T N  P+H+A  +G   +   ++++    +++    WR   PLH    NGH ++V LL+++   IN    +G   +HFA   GH  + K  I        +TK+G   + +AA + HIE ++ L+++K +T
Sbjct: 1237 TMNVIPLHLAAQQGHIAVVGMLLSRSTQQQHAKD--WRGRTPLHLAAQNGHYEMVSLLIAQGSNINVMDQNGWTGLHFATRAGHLSVVKLFIDSSADPLAETKEGKVPLCFAAAHNHIECLRFLLKQKHDT 1365          

HSP 4 Score: 70.4774 bits (171), Expect = 6.521e-12
Identity = 47/169 (27.81%), Postives = 79/169 (46.75%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +  L+N +ID         +  N+    MA    N+       NK G          G + IVQ         N Q+ +G  P+  ACA GH  +A  L+     +D+  + G T++H AA NGH+ +V LL++ K   + + K G  P+ +A  +GH+++V +L+ + 
Sbjct:  826 DAKLVNLLIDYGGMVEMPSLNANETAMHMAARSGNQAVLLAMVNKIG---------AGAVQIVQ---------NKQSKNGWSPLLEACARGHSGVANILLKHHARIDVFDEMGRTALHLAAFNGHLSLVHLLLQHKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQDH 976          

HSP 5 Score: 63.5438 bits (153), Expect = 9.269e-10
Identity = 43/169 (25.44%), Postives = 75/169 (44.38%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSK-DCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N N+ N++        P+H     G   M + M   + +    +K    P+H     G   +V+ L+ K    I  +T DG   +H A  +GH   A   + +   L +  K+G   +H AA  G  +VVK+LI +  N D++ +D    + +A   G   +V+ L+ +
Sbjct:  518 NANVQNRV-----GRTPLHEVAEVGDQNMLKIMFKLRADANIHDKEDKTPVHVAAERGDTSMVESLIDKFGGSIRARTRDGSTLLHIAACSGHTSTALAFLKRGVPLFMPNKKGALGLHSAAAAGFNDVVKMLIARGTNVDVRTRDNYTALHVAVQSGKASVVETLLGS 681          

HSP 6 Score: 56.225 bits (134), Expect = 1.430e-7
Identity = 39/157 (24.84%), Postives = 68/157 (43.31%), Query Frame = 2
Query:  170 NTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLL----SKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGW---TSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVK 619
            N   +H A   G   +++ ++    N    +  G  PLH    N   D+V+L L    +    +    ++G    H A   G   + +EL+  D  + IQ K      T++H AA  GH  +VK+L+E   N + ++  G   + +    G I I++
Sbjct:  987 NQTALHFAAKFGQLAVSQTLLALGANPNARDDKGQTPLHLAAENDFPDVVKLFLKMRNNNRSVLTAIDHNGFTCAHIAAMKGSLAVVRELMMIDKPMVIQAKTKTLEATTLHMAAAGGHANIVKILLENGANAEDENSHGMTALHLGAKNGFISILE 1143          

HSP 7 Score: 51.9878 bits (123), Expect = 2.553e-6
Identity = 48/193 (24.87%), Postives = 79/193 (40.93%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKD-CEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCN-----TDIQDKDG--C--------------------RPILI--------------ACAYGHIEIVKLLINN 634
            +H+A   G   +   ++  K      +K G  PLH    +GH+ +V +L+      +   T D    +HFA   G   +++ L+A     + +  +G T +H AA N   +VVKL ++ + N     T I D +G  C                    +P++I              A A GH  IVK+L+ N
Sbjct:  924 LHLAAFNGHLSLVHLLLQHKAFVNSKSKTGEAPLHLAAQHGHVKVVNVLVQDHGAALEAITLDNQTALHFAAKFGQLAVSQTLLALGANPNARDDKGQTPLHLAAENDFPDVVKLFLKMRNNNRSVLTAI-DHNGFTCAHIAAMKGSLAVVRELMMIDKPMVIQAKTKTLEATTLHMAAAGGHANIVKILLEN 1115          
BLAST of SMED30023739 vs. Ensembl Celegans
Match: mask-1 (Ankyrin repeat and KH domain-containing protein mask-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21920])

HSP 1 Score: 90.8929 bits (224), Expect = 4.413e-18
Identity = 50/169 (29.59%), Postives = 89/169 (52.66%), Query Frame = 2
Query:  143 INKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINC----QTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNG-HIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            IN  I+   NT  + +A  +G  E+ + ++    N E+  K G  PL  C + G++D+  LL++   + N     QT D    +  +   GH +  + L+  D  +D++ K+G T++ W ACNG ++   + L+EK  + D+ D     P++ A   GH+EIVK ++N+
Sbjct: 1398 INAQIETNRNTA-LTLASFQGRTEVVKLLLAYNANVEHRAKTGLTPLMECASGGYVDVGNLLIAAGADTNASPVQQTKDTA--LTISAEKGHEKFVRMLLNGDAAVDVRNKKGCTAL-WLACNGGYLSTAQALLEKGADPDMFDNRKISPMMAAFRKGHVEIVKYMVNS 1562          

HSP 2 Score: 73.9442 bits (180), Expect = 5.636e-13
Identity = 39/150 (26.00%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  188 IACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGM-RPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIE--KKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            IAC  G  ++ E ++ +  N E+ +K G+ PL      GH  +V++LL     I  Q++      +  AC+ G  ++ + L+A     + +    +T +  A+  G+IE+V +L+    + N+    K G  P+++A   GH E  ++L+
Sbjct: 1243 IACANGHKDIVELLLKEGANIEHRDKKGFSPLIIAATAGHSSVVEVLLKNHAAIEAQSDRTKDTALSLACSGGRKDVVELLLAHGANKEHRNVSDYTPLSLASSGGYIEIVNMLLTAGSEINSRTGSKLGISPLMLASMNGHREATRVLL 1392          

HSP 3 Score: 67.0106 bits (162), Expect = 7.710e-11
Identity = 45/160 (28.12%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMV--NKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQ--TNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDI----QDKDGCRPILIACAYGHIEIVKLLINN 634
            P+ +A + G+ E+   ++    + N    +K G  PL     NGH +  ++LL K  +IN Q  TN     +  A   G  E+ K L+A +  ++ + K G T +   A  G+++V  LLI    +T+     Q KD    + I+   GH + V++L+N 
Sbjct: 1340 PLSLASSGGYIEIVNMLLTAGSEINSRTGSKLGISPLMLASMNGHREATRVLLEKGSDINAQIETNRNTA-LTLASFQGRTEVVKLLLAYNANVEHRAKTGLTPLMECASGGYVDVGNLLIAAGADTNASPVQQTKDTA--LTISAEKGHEKFVRMLLNG 1496          

HSP 4 Score: 60.077 bits (144), Expect = 1.034e-8
Identity = 47/188 (25.00%), Postives = 87/188 (46.28%), Query Frame = 2
Query:  119 MDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQT---NDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQD-KDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGV 670
            +D+SNP+         T   P+ +A   G+  + + ++ K  +      +   P+     NGHL+ +Q +L+     +C+T   +   R +  A   G   I +E+I     L+ +  +  T++  AA   H EVV+LL+ K  + + +  K+    + +AC+ G++EI + LI N         DGV
Sbjct:  500 VDVSNPD---------TGDTPLSLAARNGYIAIMKMLIEKGGDLTAGKTS---PIVEAARNGHLECIQFILA-----HCKTIPQDQLSRALVSAADFGSLLIVEEVIRAGADLNFEQDE-RTALMKAAKGDHFEVVQLLLSKGASVNFKSSKNDATALSLACSEGNMEIAEFLIRNGADPMLKMDDGV 669          

HSP 5 Score: 54.6842 bits (130), Expect = 4.821e-7
Identity = 35/121 (28.93%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  278 PLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFE---IAKELIAKDCLLDIQTKQ-GWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            PL    A G+ ++V++LL+   +I   +N    P+  ACA    +   + K L++K   +D+     G T +  AA NG+I ++K+LIEK  +          PI+ A   GH+E ++ ++
Sbjct:  441 PLIVASAGGYPEVVEVLLAAGAKIEELSNKKNTPLMEACAGDQGDQAGVVKLLLSKHAEVDVSNPDTGDTPLSLAARNGYIAIMKMLIEKGGDLTAGK---TSPIVEAARNGHLECIQFIL 558          
BLAST of SMED30023739 vs. Ensembl Celegans
Match: mask-1 (Ankyrin repeat and KH domain-containing protein mask-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21920])

HSP 1 Score: 90.8929 bits (224), Expect = 4.490e-18
Identity = 50/169 (29.59%), Postives = 89/169 (52.66%), Query Frame = 2
Query:  143 INKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINC----QTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNG-HIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            IN  I+   NT  + +A  +G  E+ + ++    N E+  K G  PL  C + G++D+  LL++   + N     QT D    +  +   GH +  + L+  D  +D++ K+G T++ W ACNG ++   + L+EK  + D+ D     P++ A   GH+EIVK ++N+
Sbjct: 1402 INAQIETNRNTA-LTLASFQGRTEVVKLLLAYNANVEHRAKTGLTPLMECASGGYVDVGNLLIAAGADTNASPVQQTKDTA--LTISAEKGHEKFVRMLLNGDAAVDVRNKKGCTAL-WLACNGGYLSTAQALLEKGADPDMFDNRKISPMMAAFRKGHVEIVKYMVNS 1566          

HSP 2 Score: 73.9442 bits (180), Expect = 5.931e-13
Identity = 39/150 (26.00%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  188 IACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGM-RPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIE--KKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            IAC  G  ++ E ++ +  N E+ +K G+ PL      GH  +V++LL     I  Q++      +  AC+ G  ++ + L+A     + +    +T +  A+  G+IE+V +L+    + N+    K G  P+++A   GH E  ++L+
Sbjct: 1247 IACANGHKDIVELLLKEGANIEHRDKKGFSPLIIAATAGHSSVVEVLLKNHAAIEAQSDRTKDTALSLACSGGRKDVVELLLAHGANKEHRNVSDYTPLSLASSGGYIEIVNMLLTAGSEINSRTGSKLGISPLMLASMNGHREATRVLL 1396          

HSP 3 Score: 67.0106 bits (162), Expect = 8.044e-11
Identity = 45/160 (28.12%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMV--NKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQ--TNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDI----QDKDGCRPILIACAYGHIEIVKLLINN 634
            P+ +A + G+ E+   ++    + N    +K G  PL     NGH +  ++LL K  +IN Q  TN     +  A   G  E+ K L+A +  ++ + K G T +   A  G+++V  LLI    +T+     Q KD    + I+   GH + V++L+N 
Sbjct: 1344 PLSLASSGGYIEIVNMLLTAGSEINSRTGSKLGISPLMLASMNGHREATRVLLEKGSDINAQIETNRNTA-LTLASFQGRTEVVKLLLAYNANVEHRAKTGLTPLMECASGGYVDVGNLLIAAGADTNASPVQQTKDTA--LTISAEKGHEKFVRMLLNG 1500          

HSP 4 Score: 60.077 bits (144), Expect = 1.026e-8
Identity = 47/188 (25.00%), Postives = 87/188 (46.28%), Query Frame = 2
Query:  119 MDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQT---NDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQD-KDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGV 670
            +D+SNP+         T   P+ +A   G+  + + ++ K  +      +   P+     NGHL+ +Q +L+     +C+T   +   R +  A   G   I +E+I     L+ +  +  T++  AA   H EVV+LL+ K  + + +  K+    + +AC+ G++EI + LI N         DGV
Sbjct:  500 VDVSNPD---------TGDTPLSLAARNGYIAIMKMLIEKGGDLTAGKTS---PIVEAARNGHLECIQFILA-----HCKTIPQDQLSRALVSAADFGSLLIVEEVIRAGADLNFEQDE-RTALMKAAKGDHFEVVQLLLSKGASVNFKSSKNDATALSLACSEGNMEIAEFLIRNGADPMLKMDDGV 669          

HSP 5 Score: 54.6842 bits (130), Expect = 4.946e-7
Identity = 35/121 (28.93%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  278 PLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFE---IAKELIAKDCLLDIQTKQ-GWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            PL    A G+ ++V++LL+   +I   +N    P+  ACA    +   + K L++K   +D+     G T +  AA NG+I ++K+LIEK  +          PI+ A   GH+E ++ ++
Sbjct:  441 PLIVASAGGYPEVVEVLLAAGAKIEELSNKKNTPLMEACAGDQGDQAGVVKLLLSKHAEVDVSNPDTGDTPLSLAARNGYIAIMKMLIEKGGDLTAGK---TSPIVEAARNGHLECIQFIL 558          
BLAST of SMED30023739 vs. Ensembl Celegans
Match: mask-1 (Ankyrin repeat and KH domain-containing protein mask-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21920])

HSP 1 Score: 90.8929 bits (224), Expect = 4.527e-18
Identity = 50/169 (29.59%), Postives = 89/169 (52.66%), Query Frame = 2
Query:  143 INKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINC----QTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNG-HIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            IN  I+   NT  + +A  +G  E+ + ++    N E+  K G  PL  C + G++D+  LL++   + N     QT D    +  +   GH +  + L+  D  +D++ K+G T++ W ACNG ++   + L+EK  + D+ D     P++ A   GH+EIVK ++N+
Sbjct: 1400 INAQIETNRNTA-LTLASFQGRTEVVKLLLAYNANVEHRAKTGLTPLMECASGGYVDVGNLLIAAGADTNASPVQQTKDTA--LTISAEKGHEKFVRMLLNGDAAVDVRNKKGCTAL-WLACNGGYLSTAQALLEKGADPDMFDNRKISPMMAAFRKGHVEIVKYMVNS 1564          

HSP 2 Score: 73.9442 bits (180), Expect = 5.880e-13
Identity = 39/150 (26.00%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  188 IACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGM-RPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIE--KKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            IAC  G  ++ E ++ +  N E+ +K G+ PL      GH  +V++LL     I  Q++      +  AC+ G  ++ + L+A     + +    +T +  A+  G+IE+V +L+    + N+    K G  P+++A   GH E  ++L+
Sbjct: 1245 IACANGHKDIVELLLKEGANIEHRDKKGFSPLIIAATAGHSSVVEVLLKNHAAIEAQSDRTKDTALSLACSGGRKDVVELLLAHGANKEHRNVSDYTPLSLASSGGYIEIVNMLLTAGSEINSRTGSKLGISPLMLASMNGHREATRVLL 1394          

HSP 3 Score: 67.0106 bits (162), Expect = 8.111e-11
Identity = 45/160 (28.12%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMV--NKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQ--TNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDI----QDKDGCRPILIACAYGHIEIVKLLINN 634
            P+ +A + G+ E+   ++    + N    +K G  PL     NGH +  ++LL K  +IN Q  TN     +  A   G  E+ K L+A +  ++ + K G T +   A  G+++V  LLI    +T+     Q KD    + I+   GH + V++L+N 
Sbjct: 1342 PLSLASSGGYIEIVNMLLTAGSEINSRTGSKLGISPLMLASMNGHREATRVLLEKGSDINAQIETNRNTA-LTLASFQGRTEVVKLLLAYNANVEHRAKTGLTPLMECASGGYVDVGNLLIAAGADTNASPVQQTKDTA--LTISAEKGHEKFVRMLLNG 1498          

HSP 4 Score: 60.077 bits (144), Expect = 1.098e-8
Identity = 47/188 (25.00%), Postives = 87/188 (46.28%), Query Frame = 2
Query:  119 MDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQT---NDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQD-KDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGV 670
            +D+SNP+         T   P+ +A   G+  + + ++ K  +      +   P+     NGHL+ +Q +L+     +C+T   +   R +  A   G   I +E+I     L+ +  +  T++  AA   H EVV+LL+ K  + + +  K+    + +AC+ G++EI + LI N         DGV
Sbjct:  500 VDVSNPD---------TGDTPLSLAARNGYIAIMKMLIEKGGDLTAGKTS---PIVEAARNGHLECIQFILA-----HCKTIPQDQLSRALVSAADFGSLLIVEEVIRAGADLNFEQDE-RTALMKAAKGDHFEVVQLLLSKGASVNFKSSKNDATALSLACSEGNMEIAEFLIRNGADPMLKMDDGV 669          

HSP 5 Score: 54.6842 bits (130), Expect = 4.987e-7
Identity = 35/121 (28.93%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  278 PLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFE---IAKELIAKDCLLDIQTKQ-GWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            PL    A G+ ++V++LL+   +I   +N    P+  ACA    +   + K L++K   +D+     G T +  AA NG+I ++K+LIEK  +          PI+ A   GH+E ++ ++
Sbjct:  441 PLIVASAGGYPEVVEVLLAAGAKIEELSNKKNTPLMEACAGDQGDQAGVVKLLLSKHAEVDVSNPDTGDTPLSLAARNGYIAIMKMLIEKGGDLTAGK---TSPIVEAARNGHLECIQFIL 558          
BLAST of SMED30023739 vs. Ensembl Celegans
Match: mask-1 (Ankyrin repeat and KH domain-containing protein mask-1 [Source:UniProtKB/Swiss-Prot;Acc:Q21920])

HSP 1 Score: 90.8929 bits (224), Expect = 4.565e-18
Identity = 50/169 (29.59%), Postives = 89/169 (52.66%), Query Frame = 2
Query:  143 INKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINC----QTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNG-HIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            IN  I+   NT  + +A  +G  E+ + ++    N E+  K G  PL  C + G++D+  LL++   + N     QT D    +  +   GH +  + L+  D  +D++ K+G T++ W ACNG ++   + L+EK  + D+ D     P++ A   GH+EIVK ++N+
Sbjct: 1396 INAQIETNRNTA-LTLASFQGRTEVVKLLLAYNANVEHRAKTGLTPLMECASGGYVDVGNLLIAAGADTNASPVQQTKDTA--LTISAEKGHEKFVRMLLNGDAAVDVRNKKGCTAL-WLACNGGYLSTAQALLEKGADPDMFDNRKISPMMAAFRKGHVEIVKYMVNS 1560          

HSP 2 Score: 73.9442 bits (180), Expect = 5.830e-13
Identity = 39/150 (26.00%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  188 IACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGM-RPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIE--KKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            IAC  G  ++ E ++ +  N E+ +K G+ PL      GH  +V++LL     I  Q++      +  AC+ G  ++ + L+A     + +    +T +  A+  G+IE+V +L+    + N+    K G  P+++A   GH E  ++L+
Sbjct: 1241 IACANGHKDIVELLLKEGANIEHRDKKGFSPLIIAATAGHSSVVEVLLKNHAAIEAQSDRTKDTALSLACSGGRKDVVELLLAHGANKEHRNVSDYTPLSLASSGGYIEIVNMLLTAGSEINSRTGSKLGISPLMLASMNGHREATRVLL 1390          

HSP 3 Score: 67.0106 bits (162), Expect = 8.110e-11
Identity = 45/160 (28.12%), Postives = 77/160 (48.12%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMV--NKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQ--TNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDI----QDKDGCRPILIACAYGHIEIVKLLINN 634
            P+ +A + G+ E+   ++    + N    +K G  PL     NGH +  ++LL K  +IN Q  TN     +  A   G  E+ K L+A +  ++ + K G T +   A  G+++V  LLI    +T+     Q KD    + I+   GH + V++L+N 
Sbjct: 1338 PLSLASSGGYIEIVNMLLTAGSEINSRTGSKLGISPLMLASMNGHREATRVLLEKGSDINAQIETNRNTA-LTLASFQGRTEVVKLLLAYNANVEHRAKTGLTPLMECASGGYVDVGNLLIAAGADTNASPVQQTKDTA--LTISAEKGHEKFVRMLLNG 1494          

HSP 4 Score: 60.077 bits (144), Expect = 1.070e-8
Identity = 47/188 (25.00%), Postives = 87/188 (46.28%), Query Frame = 2
Query:  119 MDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQT---NDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQD-KDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGV 670
            +D+SNP+         T   P+ +A   G+  + + ++ K  +      +   P+     NGHL+ +Q +L+     +C+T   +   R +  A   G   I +E+I     L+ +  +  T++  AA   H EVV+LL+ K  + + +  K+    + +AC+ G++EI + LI N         DGV
Sbjct:  500 VDVSNPD---------TGDTPLSLAARNGYIAIMKMLIEKGGDLTAGKTS---PIVEAARNGHLECIQFILA-----HCKTIPQDQLSRALVSAADFGSLLIVEEVIRAGADLNFEQDE-RTALMKAAKGDHFEVVQLLLSKGASVNFKSSKNDATALSLACSEGNMEIAEFLIRNGADPMLKMDDGV 669          

HSP 5 Score: 54.6842 bits (130), Expect = 4.945e-7
Identity = 35/121 (28.93%), Postives = 62/121 (51.24%), Query Frame = 2
Query:  278 PLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFE---IAKELIAKDCLLDIQTKQ-GWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            PL    A G+ ++V++LL+   +I   +N    P+  ACA    +   + K L++K   +D+     G T +  AA NG+I ++K+LIEK  +          PI+ A   GH+E ++ ++
Sbjct:  441 PLIVASAGGYPEVVEVLLAAGAKIEELSNKKNTPLMEACAGDQGDQAGVVKLLLSKHAEVDVSNPDTGDTPLSLAARNGYIAIMKMLIEKGGDLTAGK---TSPIVEAARNGHLECIQFIL 558          
BLAST of SMED30023739 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0334062)

HSP 1 Score: 100.138 bits (248), Expect = 2.399e-21
Identity = 49/169 (28.99%), Postives = 86/169 (50.89%), Query Frame = 2
Query:  170 NTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N  P+H+A   G   M   ++ K  N E   ++G  PLH    +GH  +V +LL +   I+ +T +G+ P+H A    H + A+ L+     +D  T    T++H AA  GH+ V KLL+++  + + +  +G  P+ IAC    +++V+LL+ +          G+ P
Sbjct:  238 NISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTP 406          

HSP 2 Score: 95.9005 bits (237), Expect = 4.892e-20
Identity = 50/175 (28.57%), Postives = 87/175 (49.71%), Query Frame = 2
Query:  158 DITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            D+T+ +   P+HIA + G   +A  ++ K  +  YS K+   PLH     G  ++V LLL K   I  +T DG+ P+H A  +GH ++   L+ +   +  +TK G   +H AA   H++  ++L+  +   D    D    + +A   GH+ + KLL++    +   A +G  P
Sbjct:  199 DVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTP 373          

HSP 3 Score: 85.1149 bits (209), Expect = 1.358e-16
Identity = 42/149 (28.19%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +H+A + G   +A+ ++++  +      NG+ PLH  C    L +V+LLL     I+  T  G+ P+H A   G   I   L+  D   D+ T +G T +H AA     +++++L+      D + ++   P+ IA   G+++IV LL+
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLL 489          

HSP 4 Score: 82.8037 bits (203), Expect = 5.723e-16
Identity = 40/125 (32.00%), Postives = 69/125 (55.20%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+L+ V   L  + +IN    +G+  +H A  +GH  +  EL+ +  ++D  TK+G T++H A+  G  EVVKLL+E   + ++Q ++G  P+ +A    H  +V+LL++N         DG  P
Sbjct:   22 GNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTP 146          

HSP 5 Score: 82.4185 bits (202), Expect = 8.770e-16
Identity = 41/149 (27.52%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +HIA  K   + A  +++   N + ++K+G+ PLH     G+ +I  LL+ K  ++N      + P+H A   G   +   L+ K   ++ +T+ G T +H AA +GH +VV +L+E+      + K+G  P+ +A    H++  ++L+
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL 324          

HSP 6 Score: 80.8777 bits (198), Expect = 2.719e-15
Identity = 41/146 (28.08%), Postives = 71/146 (48.63%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            A   G  E     +    +   SN NG   LH    +GH+ +V  LL +   ++  T  G   +H A   G  E+ K L+  +  +++Q++ G+T ++ AA   H  VV+LL+    N  +  +DG  P+ +A   GH ++V +L+
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLL 163          

HSP 7 Score: 74.3294 bits (181), Expect = 2.927e-13
Identity = 46/183 (25.14%), Postives = 81/183 (44.26%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            L+ K  +I   TR    P+H A   G  ++ + ++ +        KNG  PLH      H+D  ++LL     ++  T D +  +H A   GH  +AK L+ ++   + +   G+T +H A     ++VV+LL+    +     + G  P+ +A   G + IV  L+ +      P   G  P
Sbjct:  257 LLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETP 439          

HSP 8 Score: 72.7886 bits (177), Expect = 9.260e-13
Identity = 40/149 (26.85%), Postives = 71/149 (47.65%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+HIAC K   ++ E ++    +   + ++G  PLH     G ++IV  LL  D   +  T  G  P+H A      +I + L+     +D + ++  T +H A+  G++++V LL++     D   KD    + IA   G  E+  L+
Sbjct:  373 PLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVKDLI 521          

HSP 9 Score: 68.9366 bits (167), Expect = 1.436e-11
Identity = 48/207 (23.19%), Postives = 83/207 (40.10%), Query Frame = 2
Query:  155 IDITTNT----RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            IDI T+       +H+A   G   +   ++ +    + + K G   LH     G  ++V+LLL  +  +N Q+ +G  P++ A    H  + + L++      + T+ G+T +  A   GH +VV +L+E                                N D+  K G  P+ IA  YG+  I  LLI         A+  ++P
Sbjct:   35 IDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISP 241          

HSP 10 Score: 66.6254 bits (161), Expect = 6.621e-11
Identity = 46/195 (23.59%), Postives = 81/195 (41.54%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDC---------EINCQTND--------------------GMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+++A  +    +   +++   N   + ++G+ PL      GH  +V +LL  D           I  + +D                    G  P+H A   G+  IA  LI K   ++   K   + +H AA  G   +V LL+EK  N + + +DG  P+  A   GH ++V +L+          ++G+AP
Sbjct:  113 PLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAP 307          

HSP 11 Score: 58.151 bits (139), Expect = 2.851e-8
Identity = 34/125 (27.20%), Postives = 58/125 (46.40%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDI 553
            P+H+A   G   +  +++    + +     G  PLH        DI+++LL    +++ +  +   P+H A   G+ +I   L+     +D  TK  +T++H AA  G  E VK LI KK    I
Sbjct:  406 PLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDE-VKDLIAKKITDHI 529          
BLAST of SMED30023739 vs. Ensembl Fly
Match: Ank2 (gene:FBgn0261788 transcript:FBtr0303119)

HSP 1 Score: 101.293 bits (251), Expect = 2.461e-21
Identity = 50/166 (30.12%), Postives = 83/166 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A      ++   ++      +   +    PLH     G++DIV LLL    +++  T D    +H A   G  E+A  LI     LD  TK+G+T +H  A  GHI+V +LL++K+ + D Q K+G  P+ +AC Y + ++  LL+         A++G  P
Sbjct:  439 PLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTP 604          

HSP 2 Score: 100.908 bits (250), Expect = 3.233e-21
Identity = 52/176 (29.55%), Postives = 89/176 (50.57%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +D TT      +HIA  +G  E+A  ++      + + K G+ PLH     GH+ + QLLL K+ +++ Q  +G+ P+H AC   + ++A  L+ K        K G T +H AA    +++   L+E     + + K G  P+ ++   GH EI  LLI ++     PA++G+ P
Sbjct:  495 VDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTP 670          

HSP 3 Score: 100.523 bits (249), Expect = 4.001e-21
Identity = 53/183 (28.96%), Postives = 91/183 (49.73%), Query Frame = 2
Query:  140 LINKIIDITT----NTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            LI K  D+      N  P+H+A   G   M   ++ K  N E   ++G  PLH    +GH  +V +LL +   I+ +T +G+ P+H A    H + A+ L+     +D  T    T++H AA  GH+ V KLL+++  + + +  +G  P+ IAC    +++V+LL+ +          G+ P
Sbjct:  224 LIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTP 406          

HSP 4 Score: 96.2857 bits (238), Expect = 9.852e-20
Identity = 50/175 (28.57%), Postives = 87/175 (49.71%), Query Frame = 2
Query:  158 DITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            D+T+ +   P+HIA + G   +A  ++ K  +  YS K+   PLH     G  ++V LLL K   I  +T DG+ P+H A  +GH ++   L+ +   +  +TK G   +H AA   H++  ++L+  +   D    D    + +A   GH+ + KLL++    +   A +G  P
Sbjct:  199 DVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTP 373          

HSP 5 Score: 89.3521 bits (220), Expect = 1.111e-17
Identity = 42/149 (28.19%), Postives = 74/149 (49.66%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H++  +G  E++  ++  K    +  KNG  P+H C    ++++ ++L      I+  T  G  P+H A   G   + + L+     +D  T  G+T +H  A  GH  +V LL+E K N + Q  +G  P+ IA   G+I ++  L
Sbjct:  637 PLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTPLHIARKLGYISVLDSL 785          

HSP 6 Score: 87.8113 bits (216), Expect = 3.914e-17
Identity = 47/176 (26.70%), Postives = 82/176 (46.59%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            I  TT +   P+H+A   G   +  +++    + +     G  PLH        DI+++LL    +++ +  +   P+H A   G+ +I   L+     +D  TK  +T++H AA  G  EV  +LIE     D   K G  P+ +   YGHI++ +LL+  +       ++GV P
Sbjct:  396 ISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTP 571          

HSP 7 Score: 87.4261 bits (215), Expect = 4.447e-17
Identity = 45/167 (26.95%), Postives = 80/167 (47.90%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL-INNQNISFCPARDGVAP 676
            P+H+    G  ++A+ ++ K+ + +   KNG  PLH  C   +  +  LLL K    +    +G  P+H A      +IA  L+    L + ++K G+T +H ++  GH E+  LLIE K   +   K+G  P+ +     ++ + ++L  N  NI     + G  P
Sbjct:  538 PLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMA-TKAGYTP 703          

HSP 8 Score: 86.2705 bits (212), Expect = 1.096e-16
Identity = 43/152 (28.29%), Postives = 73/152 (48.03%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+H+AC+    ++A  ++ K  +   + KNG  PLH       +DI   LL      N ++  G  P+H +   GH EI+  LI     ++   K G T +H  A   ++ V ++L +   N D+  K G  P+ +A  +G   +V+ L+ N
Sbjct:  571 PLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQN 722          

HSP 9 Score: 85.5001 bits (210), Expect = 1.779e-16
Identity = 42/151 (27.81%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +H+A + G   +A+ ++++  +      NG+ PLH  C    L +V+LLL     I+  T  G+ P+H A   G   I   L+  D   D+ T +G T +H AA     +++++L+      D + ++   P+ IA   G+++IV LL+ +
Sbjct:  341 LHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETPLHLAARANQTDIIRILLRNGAQVDARAREQQTPLHIASRLGNVDIVMLLLQH 491          

HSP 10 Score: 83.1889 bits (204), Expect = 9.343e-16
Identity = 40/125 (32.00%), Postives = 69/125 (55.20%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+L+ V   L  + +IN    +G+  +H A  +GH  +  EL+ +  ++D  TK+G T++H A+  G  EVVKLL+E   + ++Q ++G  P+ +A    H  +V+LL++N         DG  P
Sbjct:   22 GNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTP 146          

HSP 11 Score: 83.1889 bits (204), Expect = 9.343e-16
Identity = 41/149 (27.52%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +HIA  K   + A  +++   N + ++K+G+ PLH     G+ +I  LL+ K  ++N      + P+H A   G   +   L+ K   ++ +T+ G T +H AA +GH +VV +L+E+      + K+G  P+ +A    H++  ++L+
Sbjct:  176 LHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILL 324          

HSP 12 Score: 81.2629 bits (199), Expect = 3.490e-15
Identity = 46/177 (25.99%), Postives = 80/177 (45.20%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKK 709
            P+HIA  K   ++A  ++         +K G+ PLH     GH +I  LL+     +N    +G+ P+H      +  +A+ L      +D+ TK G+T +H A+  G   +V+ L++   N D     G  P+      GH  IV LL+ ++  +     +G  P     +H+ +K
Sbjct:  604 PLHIAARKNQMDIATTLLEYGALANAESKAGFTPLHLSSQEGHAEISNLLIEHKAAVNHPAKNGLTPMHLCAQEDNVNVAEILEKNGANIDMATKAGYTPLHVASHFGQANMVRFLLQNGANVDAATSIGYTPLHQTAQQGHCHIVNLLLEHKANANAQTVNGQTP-----LHIARK 775          

HSP 13 Score: 80.8777 bits (198), Expect = 4.700e-15
Identity = 41/146 (28.08%), Postives = 71/146 (48.63%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            A   G  E     +    +   SN NG   LH    +GH+ +V  LL +   ++  T  G   +H A   G  E+ K L+  +  +++Q++ G+T ++ AA   H  VV+LL+    N  +  +DG  P+ +A   GH ++V +L+
Sbjct:   18 AARAGNLERVLEHLKNNIDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLL 163          

HSP 14 Score: 77.7962 bits (190), Expect = 4.212e-14
Identity = 40/166 (24.10%), Postives = 76/166 (45.78%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA   G  ++   ++      + + K+ +  LH     G  ++  +L+     ++  T  G  P+H     GH ++A+ L+ K+  +D Q K G T +H A    + +V  LL+EK  +     K+G  P+ IA     ++I   L+    ++   ++ G  P
Sbjct:  472 PLHIASRLGNVDIVMLLLQHGAQVDATTKDMYTALHIAAKEGQDEVAAVLIENGAALDAATKKGFTPLHLTAKYGHIKVAQLLLQKEADVDAQGKNGVTPLHVACHYNNQQVALLLLEKGASPHATAKNGHTPLHIAARKNQMDIATTLLEYGALANAESKAGFTP 637          

HSP 15 Score: 75.485 bits (184), Expect = 2.227e-13
Identity = 46/183 (25.14%), Postives = 81/183 (44.26%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            L+ K  +I   TR    P+H A   G  ++ + ++ +        KNG  PLH      H+D  ++LL     ++  T D +  +H A   GH  +AK L+ ++   + +   G+T +H A     ++VV+LL+    +     + G  P+ +A   G + IV  L+ +      P   G  P
Sbjct:  257 LLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGEHVDAARILLYHRAPVDEVTVDYLTALHVAAHCGHVRVAKLLLDRNADANARALNGFTPLHIACKKNRLKVVELLLRHGASISATTESGLTPLHVAAFMGCMNIVIYLLQHDASPDVPTVRGETP 439          

HSP 16 Score: 68.9366 bits (167), Expect = 2.223e-11
Identity = 48/207 (23.19%), Postives = 83/207 (40.10%), Query Frame = 2
Query:  155 IDITTNT----RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            IDI T+       +H+A   G   +   ++ +    + + K G   LH     G  ++V+LLL  +  +N Q+ +G  P++ A    H  + + L++      + T+ G+T +  A   GH +VV +L+E                                N D+  K G  P+ IA  YG+  I  LLI         A+  ++P
Sbjct:   35 IDINTSNANGLNALHLASKDGHIHVVSELLRRGAIVDSATKKGNTALHIASLAGQEEVVKLLLEHNASVNVQSQNGFTPLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISP 241          

HSP 17 Score: 67.3958 bits (163), Expect = 7.295e-11
Identity = 50/207 (24.15%), Postives = 87/207 (42.03%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCE---------INCQTND--------------------GMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP---SVAGEIHLD 703
            P+++A  +    +   +++   N   + ++G+ PL      GH  +V +LL  D           I  + +D                    G  P+H A   G+  IA  LI K   ++   K   + +H AA  G   +V LL+EK  N + + +DG  P+  A   GH ++V +L+          ++G+AP   +  GE H+D
Sbjct:  113 PLYMAAQENHDAVVRLLLSNGANQSLATEDGFTPLAVAMQQGHDKVVAVLLESDTRGKVRLPALHIAAKKDDVKAATLLLDNDHNPDVTSKSGFTPLHIASHYGNQNIANLLIQKGADVNYSAKHNISPLHVAAKWGKTNMVSLLLEKGGNIEAKTRDGLTPLHCAARSGHEQVVDMLLERGAPISAKTKNGLAPLHMAAQGE-HVD 318          
BLAST of SMED30023739 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089172)

HSP 1 Score: 101.293 bits (251), Expect = 2.600e-21
Identity = 53/166 (31.93%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA + G  ++A  ++N K +  Y  K+   PLH  C  G L +  LLL +  +I+  T DG+ P+H A  +GH E+ K L+ ++  +  +TK G +++H AA   H E   LL++ K   D    D    + +A   GH+++ KLL++ +      A +G  P
Sbjct:  237 PLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTP 402          

HSP 2 Score: 99.3673 bits (246), Expect = 1.093e-20
Identity = 51/162 (31.48%), Postives = 87/162 (53.70%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            IHIAC K + E+A  ++    +    +K+G+ PLH     G++D+VQLLL     I+    +G+ P+H A   GH  +++ L+     +  +T+ G+T +H AA  GH+++VK  IE   + ++    G  P+  A   GHI I+ LL+ ++       +DG
Sbjct:  633 IHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDG 793          

HSP 3 Score: 93.2041 bits (230), Expect = 9.441e-19
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A   G  +M + ++        + KNG  PLH     GH+ + Q+LL     I+ +T +G  P+H A   GH ++ K  I  D  +++ +  G+T +H AA  GHI ++ LL+  K N +   KDG   + IA   G++ +++ L
Sbjct:  665 PLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 4 Score: 84.3445 bits (207), Expect = 5.254e-16
Identity = 44/152 (28.95%), Postives = 79/152 (51.97%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA  K     A+ ++    N +  +K+G+ PLH     G++DI  LLL+   ++N      + P+H AC  G   +   L+ +   +D  T+ G T +H A+ +GH+EV+K L+++      + K+G   + +A    H E   LL++N+
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNK 356          

HSP 5 Score: 83.5741 bits (205), Expect = 7.828e-16
Identity = 49/167 (29.34%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI-NNQNISFCPARDGVAP 676
            P+H+AC  G   + + ++    + ++  KN   PLH      +  IV+LLL      N    +G   IH AC   + EIA +L+     ++I +K G++ +H AA  G++++V+LL+E         K+G  P+ +A   GH+ + ++L+ +  NIS    R+G  P
Sbjct:  566 PLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISE-RTRNGYTP 730          

HSP 6 Score: 80.4925 bits (197), Expect = 7.727e-15
Identity = 47/163 (28.83%), Postives = 81/163 (49.69%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            P+H+A      ++   ++ +    +   + G  PLH     G+++I+ LLL    EIN Q+ND    +H A   G   I + L+      +  TK+G+T +H A   G   VV++L++   + D Q K+   P+ +A  Y +  IV+LL+ N +     AR+G
Sbjct:  468 PLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNG 629          

HSP 7 Score: 77.411 bits (189), Expect = 6.063e-14
Identity = 41/149 (27.52%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +H+A + G  ++A+ +++ K N      NG+ PLH  C    + +V+LL+     I   T  G+ P+H A   G   I   L+  +   D+ T +G T +H AA     +++++L+ +    D   ++G  P+ +A   G+I I+ LL+
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLL 517          

HSP 8 Score: 73.1738 bits (178), Expect = 1.303e-12
Identity = 46/165 (27.88%), Postives = 76/165 (46.06%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA   G  ++   ++    N    + NG+ PL+      H +  + LL+     +  T DG  P+  A   GH +I   L+  D    ++ K    ++H AA    +   KLL++   N DI  K G  P+ IA  YG+++I  LL+NN+      A+  + P
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEND----VRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITP 270          

HSP 9 Score: 72.0182 bits (175), Expect = 2.524e-12
Identity = 42/165 (25.45%), Postives = 81/165 (49.09%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA  +G   + + ++          K G+ PLH  C  G  ++VQ+LL     I+ Q  + + P+H A    +  I + L+      ++  + G  +IH A    ++E+   L++   + +I  K G  P+ +A   G++++V+LL+    IS   A++G+ P
Sbjct:  534 LHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVIS-AAAKNGLTP 697          

HSP 10 Score: 70.8626 bits (172), Expect = 6.573e-12
Identity = 45/202 (22.28%), Postives = 85/202 (42.08%), Query Frame = 2
Query:  170 NTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACAN---------------------------------GHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N  P+H+AC  G   +   ++ +    + + ++G  PLH    +GH+++++ LL ++  I  +T +G+  +H A                                    GH ++AK L+      + +   G+T +H A     I++V+LLI+   N     + G  P+ +A   G I IV  L+ ++  +  P   G  P
Sbjct:  267 NITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETP 468          

HSP 11 Score: 69.3218 bits (168), Expect = 1.771e-11
Identity = 104/502 (20.72%), Postives = 205/502 (40.84%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGI-------QHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXX----KPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEG--FKIFSSPQTINRPRKLV-----QKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDN-PDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKL 1630
            +H+A      E A  +++ K   +    +    LH     GH+ + +LLL      N +  +G  P+H AC     ++ + LI     +   T+ G T +H A+  G I +V  L++ + + D+    G  P+ +A      +I+++L+ +  +    AR+G  P     +H+  +    LG I       QH  +I +       DK+S  +  I     +E     +LE   ENN              K    + +Q +++   ++  +G+  +    +     N  +     K  SSP    R  +       +K++LEIA++    G   +I+ K+ +           A Q   ++++  + +   V+S+  +  L+ LH A  + +  + + +L++  +++++  N     T L  A    H   +    + + D    + +  T LH+A   G  M    L+ +    + +   G TALH A   G+  + E L
Sbjct:  337 LHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAI-AREGQTP-----LHVASR----LGNINIIMLLLQHGAEINAQ----SNDKYSALH--IAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHL------AAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNG---YTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 12 Score: 67.781 bits (164), Expect = 5.326e-11
Identity = 44/185 (23.78%), Postives = 82/185 (44.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLEF 721
            P+H+A   G   +   ++         + + +  LH     G  +IVQ+LL    E N  T  G  P+H AC  G   + + L+     +D Q K   T +H A    +  +V+LL++   + ++  ++G   I IAC   ++EI   L+ +       ++ G +P    +  G + + +  LE+
Sbjct:  500 PLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEY 684          

HSP 13 Score: 66.6254 bits (161), Expect = 1.171e-10
Identity = 36/125 (28.80%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N NG   LH    +G++DI   LL +  +I+  T  G   +H A   G  ++  +LI  +  +++Q+  G+T ++ AA   H    + L+    N  +  +DG  P+ +A   GH +IV +L+ N
Sbjct:   70 NANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN 194          

HSP 14 Score: 55.4546 bits (132), Expect = 2.729e-7
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 2
Query:  311 DIVQLLLSKDC----EINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            DI +++   DC    +IN    +G+  +H A  +G+ +I  EL+ +   +D  TK+G T++H A+  G  +V+  LI    N ++Q  +G  P+ +A    H    + L+ N         DG  P
Sbjct:   50 DIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTP 175          
BLAST of SMED30023739 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0300497)

HSP 1 Score: 101.293 bits (251), Expect = 2.600e-21
Identity = 53/166 (31.93%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA + G  ++A  ++N K +  Y  K+   PLH  C  G L +  LLL +  +I+  T DG+ P+H A  +GH E+ K L+ ++  +  +TK G +++H AA   H E   LL++ K   D    D    + +A   GH+++ KLL++ +      A +G  P
Sbjct:  237 PLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTP 402          

HSP 2 Score: 99.3673 bits (246), Expect = 1.093e-20
Identity = 51/162 (31.48%), Postives = 87/162 (53.70%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            IHIAC K + E+A  ++    +    +K+G+ PLH     G++D+VQLLL     I+    +G+ P+H A   GH  +++ L+     +  +T+ G+T +H AA  GH+++VK  IE   + ++    G  P+  A   GHI I+ LL+ ++       +DG
Sbjct:  633 IHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDG 793          

HSP 3 Score: 93.2041 bits (230), Expect = 9.441e-19
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A   G  +M + ++        + KNG  PLH     GH+ + Q+LL     I+ +T +G  P+H A   GH ++ K  I  D  +++ +  G+T +H AA  GHI ++ LL+  K N +   KDG   + IA   G++ +++ L
Sbjct:  665 PLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 4 Score: 84.3445 bits (207), Expect = 5.254e-16
Identity = 44/152 (28.95%), Postives = 79/152 (51.97%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA  K     A+ ++    N +  +K+G+ PLH     G++DI  LLL+   ++N      + P+H AC  G   +   L+ +   +D  T+ G T +H A+ +GH+EV+K L+++      + K+G   + +A    H E   LL++N+
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNK 356          

HSP 5 Score: 83.5741 bits (205), Expect = 7.828e-16
Identity = 49/167 (29.34%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI-NNQNISFCPARDGVAP 676
            P+H+AC  G   + + ++    + ++  KN   PLH      +  IV+LLL      N    +G   IH AC   + EIA +L+     ++I +K G++ +H AA  G++++V+LL+E         K+G  P+ +A   GH+ + ++L+ +  NIS    R+G  P
Sbjct:  566 PLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISE-RTRNGYTP 730          

HSP 6 Score: 80.4925 bits (197), Expect = 7.727e-15
Identity = 47/163 (28.83%), Postives = 81/163 (49.69%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            P+H+A      ++   ++ +    +   + G  PLH     G+++I+ LLL    EIN Q+ND    +H A   G   I + L+      +  TK+G+T +H A   G   VV++L++   + D Q K+   P+ +A  Y +  IV+LL+ N +     AR+G
Sbjct:  468 PLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNG 629          

HSP 7 Score: 77.411 bits (189), Expect = 6.063e-14
Identity = 41/149 (27.52%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +H+A + G  ++A+ +++ K N      NG+ PLH  C    + +V+LL+     I   T  G+ P+H A   G   I   L+  +   D+ T +G T +H AA     +++++L+ +    D   ++G  P+ +A   G+I I+ LL+
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLL 517          

HSP 8 Score: 73.1738 bits (178), Expect = 1.303e-12
Identity = 46/165 (27.88%), Postives = 76/165 (46.06%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA   G  ++   ++    N    + NG+ PL+      H +  + LL+     +  T DG  P+  A   GH +I   L+  D    ++ K    ++H AA    +   KLL++   N DI  K G  P+ IA  YG+++I  LL+NN+      A+  + P
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEND----VRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITP 270          

HSP 9 Score: 72.0182 bits (175), Expect = 2.524e-12
Identity = 42/165 (25.45%), Postives = 81/165 (49.09%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA  +G   + + ++          K G+ PLH  C  G  ++VQ+LL     I+ Q  + + P+H A    +  I + L+      ++  + G  +IH A    ++E+   L++   + +I  K G  P+ +A   G++++V+LL+    IS   A++G+ P
Sbjct:  534 LHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVIS-AAAKNGLTP 697          

HSP 10 Score: 70.8626 bits (172), Expect = 6.573e-12
Identity = 45/202 (22.28%), Postives = 85/202 (42.08%), Query Frame = 2
Query:  170 NTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACAN---------------------------------GHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N  P+H+AC  G   +   ++ +    + + ++G  PLH    +GH+++++ LL ++  I  +T +G+  +H A                                    GH ++AK L+      + +   G+T +H A     I++V+LLI+   N     + G  P+ +A   G I IV  L+ ++  +  P   G  P
Sbjct:  267 NITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETP 468          

HSP 11 Score: 69.3218 bits (168), Expect = 1.771e-11
Identity = 104/502 (20.72%), Postives = 205/502 (40.84%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGI-------QHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXX----KPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEG--FKIFSSPQTINRPRKLV-----QKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDN-PDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKL 1630
            +H+A      E A  +++ K   +    +    LH     GH+ + +LLL      N +  +G  P+H AC     ++ + LI     +   T+ G T +H A+  G I +V  L++ + + D+    G  P+ +A      +I+++L+ +  +    AR+G  P     +H+  +    LG I       QH  +I +       DK+S  +  I     +E     +LE   ENN              K    + +Q +++   ++  +G+  +    +     N  +     K  SSP    R  +       +K++LEIA++    G   +I+ K+ +           A Q   ++++  + +   V+S+  +  L+ LH A  + +  + + +L++  +++++  N     T L  A    H   +    + + D    + +  T LH+A   G  M    L+ +    + +   G TALH A   G+  + E L
Sbjct:  337 LHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAI-AREGQTP-----LHVASR----LGNINIIMLLLQHGAEINAQ----SNDKYSALH--IAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHL------AAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNG---YTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 12 Score: 67.781 bits (164), Expect = 5.326e-11
Identity = 44/185 (23.78%), Postives = 82/185 (44.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLEF 721
            P+H+A   G   +   ++         + + +  LH     G  +IVQ+LL    E N  T  G  P+H AC  G   + + L+     +D Q K   T +H A    +  +V+LL++   + ++  ++G   I IAC   ++EI   L+ +       ++ G +P    +  G + + +  LE+
Sbjct:  500 PLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEY 684          

HSP 13 Score: 66.6254 bits (161), Expect = 1.171e-10
Identity = 36/125 (28.80%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N NG   LH    +G++DI   LL +  +I+  T  G   +H A   G  ++  +LI  +  +++Q+  G+T ++ AA   H    + L+    N  +  +DG  P+ +A   GH +IV +L+ N
Sbjct:   70 NANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN 194          

HSP 14 Score: 55.4546 bits (132), Expect = 2.729e-7
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 2
Query:  311 DIVQLLLSKDC----EINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            DI +++   DC    +IN    +G+  +H A  +G+ +I  EL+ +   +D  TK+G T++H A+  G  +V+  LI    N ++Q  +G  P+ +A    H    + L+ N         DG  P
Sbjct:   50 DIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTP 175          
BLAST of SMED30023739 vs. Ensembl Fly
Match: Ank (gene:FBgn0011747 transcript:FBtr0089171)

HSP 1 Score: 101.293 bits (251), Expect = 2.600e-21
Identity = 53/166 (31.93%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA + G  ++A  ++N K +  Y  K+   PLH  C  G L +  LLL +  +I+  T DG+ P+H A  +GH E+ K L+ ++  +  +TK G +++H AA   H E   LL++ K   D    D    + +A   GH+++ KLL++ +      A +G  P
Sbjct:  237 PLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTP 402          

HSP 2 Score: 99.3673 bits (246), Expect = 1.093e-20
Identity = 51/162 (31.48%), Postives = 87/162 (53.70%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            IHIAC K + E+A  ++    +    +K+G+ PLH     G++D+VQLLL     I+    +G+ P+H A   GH  +++ L+     +  +T+ G+T +H AA  GH+++VK  IE   + ++    G  P+  A   GHI I+ LL+ ++       +DG
Sbjct:  633 IHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDG 793          

HSP 3 Score: 93.2041 bits (230), Expect = 9.441e-19
Identity = 46/149 (30.87%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A   G  +M + ++        + KNG  PLH     GH+ + Q+LL     I+ +T +G  P+H A   GH ++ K  I  D  +++ +  G+T +H AA  GHI ++ LL+  K N +   KDG   + IA   G++ +++ L
Sbjct:  665 PLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNGYTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 4 Score: 84.3445 bits (207), Expect = 5.254e-16
Identity = 44/152 (28.95%), Postives = 79/152 (51.97%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA  K     A+ ++    N +  +K+G+ PLH     G++DI  LLL+   ++N      + P+H AC  G   +   L+ +   +D  T+ G T +H A+ +GH+EV+K L+++      + K+G   + +A    H E   LL++N+
Sbjct:  205 LHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNK 356          

HSP 5 Score: 83.5741 bits (205), Expect = 7.828e-16
Identity = 49/167 (29.34%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI-NNQNISFCPARDGVAP 676
            P+H+AC  G   + + ++    + ++  KN   PLH      +  IV+LLL      N    +G   IH AC   + EIA +L+     ++I +K G++ +H AA  G++++V+LL+E         K+G  P+ +A   GH+ + ++L+ +  NIS    R+G  P
Sbjct:  566 PLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGV-ISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISE-RTRNGYTP 730          

HSP 6 Score: 80.4925 bits (197), Expect = 7.727e-15
Identity = 47/163 (28.83%), Postives = 81/163 (49.69%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            P+H+A      ++   ++ +    +   + G  PLH     G+++I+ LLL    EIN Q+ND    +H A   G   I + L+      +  TK+G+T +H A   G   VV++L++   + D Q K+   P+ +A  Y +  IV+LL+ N +     AR+G
Sbjct:  468 PLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNG 629          

HSP 7 Score: 77.411 bits (189), Expect = 6.063e-14
Identity = 41/149 (27.52%), Postives = 76/149 (51.01%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +H+A + G  ++A+ +++ K N      NG+ PLH  C    + +V+LL+     I   T  G+ P+H A   G   I   L+  +   D+ T +G T +H AA     +++++L+ +    D   ++G  P+ +A   G+I I+ LL+
Sbjct:  370 LHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILL-RSAKVDAIAREGQTPLHVASRLGNINIIMLLL 517          

HSP 8 Score: 73.1738 bits (178), Expect = 1.303e-12
Identity = 46/165 (27.88%), Postives = 76/165 (46.06%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA   G  ++   ++    N    + NG+ PL+      H +  + LL+     +  T DG  P+  A   GH +I   L+  D    ++ K    ++H AA    +   KLL++   N DI  K G  P+ IA  YG+++I  LL+NN+      A+  + P
Sbjct:  110 LHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEND----VRGKVRLPALHIAAKKNDVNAAKLLLQHDPNADIVSKSGFTPLHIAAHYGNVDIATLLLNNKADVNYVAKHNITP 270          

HSP 9 Score: 72.0182 bits (175), Expect = 2.524e-12
Identity = 42/165 (25.45%), Postives = 81/165 (49.09%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA  +G   + + ++          K G+ PLH  C  G  ++VQ+LL     I+ Q  + + P+H A    +  I + L+      ++  + G  +IH A    ++E+   L++   + +I  K G  P+ +A   G++++V+LL+    IS   A++G+ P
Sbjct:  534 LHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEYGVIS-AAAKNGLTP 697          

HSP 10 Score: 70.8626 bits (172), Expect = 6.573e-12
Identity = 45/202 (22.28%), Postives = 85/202 (42.08%), Query Frame = 2
Query:  170 NTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACAN---------------------------------GHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N  P+H+AC  G   +   ++ +    + + ++G  PLH    +GH+++++ LL ++  I  +T +G+  +H A                                    GH ++AK L+      + +   G+T +H A     I++V+LLI+   N     + G  P+ +A   G I IV  L+ ++  +  P   G  P
Sbjct:  267 NITPLHVACKWGKLSLCTLLLCRGAKIDAATRDGLTPLHCASRSGHVEVIKHLLQQNAPILTKTKNGLSALHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETP 468          

HSP 11 Score: 69.3218 bits (168), Expect = 1.771e-11
Identity = 104/502 (20.72%), Postives = 205/502 (40.84%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGI-------QHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXX----KPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEG--FKIFSSPQTINRPRKLV-----QKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDN-PDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKL 1630
            +H+A      E A  +++ K   +    +    LH     GH+ + +LLL      N +  +G  P+H AC     ++ + LI     +   T+ G T +H A+  G I +V  L++ + + D+    G  P+ +A      +I+++L+ +  +    AR+G  P     +H+  +    LG I       QH  +I +       DK+S  +  I     +E     +LE   ENN              K    + +Q +++   ++  +G+  +    +     N  +     K  SSP    R  +       +K++LEIA++    G   +I+ K+ +           A Q   ++++  + +   V+S+  +  L+ LH A  + +  + + +L++  +++++  N     T L  A    H   +    + + D    + +  T LH+A   G  M    L+ +    + +   G TALH A   G+  + E L
Sbjct:  337 LHMAAQGEHDEAAHLLLDNKAPVDEVTVDYLTALHVAAHCGHVKVAKLLLDYKANPNARALNGFTPLHIACKKNRIKMVELLIKHGANIGATTESGLTPLHVASFMGCINIVIYLLQHEASADLPTIRGETPLHLAARANQADIIRILLRSAKVDAI-AREGQTP-----LHVASR----LGNINIIMLLLQHGAEINAQ----SNDKYSALH--IAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHL------AAQGGNVDMVQLLLEYG-VISAAAKNGLTPLHVAAQEGHVLVSQILLEHGANISERTRNG---YTPLHMAAHYGHLDLVKFFIENDADIEMSSNIGYTPLHQAAQQGHIMIINLLLRHKANPNALTKDGNTALHIASNLGYVTVMESL 812          

HSP 12 Score: 67.781 bits (164), Expect = 5.326e-11
Identity = 44/185 (23.78%), Postives = 82/185 (44.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLEF 721
            P+H+A   G   +   ++         + + +  LH     G  +IVQ+LL    E N  T  G  P+H AC  G   + + L+     +D Q K   T +H A    +  +V+LL++   + ++  ++G   I IAC   ++EI   L+ +       ++ G +P    +  G + + +  LE+
Sbjct:  500 PLHVASRLGNINIIMLLLQHGAEINAQSNDKYSALHIAAKEGQENIVQVLLENGAENNAVTKKGFTPLHLACKYGKQNVVQILLQNGASIDFQGKNDVTPLHVATHYNNPSIVELLLKNGSSPNLCARNGQCAIHIACKKNYLEIAMQLLQHGADVNIISKSGFSPLHLAAQGGNVDMVQLLLEY 684          

HSP 13 Score: 66.6254 bits (161), Expect = 1.171e-10
Identity = 36/125 (28.80%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N NG   LH    +G++DI   LL +  +I+  T  G   +H A   G  ++  +LI  +  +++Q+  G+T ++ AA   H    + L+    N  +  +DG  P+ +A   GH +IV +L+ N
Sbjct:   70 NANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTPLAVAMQQGHDKIVAVLLEN 194          

HSP 14 Score: 55.4546 bits (132), Expect = 2.729e-7
Identity = 35/126 (27.78%), Postives = 61/126 (48.41%), Query Frame = 2
Query:  311 DIVQLLLSKDC----EINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            DI +++   DC    +IN    +G+  +H A  +G+ +I  EL+ +   +D  TK+G T++H A+  G  +V+  LI    N ++Q  +G  P+ +A    H    + L+ N         DG  P
Sbjct:   50 DIKKVMDFLDCGEISDINSCNANGLNALHLAAKDGYVDICCELLRRGIKIDNATKKGNTALHIASLAGQHDVINQLILYNANVNVQSLNGFTPLYMAAQENHDNCCRTLLANGANPSLSTEDGFTP 175          
BLAST of SMED30023739 vs. Ensembl Zebrafish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 105.531 bits (262), Expect = 2.350e-22
Identity = 113/502 (22.51%), Postives = 201/502 (40.04%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPS--------VAGEIHLDKKC-----LEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGA 1645
            P+H A   G   + E ++++    +   KNG  P+H      H+D V+ LL  + EI+  T D + P+H A   GH  + K L+ K    + +   G+T +H A    H+  + LL++   + +   + G  P+ +A   GH+ IVK L+            G +P+        V   +H+  +       +FL  +Q++ Q+ +  K   C     FY  + L + +++T +          L  ++      P  D        PL+     G+  + E  L R   N +  G K   +P  +      V  + L++     S+G       +  Y       A   A + NQ+E+ S +       +S     ++ LH A  +  PDMV  ++     A+ ++ N    T L       H    D+L +        +++  T LH A   G     ++L+     ++    +G T LH A  +G  D+   LL+ GA
Sbjct:  305 PLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQR----------GASPNSNIFSSDYVETPLHMAARAGHCEVAQFL--LQNNAQVDAKAKV--CQTCKMFY--LHLYAFDDQTPLHCAARMGHKELVKLLMEHKANP--DSATTKGFTPLHVACKYGKVDVVELLLERG-ANPNAAG-KNGLTPLHV-----AVHHNNLDVVKLLVSKGGSPHSTARNGYT------ALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK--QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGA 773          

HSP 2 Score: 102.834 bits (255), Expect = 1.484e-21
Identity = 55/182 (30.22%), Postives = 97/182 (53.30%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            NP++++K     T   P+HIA +     +A+ ++N+  N  ++ KNG  PLH     G++ +V+LLL +  +I+ +T D + P+H A  NGH  + + L+ +   L  +TK G + IH AA   H++ V+ L++     D    D   P+ +A   GH  +VK+L++    +   A +G  P
Sbjct:  228 NPDVLSK-----TGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTP 404          

HSP 3 Score: 96.6709 bits (239), Expect = 1.164e-19
Identity = 43/146 (29.45%), Postives = 79/146 (54.11%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIV 616
            P+H+A  +G  +M   +++K+ N    NKNG  PLH     GH+ I  +L+ +   +   +  G  P+H AC  G+ ++ K L+ +   ++ +T+ G+T +H AA  GH ++V LL++     +    +G  P+ IA   G+I ++
Sbjct:  653 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVI 798          

HSP 4 Score: 92.8189 bits (229), Expect = 1.671e-18
Identity = 53/197 (26.90%), Postives = 96/197 (48.73%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLEFLGGIQHSKQIFS 757
            P+HIA  +G   M   ++++    +   K+   PLH    NGH+ +V++LL +   +  +T +G+ PIH A    H +  ++L+  +  +D  T    T +H AA  GH  +VK+L++K    + +  +G  P+ IAC   H+  + LL+ +          G+ P    +  G +++ K  L+   G   +  IFS
Sbjct:  272 PLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQR--GASPNSNIFS 466          

HSP 5 Score: 90.8929 bits (224), Expect = 5.912e-18
Identity = 46/165 (27.88%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA  +   E+A  ++    N    +  G  PLH     G  D+V LL+SK   +N    +G+ P+H     GH  IA  L+ +   +   ++ G+T +H A   G+I++VK L++++ + + + + G  P+  A   GH +IV LL+ +  +      +G +P
Sbjct:  621 LHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSP 785          

HSP 6 Score: 84.7297 bits (208), Expect = 5.285e-16
Identity = 49/143 (34.27%), Postives = 75/143 (52.45%), Query Frame = 2
Query:  203 GFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            GFF   EF+ +  C F YS +NG   LH     GH+ +V  LL    ++   T  G   +H A   G  ++  ELI     ++ Q+++G++ ++ AA   H+EVVK L+E   N  +  +DG  P+ +A   GH  +V LLIN
Sbjct:   56 GFFH-TEFL-SASCFFLYS-QNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN 195          

HSP 7 Score: 83.9593 bits (206), Expect = 8.074e-16
Identity = 43/149 (28.86%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +HIA        A  ++    N +  +K G+ PLH      +L + QLLL++   +N    +G+ P+H A   G+  + + L+ +   +D +TK   T +H AA NGH+ VV++L+++      + K+G  PI +A    H++ V+ L+
Sbjct:  207 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGAQIDAKTKDELTPLHCAARNGHVRVVEILLDQGAPLQAKTKNGLSPIHMAAQGDHMDCVRQLL 355          

HSP 8 Score: 73.559 bits (179), Expect = 1.336e-12
Identity = 49/197 (24.87%), Postives = 87/197 (44.16%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEI-----------------------------AKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            L++  ID+ T T+     +HIA   G  ++   ++N   N    ++ G+ PL+      HL++V+ LL      +  T DG  P+  A   GH  +                             A  L+  D   D+ +K G+T +H AA   ++ V +LL+ +  N +   K+G  P+ IA   G++ +V+LL++
Sbjct:   94 LLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLD 290          

HSP 9 Score: 67.0106 bits (162), Expect = 1.393e-10
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  359 TNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            + +G+  +H A   GH ++  EL+     L+  TK+G T++H AA  G  +VV  LI    N + Q + G  P+ +A    H+E+VK L+ +      P  DG  P
Sbjct:   72 SQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTP 177          
BLAST of SMED30023739 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 105.145 bits (261), Expect = 2.714e-22
Identity = 49/166 (29.52%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+AC  G  ++AE ++ +  N   + KNG  PLH    + +LD+V+LL+SK    +    +G   +H A      E+A  L+      + ++ QG T +H A+  G  ++V LLI K+ N ++ +K+G  P+ +    GH+ I  +L+      +  +R G  P
Sbjct:  512 PLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTP 677          

HSP 2 Score: 100.138 bits (248), Expect = 8.977e-21
Identity = 51/151 (33.77%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            P+HIAC K      + ++    + E   ++G  PLH     GHL+IV+ LL +    N        P+H A   GH E+A+ L+  +  +D + K   T +H AA  GH E+VKLL+E K N D     G  P+ IA   GH +  ++L++
Sbjct:  347 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD 497          

HSP 3 Score: 99.7525 bits (247), Expect = 1.110e-20
Identity = 50/180 (27.78%), Postives = 93/180 (51.67%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            ++PN  N  ++      P+H+A   G  E+A+F++      +   K+   PLH     GH ++V+LL+      +  T  G  P+H A   GH +  + L+ ++      TK+G+T +H A   G ++V +LL+E+  N +   K+G  P+ +A  + ++++VKLL++        AR+G
Sbjct:  401 ASPNASNVKVET-----PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNG 575          

HSP 4 Score: 99.7525 bits (247), Expect = 1.372e-20
Identity = 46/163 (28.22%), Postives = 88/163 (53.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKL--LINNQNISFCPAR 661
            P+H+A  +G  +M   +++K+ N    NKNG  PLH     GH+ I  +L+ +   +   +  G  P+H AC  G+ ++ K L+ +   ++ +T+ G+T +H AA  GH ++V LL++     +    +G  P+ IA   G+I ++ +  L+  +++S   A+
Sbjct:  611 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMVRAK 773          

HSP 5 Score: 98.2117 bits (243), Expect = 3.235e-20
Identity = 115/537 (21.42%), Postives = 203/537 (37.80%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNK--------NGWRPLHHCCANGHLD---------------------------------IVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIE---EKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGA 1645
            T   P+HIA +     +A+ ++N+  N  ++ K        NG  P+H      H+D                                 +V++LL K  + N +  +G  P+H AC   H      L+     L+  T+ G T +H AA  GH+ +VK L+++  + +  +     P+ +A   GH E+ + L+ N       A+D   P     +H    C   +G  +  K +     N D    +  + P+ + + E   + TRI + E A +  +                 +    PL+     G+  + E  L R   N +  G K   +P  +      V  + L++     S+G       +  Y       A   A + NQ+E+ S +       +S     ++ LH A  +  PDMV  ++     A+ ++ N    T L       H    D+L +        +++  T LH A   G     ++L+     ++    +G T LH A  +G  D+   LL+ GA
Sbjct:  236 TGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTP-----LH----CAARMGHKELVKLLMEHKANPDS-ATTAGHTPLHIAAREGHAQTTRILLDENAQQTKM----------------TKKGFTPLHVACKYGKVDVAELLLERG-ANPNAAG-KNGLTPLHV-----AVHHNNLDVVKLLVSKGGSPHSTARNGYT------ALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK--QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGA 731          

HSP 6 Score: 93.5893 bits (231), Expect = 9.159e-19
Identity = 51/164 (31.10%), Postives = 80/164 (48.78%), Query Frame = 2
Query:  149 KIIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +I DIT +   P+H+A + G   M + +++K         NG+ PLH  C   H+  + LLL     +   T  G+ P+H A   GH  I K L+ +    +    +  T +H AA  GH EV + L++     D + KD   P+  A   GH E+VKLL+ ++
Sbjct:  303 EIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHK 466          

HSP 7 Score: 92.0485 bits (227), Expect = 3.081e-18
Identity = 49/181 (27.07%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHL 700
            T    P+HIA  +G  +    ++++        K G+ PLH  C  G +D+ +LLL +    N    +G+ P+H A  + + ++ K L++K        + G+T++H AA    +EV   L++   N + +   G  P+ +A   G  ++V LLI+ Q       ++G+ P   VA E H+
Sbjct:  474 TAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHV 654          

HSP 8 Score: 91.2781 bits (225), Expect = 4.669e-18
Identity = 46/165 (27.88%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA  +   E+A  ++    N    +  G  PLH     G  D+V LL+SK   +N    +G+ P+H     GH  IA  L+ +   +   ++ G+T +H A   G+I++VK L++++ + + + + G  P+  A   GH +IV LL+ +  +      +G +P
Sbjct:  579 LHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSP 743          

HSP 9 Score: 83.1889 bits (204), Expect = 1.464e-15
Identity = 45/147 (30.61%), Postives = 72/147 (48.98%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            A   G  E A   +    +   +N+NG   LH     GH+ +V  LL    ++   T  G   +H A   G  ++  ELI     ++ Q+++G++ ++ AA   H+EVVK L+E   N  +  +DG  P+ +A   GH  +V LLIN
Sbjct:   21 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN 167          

HSP 10 Score: 69.707 bits (169), Expect = 1.866e-11
Identity = 36/111 (32.43%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  344 EINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +IN    +G+  +H A   GH ++  EL+     L+  TK+G T++H AA  G  +VV  LI    N + Q + G  P+ +A    H+E+VK L+ +      P  DG  P
Sbjct:   39 DINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTP 149          

HSP 11 Score: 66.2402 bits (160), Expect = 2.384e-10
Identity = 45/190 (23.68%), Postives = 86/190 (45.26%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTN--------DGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            NP++++K+  +  +   + + C         +  + KC +    + G+ PLH      +L + QLLL++   +N            +G+ PIH A    H +  ++L+  +  +D  T    T +H AA  GH  +VK+L++K    + +  +G  P+ IAC   H+  + LL+ +          G+ P
Sbjct:  200 NPDVLSKVCVLLQDYLSVFLFCT--------YTESMKC-YTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTP 380          

HSP 12 Score: 60.8474 bits (146), Expect = 1.065e-8
Identity = 32/116 (27.59%), Postives = 54/116 (46.55%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLI 529
            +H+A  +G  +M   +++   + E + K G   LH     G   +V  L++    +N Q+  G  P++ A    H E+ K L+       + T+ G+T +  A   GH  VV LLI
Sbjct:   51 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI 166          
BLAST of SMED30023739 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 105.145 bits (261), Expect = 2.811e-22
Identity = 49/166 (29.52%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+AC  G  ++AE ++ +  N   + KNG  PLH    + +LD+V+LL+SK    +    +G   +H A      E+A  L+      + ++ QG T +H A+  G  ++V LLI K+ N ++ +K+G  P+ +    GH+ I  +L+      +  +R G  P
Sbjct:  525 PLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTP 690          

HSP 2 Score: 99.3673 bits (246), Expect = 1.447e-20
Identity = 47/163 (28.83%), Postives = 86/163 (52.76%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            P+H+A   G  E+A+F++      +   K+   PLH     GH ++V+LL+      +  T  G  P+H A   GH +  + L+ ++      TK+G+T +H A   G ++V +LL+E+  N +   K+G  P+ +A  + ++++VKLL++        AR+G
Sbjct:  426 PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNG 588          

HSP 3 Score: 98.2117 bits (243), Expect = 3.241e-20
Identity = 44/149 (29.53%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K+ N    NKNG  PLH     GH+ I  +L+ +   +   +  G  P+H AC  G+ ++ K L+ +   ++ +T+ G+T +H AA  GH ++V LL++     +    +G  P+ IA   G+I ++ +L
Sbjct:  624 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 772          

HSP 4 Score: 96.6709 bits (239), Expect = 1.073e-19
Identity = 120/540 (22.22%), Postives = 207/540 (38.33%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNK--------NGWRPLH--------------------------------HCCAN-GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC--NTDIQDKDGCR-PILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIE---EKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGA 1645
            T   P+HIA +     +A+ ++N+  N  ++ K        NG  P+H                                H  A+ GH  +V++LL K  + N +  +G  P+H AC   H      L+     L+  T+ G T +H AA  GH+ +VK L+++    N++I   D    P+ +A   GH E+ + L+ N       A+D   P     +H    C   +G  +  K +     N D    +  + P+ + + E   + TRI + E A +  +                 +    PL+     G+  + E  L R   N +  G K   +P  +      V  + L++     S+G       +  Y       A   A + NQ+E+ S +       +S     ++ LH A  +  PDMV  ++     A+ ++ N    T L       H    D+L +        +++  T LH A   G     ++L+     ++    +G T LH A  +G  D+   LL+ GA
Sbjct:  246 TGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTP-----LH----CAARMGHKELVKLLMEHKANPDS-ATTAGHTPLHIAAREGHAQTTRILLDENAQQTKM----------------TKKGFTPLHVACKYGKVDVAELLLERG-ANPNAAG-KNGLTPLHV-----AVHHNNLDVVKLLVSKGGSPHSTARNGYT------ALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK--QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGA 744          

HSP 5 Score: 92.0485 bits (227), Expect = 3.142e-18
Identity = 49/181 (27.07%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHL 700
            T    P+HIA  +G  +    ++++        K G+ PLH  C  G +D+ +LLL +    N    +G+ P+H A  + + ++ K L++K        + G+T++H AA    +EV   L++   N + +   G  P+ +A   G  ++V LLI+ Q       ++G+ P   VA E H+
Sbjct:  487 TAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHV 667          

HSP 6 Score: 91.2781 bits (225), Expect = 4.525e-18
Identity = 46/165 (27.88%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA  +   E+A  ++    N    +  G  PLH     G  D+V LL+SK   +N    +G+ P+H     GH  IA  L+ +   +   ++ G+T +H A   G+I++VK L++++ + + + + G  P+  A   GH +IV LL+ +  +      +G +P
Sbjct:  592 LHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSP 756          

HSP 7 Score: 82.4185 bits (202), Expect = 2.245e-15
Identity = 48/143 (33.57%), Postives = 74/143 (51.75%), Query Frame = 2
Query:  203 GFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            GFF   EF+ +  C   YS +NG   LH     GH+ +V  LL    ++   T  G   +H A   G  ++  ELI     ++ Q+++G++ ++ AA   H+EVVK L+E   N  +  +DG  P+ +A   GH  +V LLIN
Sbjct:   38 GFFH-TEFL-SASCFLLYS-QNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN 177          

HSP 8 Score: 67.0106 bits (162), Expect = 1.280e-10
Identity = 52/221 (23.53%), Postives = 99/221 (44.80%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTN--------DGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLEFLGGIQHSKQIFS 757
            NP++++K+  +  +   + + C         +  + KC +    + G+ PLH      +L + QLLL++   +N            +G+ PIH A    H +  ++L+  +  +D  T    T +H AA  GH  +VK+L++K    + +  +G  P+ IAC   H+  + LL+ +          G+ P    +  G +++ K  L+   G   +  IFS
Sbjct:  210 NPDVLSKVCVLLQDYLSVFLFCT--------YTESMKC-YTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQR--GASPNSNIFS 419          

HSP 9 Score: 67.0106 bits (162), Expect = 1.313e-10
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  359 TNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            + +G+  +H A   GH ++  EL+     L+  TK+G T++H AA  G  +VV  LI    N + Q + G  P+ +A    H+E+VK L+ +      P  DG  P
Sbjct:   54 SQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTP 159          
BLAST of SMED30023739 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 104.76 bits (260), Expect = 3.132e-22
Identity = 49/166 (29.52%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+AC  G  ++AE ++ +  N   + KNG  PLH    + +LD+V+LL+SK    +    +G   +H A      E+A  L+      + ++ QG T +H A+  G  ++V LLI K+ N ++ +K+G  P+ +    GH+ I  +L+      +  +R G  P
Sbjct:  507 PLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTP 672          

HSP 2 Score: 99.7525 bits (247), Expect = 1.128e-20
Identity = 51/151 (33.77%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            P+HIAC K      + ++    + E   ++G  PLH     GHL+IV+ LL +    N        P+H A   GH E+A+ L+  +  +D + K   T +H AA  GH E+VKLL+E K N D     G  P+ IA   GH +  ++L++
Sbjct:  342 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLD 492          

HSP 3 Score: 99.3673 bits (246), Expect = 1.395e-20
Identity = 50/180 (27.78%), Postives = 93/180 (51.67%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            ++PN  N  ++      P+H+A   G  E+A+F++      +   K+   PLH     GH ++V+LL+      +  T  G  P+H A   GH +  + L+ ++      TK+G+T +H A   G ++V +LL+E+  N +   K+G  P+ +A  + ++++VKLL++        AR+G
Sbjct:  396 ASPNASNVKVET-----PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNG 570          

HSP 4 Score: 99.3673 bits (246), Expect = 1.625e-20
Identity = 46/163 (28.22%), Postives = 88/163 (53.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKL--LINNQNISFCPAR 661
            P+H+A  +G  +M   +++K+ N    NKNG  PLH     GH+ I  +L+ +   +   +  G  P+H AC  G+ ++ K L+ +   ++ +T+ G+T +H AA  GH ++V LL++     +    +G  P+ IA   G+I ++ +  L+  +++S   A+
Sbjct:  606 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVLKLVTEESVSMVRAK 768          

HSP 5 Score: 98.2117 bits (243), Expect = 3.232e-20
Identity = 115/537 (21.42%), Postives = 203/537 (37.80%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNK--------NGWRPLHHCCANGHLD---------------------------------IVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIE---EKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGA 1645
            T   P+HIA +     +A+ ++N+  N  ++ K        NG  P+H      H+D                                 +V++LL K  + N +  +G  P+H AC   H      L+     L+  T+ G T +H AA  GH+ +VK L+++  + +  +     P+ +A   GH E+ + L+ N       A+D   P     +H    C   +G  +  K +     N D    +  + P+ + + E   + TRI + E A +  +                 +    PL+     G+  + E  L R   N +  G K   +P  +      V  + L++     S+G       +  Y       A   A + NQ+E+ S +       +S     ++ LH A  +  PDMV  ++     A+ ++ N    T L       H    D+L +        +++  T LH A   G     ++L+     ++    +G T LH A  +G  D+   LL+ GA
Sbjct:  231 TGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTP-----LH----CAARMGHKELVKLLMEHKANPDS-ATTAGHTPLHIAAREGHAQTTRILLDENAQQTKM----------------TKKGFTPLHVACKYGKVDVAELLLERG-ANPNAAG-KNGLTPLHV-----AVHHNNLDVVKLLVSKGGSPHSTARNGYT------ALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK--QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGA 726          

HSP 6 Score: 93.5893 bits (231), Expect = 1.022e-18
Identity = 51/164 (31.10%), Postives = 80/164 (48.78%), Query Frame = 2
Query:  149 KIIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +I DIT +   P+H+A + G   M + +++K         NG+ PLH  C   H+  + LLL     +   T  G+ P+H A   GH  I K L+ +    +    +  T +H AA  GH EV + L++     D + KD   P+  A   GH E+VKLL+ ++
Sbjct:  298 EIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHK 461          

HSP 7 Score: 91.6633 bits (226), Expect = 3.467e-18
Identity = 49/181 (27.07%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHL 700
            T    P+HIA  +G  +    ++++        K G+ PLH  C  G +D+ +LLL +    N    +G+ P+H A  + + ++ K L++K        + G+T++H AA    +EV   L++   N + +   G  P+ +A   G  ++V LLI+ Q       ++G+ P   VA E H+
Sbjct:  469 TAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHV 649          

HSP 8 Score: 91.2781 bits (225), Expect = 5.343e-18
Identity = 46/165 (27.88%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA  +   E+A  ++    N    +  G  PLH     G  D+V LL+SK   +N    +G+ P+H     GH  IA  L+ +   +   ++ G+T +H A   G+I++VK L++++ + + + + G  P+  A   GH +IV LL+ +  +      +G +P
Sbjct:  574 LHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSP 738          

HSP 9 Score: 83.1889 bits (204), Expect = 1.553e-15
Identity = 45/147 (30.61%), Postives = 72/147 (48.98%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            A   G  E A   +    +   +N+NG   LH     GH+ +V  LL    ++   T  G   +H A   G  ++  ELI     ++ Q+++G++ ++ AA   H+EVVK L+E   N  +  +DG  P+ +A   GH  +V LLIN
Sbjct:   16 AARSGNLEKALDHIKNGIDINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN 162          

HSP 10 Score: 69.707 bits (169), Expect = 1.929e-11
Identity = 36/111 (32.43%), Postives = 56/111 (50.45%), Query Frame = 2
Query:  344 EINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +IN    +G+  +H A   GH ++  EL+     L+  TK+G T++H AA  G  +VV  LI    N + Q + G  P+ +A    H+E+VK L+ +      P  DG  P
Sbjct:   34 DINIANQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTP 144          

HSP 11 Score: 66.2402 bits (160), Expect = 2.403e-10
Identity = 45/190 (23.68%), Postives = 86/190 (45.26%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTN--------DGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            NP++++K+  +  +   + + C         +  + KC +    + G+ PLH      +L + QLLL++   +N            +G+ PIH A    H +  ++L+  +  +D  T    T +H AA  GH  +VK+L++K    + +  +G  P+ IAC   H+  + LL+ +          G+ P
Sbjct:  195 NPDVLSKVCVLLQDYLSVFLFCT--------YTESMKC-YTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTP 375          

HSP 12 Score: 60.4622 bits (145), Expect = 1.158e-8
Identity = 32/116 (27.59%), Postives = 54/116 (46.55%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLI 529
            +H+A  +G  +M   +++   + E + K G   LH     G   +V  L++    +N Q+  G  P++ A    H E+ K L+       + T+ G+T +  A   GH  VV LLI
Sbjct:   46 LHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLI 161          
BLAST of SMED30023739 vs. Ensembl Zebrafish
Match: BX640476.1 (ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:797662])

HSP 1 Score: 104.76 bits (260), Expect = 3.518e-22
Identity = 49/166 (29.52%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+AC  G  ++AE ++ +  N   + KNG  PLH    + +LD+V+LL+SK    +    +G   +H A      E+A  L+      + ++ QG T +H A+  G  ++V LLI K+ N ++ +K+G  P+ +    GH+ I  +L+      +  +R G  P
Sbjct:  537 PLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTP 702          

HSP 2 Score: 98.9821 bits (245), Expect = 1.921e-20
Identity = 47/163 (28.83%), Postives = 86/163 (52.76%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            P+H+A   G  E+A+F++      +   K+   PLH     GH ++V+LL+      +  T  G  P+H A   GH +  + L+ ++      TK+G+T +H A   G ++V +LL+E+  N +   K+G  P+ +A  + ++++VKLL++        AR+G
Sbjct:  438 PLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTPLHCAARMGHKELVKLLMEHKANPDSATTAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNG 600          

HSP 3 Score: 98.2117 bits (243), Expect = 3.853e-20
Identity = 44/149 (29.53%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K+ N    NKNG  PLH     GH+ I  +L+ +   +   +  G  P+H AC  G+ ++ K L+ +   ++ +T+ G+T +H AA  GH ++V LL++     +    +G  P+ IA   G+I ++ +L
Sbjct:  636 PLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 784          

HSP 4 Score: 96.2857 bits (238), Expect = 1.448e-19
Identity = 120/540 (22.22%), Postives = 207/540 (38.33%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNK--------NGWRPLH--------------------------------HCCAN-GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC--NTDIQDKDGCR-PILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIE---EKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGA 1645
            T   P+HIA +     +A+ ++N+  N  ++ K        NG  P+H                                H  A+ GH  +V++LL K  + N +  +G  P+H AC   H      L+     L+  T+ G T +H AA  GH+ +VK L+++    N++I   D    P+ +A   GH E+ + L+ N       A+D   P     +H    C   +G  +  K +     N D    +  + P+ + + E   + TRI + E A +  +                 +    PL+     G+  + E  L R   N +  G K   +P  +      V  + L++     S+G       +  Y       A   A + NQ+E+ S +       +S     ++ LH A  +  PDMV  ++     A+ ++ N    T L       H    D+L +        +++  T LH A   G     ++L+     ++    +G T LH A  +G  D+   LL+ GA
Sbjct:  258 TGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNSNIFSSDYVETPLHMAARAGHCEVAQFLLQNNAQVDAKAKDDQTP-----LH----CAARMGHKELVKLLMEHKANPD-SATTAGHTPLHIAAREGHAQTTRILLDENAQQTKM----------------TKKGFTPLHVACKYGKVDVAELLLERG-ANPNAAG-KNGLTPLHV-----AVHHNNLDVVKLLVSKGGSPHSTARNGYT------ALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISK--QANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGA 756          

HSP 5 Score: 91.6633 bits (226), Expect = 3.829e-18
Identity = 49/181 (27.07%), Postives = 88/181 (48.62%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHL 700
            T    P+HIA  +G  +    ++++        K G+ PLH  C  G +D+ +LLL +    N    +G+ P+H A  + + ++ K L++K        + G+T++H AA    +EV   L++   N + +   G  P+ +A   G  ++V LLI+ Q       ++G+ P   VA E H+
Sbjct:  499 TAGHTPLHIAAREGHAQTTRILLDENAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTALHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHV 679          

HSP 6 Score: 90.8929 bits (224), Expect = 5.852e-18
Identity = 46/165 (27.88%), Postives = 83/165 (50.30%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +HIA  +   E+A  ++    N    +  G  PLH     G  D+V LL+SK   +N    +G+ P+H     GH  IA  L+ +   +   ++ G+T +H A   G+I++VK L++++ + + + + G  P+  A   GH +IV LL+ +  +      +G +P
Sbjct:  604 LHIAAKQNQLEVASSLLQYGANANSESLQGITPLHLASQEGQPDMVALLISKQANVNLGNKNGLTPLHLVAQEGHVGIADMLVKQGASVYAASRMGYTPLHVACHYGNIKMVKFLLQQQAHVNSKTRLGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSP 768          

HSP 7 Score: 82.4185 bits (202), Expect = 2.621e-15
Identity = 48/143 (33.57%), Postives = 74/143 (51.75%), Query Frame = 2
Query:  203 GFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            GFF   EF+ +  C   YS +NG   LH     GH+ +V  LL    ++   T  G   +H A   G  ++  ELI     ++ Q+++G++ ++ AA   H+EVVK L+E   N  +  +DG  P+ +A   GH  +V LLIN
Sbjct:   50 GFFH-TEFL-SASCFLLYS-QNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTPLAVALQQGHENVVALLIN 189          

HSP 8 Score: 67.0106 bits (162), Expect = 1.169e-10
Identity = 52/221 (23.53%), Postives = 99/221 (44.80%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTN--------DGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLEFLGGIQHSKQIFS 757
            NP++++K+  +  +   + + C         +  + KC +    + G+ PLH      +L + QLLL++   +N            +G+ PIH A    H +  ++L+  +  +D  T    T +H AA  GH  +VK+L++K    + +  +G  P+ IAC   H+  + LL+ +          G+ P    +  G +++ K  L+   G   +  IFS
Sbjct:  222 NPDVLSKVCVLLQDYLSVFLFCT--------YTESMKC-YTLFRQTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKVSSTLILLNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMVKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQR--GASPNSNIFS 431          

HSP 9 Score: 67.0106 bits (162), Expect = 1.338e-10
Identity = 34/106 (32.08%), Postives = 54/106 (50.94%), Query Frame = 2
Query:  359 TNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            + +G+  +H A   GH ++  EL+     L+  TK+G T++H AA  G  +VV  LI    N + Q + G  P+ +A    H+E+VK L+ +      P  DG  P
Sbjct:   66 SQNGLNGLHLASKEGHVKMVLELLHNGIDLETTTKKGNTALHIAALAGQEKVVAELINYGANVNAQSQKGFSPLYMAAQENHLEVVKYLLEHGANQSLPTEDGFTP 171          
BLAST of SMED30023739 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 108.227 bits (269), Expect = 4.544e-23
Identity = 51/166 (30.72%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A      ++A+F++  K       K+   PLH    +GH ++V+LLL      +  T  G  P+H     GH + A+ L+         TK+G+T +H AA  G I++ +LL+E++ + +   K G  P+ +A  + H+ IV+LL+N      C AR+G  P
Sbjct:  398 PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTP 563          

HSP 2 Score: 107.071 bits (266), Expect = 1.099e-22
Identity = 57/196 (29.08%), Postives = 101/196 (51.53%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLK 766
            P+H+A   G  ++AE ++ ++ +   + K G  PLH    + HL+IV+LLL+K    +C   +G  P+H A      + A+ L+      + Q+ QG T +H AA  GH ++V LL+ K+ N  + +K    P+ +A   GH+ I ++L+++        R G AP      + + K ++FL  +QH   + +  K
Sbjct:  497 PLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFL--LQHQANVNAVTK 690          

HSP 3 Score: 102.064 bits (253), Expect = 3.860e-21
Identity = 47/149 (31.54%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K+ N    NK+   PLH     GHL+I ++L+S D  +  +T  G  P+H AC  G+ ++ K L+     ++  TK G+T +H AA  GH ++V LL++     +    +G  P+ IA   G+I +  +L
Sbjct:  596 PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 744          

HSP 4 Score: 99.3673 bits (246), Expect = 2.315e-20
Identity = 55/176 (31.25%), Postives = 86/176 (48.86%), Query Frame = 2
Query:  152 IIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            I DIT +   P+H+A + G   +A+ +++K         NG+ PLH  C   H+ +++LLL     I+  T  G+ P+H A   GH  I K L+ K    ++ + +  T +H AA   H +V   LI+ K   + + KD   P+  A   GH E+V+LL+ N      P   G  P
Sbjct:  289 IDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTP 464          

HSP 5 Score: 95.9005 bits (237), Expect = 2.600e-19
Identity = 52/169 (30.77%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCP---ARDGVAP 676
            P+H+A  +   + A  ++         +  G  PLH     GH D+V LLLSK   ++      + P+H A   GH  IA+ L++ D  +  +T+ G+  +H A   G+I+VVK L++ + N +   K G  P+  A   GH +IV LL+ N     CP   + +G+ P
Sbjct:  563 PLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKN---GACPNQASMNGITP 728          

HSP 6 Score: 95.5153 bits (236), Expect = 3.325e-19
Identity = 51/170 (30.00%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            T   P+HIA +     +A+ ++N+  N  ++ +NG   LH     G++ +V+LLL +  +I+  T D + P+H A  NGH  I++ L+     +  +TK G + IH A+   H++ V+LL++ + + D    D   P+ +A   GH  + KLL++    S   A +G  P
Sbjct:  163 TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTP 332          

HSP 7 Score: 95.1301 bits (235), Expect = 4.362e-19
Identity = 50/166 (30.12%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + E ++    + +   ++G  PLH     GHL IV+ LL K    N  +     P+H A    H ++A  LI     ++ + K   T +H AA +GH E+V+LL+E   + D     G  P+ +    GH +  +LL++NQ       + G  P
Sbjct:  332 PLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTP 497          

HSP 8 Score: 93.2041 bits (230), Expect = 1.768e-18
Identity = 48/150 (32.00%), Postives = 76/150 (50.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H A   G   ++E +++     +   KNG  P+H      HLD V+LLL     I+  T D + P+H A   GH  +AK L+ K    + +   G+T +H A    HI V++LL++   + D   + G  P+ +A   GH+ IVK L+
Sbjct:  233 PLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLL 382          

HSP 9 Score: 89.3521 bits (220), Expect = 2.557e-17
Identity = 46/151 (30.46%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +HIA  +G   M   ++++    +   K+   PLH    NGH+ I ++LL     I  +T +G+ PIH A    H +  + L+     +D  T    T +H AA  GH  V KLL++K   ++ +  +G  P+ IAC   HI +++LL+ +
Sbjct:  201 LHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS 351          

HSP 10 Score: 79.7221 bits (195), Expect = 2.194e-14
Identity = 50/177 (28.25%), Postives = 83/177 (46.89%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCP 655
            L++K I + T T+     +HIA   G  ++   +VN   N    ++ G+ PL+      HL +V+ LL      N  T DG  P+  A   GH  +   LI+      ++ K    ++H AA N       +L++   N D+  K G  P+ IA  Y ++ + +LL+N   N++F P
Sbjct:   22 LLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS----YGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTP 194          

HSP 11 Score: 79.337 bits (194), Expect = 3.466e-14
Identity = 41/166 (24.70%), Postives = 71/166 (42.77%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G +EM   ++    + +     G  PLH     GH    +LLL         T  G  P+H A   G  +IA+ L+ ++   +   K G T +H A  + H+ +V+LL+ K  +     ++G  P+ +A     ++  + L+         +  GV P
Sbjct:  431 PLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTP 596          

HSP 12 Score: 77.7962 bits (190), Expect = 8.950e-14
Identity = 41/152 (26.97%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA        A  ++    N +  +K G+ PLH      +L++ QLLL++   +N    +G+  +H A   G+  + + L+ +   +D  TK   T +H A  NGH+ + ++L++       + K+G  PI +A    H++ V+LL+  Q
Sbjct:  135 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQ 286          

HSP 13 Score: 77.7962 bits (190), Expect = 9.027e-14
Identity = 39/122 (31.97%), Postives = 64/122 (52.46%), Query Frame = 2
Query:  266 NGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            NG   LH     GH+ +V  LL KD  +   T  G   +H A   G  ++ +EL+     ++ Q+++G+T ++ AA   H+ VVK L+E   N ++  +DG  P+ +A   GH  +V  LI+
Sbjct:    2 NGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS 123          

HSP 14 Score: 69.3218 bits (168), Expect = 3.328e-11
Identity = 33/104 (31.73%), Postives = 55/104 (52.88%), Query Frame = 2
Query:  365 DGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +G+  +H +   GH ++  EL+ KD +L+  TK+G T++H AA  G  +VV+ L+    N + Q + G  P+ +A    H+ +VK L+ N         DG  P
Sbjct:    2 NGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTP 105          
BLAST of SMED30023739 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 108.227 bits (269), Expect = 4.754e-23
Identity = 51/166 (30.72%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A      ++A+F++  K       K+   PLH    +GH ++V+LLL      +  T  G  P+H     GH + A+ L+         TK+G+T +H AA  G I++ +LL+E++ + +   K G  P+ +A  + H+ IV+LL+N      C AR+G  P
Sbjct:  436 PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTP 601          

HSP 2 Score: 106.686 bits (265), Expect = 1.150e-22
Identity = 57/196 (29.08%), Postives = 101/196 (51.53%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLK 766
            P+H+A   G  ++AE ++ ++ +   + K G  PLH    + HL+IV+LLL+K    +C   +G  P+H A      + A+ L+      + Q+ QG T +H AA  GH ++V LL+ K+ N  + +K    P+ +A   GH+ I ++L+++        R G AP      + + K ++FL  +QH   + +  K
Sbjct:  535 PLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFL--LQHQANVNAVTK 728          

HSP 3 Score: 101.679 bits (252), Expect = 4.004e-21
Identity = 47/149 (31.54%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K+ N    NK+   PLH     GHL+I ++L+S D  +  +T  G  P+H AC  G+ ++ K L+     ++  TK G+T +H AA  GH ++V LL++     +    +G  P+ IA   G+I +  +L
Sbjct:  634 PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 782          

HSP 4 Score: 99.3673 bits (246), Expect = 2.380e-20
Identity = 55/176 (31.25%), Postives = 86/176 (48.86%), Query Frame = 2
Query:  152 IIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            I DIT +   P+H+A + G   +A+ +++K         NG+ PLH  C   H+ +++LLL     I+  T  G+ P+H A   GH  I K L+ K    ++ + +  T +H AA   H +V   LI+ K   + + KD   P+  A   GH E+V+LL+ N      P   G  P
Sbjct:  327 IDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTP 502          

HSP 5 Score: 95.9005 bits (237), Expect = 2.959e-19
Identity = 52/169 (30.77%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCP---ARDGVAP 676
            P+H+A  +   + A  ++         +  G  PLH     GH D+V LLLSK   ++      + P+H A   GH  IA+ L++ D  +  +T+ G+  +H A   G+I+VVK L++ + N +   K G  P+  A   GH +IV LL+ N     CP   + +G+ P
Sbjct:  601 PLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKN---GACPNQASMNGITP 766          

HSP 6 Score: 95.5153 bits (236), Expect = 3.167e-19
Identity = 51/170 (30.00%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            T   P+HIA +     +A+ ++N+  N  ++ +NG   LH     G++ +V+LLL +  +I+  T D + P+H A  NGH  I++ L+     +  +TK G + IH A+   H++ V+LL++ + + D    D   P+ +A   GH  + KLL++    S   A +G  P
Sbjct:  201 TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTP 370          

HSP 7 Score: 95.1301 bits (235), Expect = 4.840e-19
Identity = 50/166 (30.12%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + E ++    + +   ++G  PLH     GHL IV+ LL K    N  +     P+H A    H ++A  LI     ++ + K   T +H AA +GH E+V+LL+E   + D     G  P+ +    GH +  +LL++NQ       + G  P
Sbjct:  370 PLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTP 535          

HSP 8 Score: 93.2041 bits (230), Expect = 1.881e-18
Identity = 48/150 (32.00%), Postives = 76/150 (50.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H A   G   ++E +++     +   KNG  P+H      HLD V+LLL     I+  T D + P+H A   GH  +AK L+ K    + +   G+T +H A    HI V++LL++   + D   + G  P+ +A   GH+ IVK L+
Sbjct:  271 PLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLL 420          

HSP 9 Score: 89.3521 bits (220), Expect = 2.765e-17
Identity = 46/151 (30.46%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +HIA  +G   M   ++++    +   K+   PLH    NGH+ I ++LL     I  +T +G+ PIH A    H +  + L+     +D  T    T +H AA  GH  V KLL++K   ++ +  +G  P+ IAC   HI +++LL+ +
Sbjct:  239 LHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS 389          

HSP 10 Score: 80.4925 bits (197), Expect = 1.278e-14
Identity = 43/147 (29.25%), Postives = 72/147 (48.98%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            A   G  + A   +    +    N+NG   LH     GH+ +V  LL KD  +   T  G   +H A   G  ++ +EL+     ++ Q+++G+T ++ AA   H+ VVK L+E   N ++  +DG  P+ +A   GH  +V  LI+
Sbjct:   15 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS 161          

HSP 11 Score: 79.7221 bits (195), Expect = 2.161e-14
Identity = 51/183 (27.87%), Postives = 88/183 (48.09%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVA 673
            L++K I + T T+     +HIA   G  ++   +VN   N    ++ G+ PL+      HL +V+ LL      N  T DG  P+  A   GH  +   LI+      ++ K    ++H AA N       +L++   N D+  K G  P+ IA  Y ++ + +LL+N   N++F P ++G++
Sbjct:   60 LLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS----YGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTP-QNGIS 237          

HSP 12 Score: 78.9518 bits (193), Expect = 3.532e-14
Identity = 41/166 (24.70%), Postives = 71/166 (42.77%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G +EM   ++    + +     G  PLH     GH    +LLL         T  G  P+H A   G  +IA+ L+ ++   +   K G T +H A  + H+ +V+LL+ K  +     ++G  P+ +A     ++  + L+         +  GV P
Sbjct:  469 PLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTP 634          

HSP 13 Score: 77.7962 bits (190), Expect = 9.043e-14
Identity = 41/152 (26.97%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA        A  ++    N +  +K G+ PLH      +L++ QLLL++   +N    +G+  +H A   G+  + + L+ +   +D  TK   T +H A  NGH+ + ++L++       + K+G  PI +A    H++ V+LL+  Q
Sbjct:  173 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQ 324          

HSP 14 Score: 73.9442 bits (180), Expect = 1.359e-12
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+LD     L    +IN    +G+  +H +   GH ++  EL+ KD +L+  TK+G T++H AA  G  +VV+ L+    N + Q + G  P+ +A    H+ +VK L+ N         DG  P
Sbjct:   19 GNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTP 143          

HSP 15 Score: 51.6026 bits (122), Expect = 9.420e-6
Identity = 119/535 (22.24%), Postives = 208/535 (38.88%), Query Frame = 2
Query:  446 LDIQT--KQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCLEFL---GGIQH--SKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXK-PVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVW-DRAKKD-------AEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLE--TSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETILPLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENIL 1990
            +DI T  + G  ++H ++  GH+++V  L+ K    +   K G   + IA   G  ++V+ L+N+       ++ G  P    A E HL    ++FL   G  Q+  ++  F+ L              +    ++ K R+  L  A  N+      +++   P  D   +T   PL+         + +  L R        G  +  +PQ           S L IA   S RG +  I+ + + D+    D   KD       A +N  + I   + D    + ++ +  LS +H A   ++ D V+ +L      D D+    +      AH  HH++   +L++    A +  + L   T LH A         + L+ +   ID V   G+T LH A   G   + + LL+KGA    +   +                 E  L +  +   T  + FL  + N+A  N R  ++   +H AA     E+   LLE+G   D   +  +T L   L T+     +  +L
Sbjct:   32 VDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHL--PVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNR--------GANVNFTPQN--------GISALHIA---SRRGNV--IMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHID-DITLDHLTPLHVAAHCGHHRVAKLLLDK---GAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-----------------ETPLHMAARAAHTDVADFL--IQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLH--LTTRGGHTQTAELL 518          
BLAST of SMED30023739 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 108.227 bits (269), Expect = 5.082e-23
Identity = 51/166 (30.72%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A      ++A+F++  K       K+   PLH    +GH ++V+LLL      +  T  G  P+H     GH + A+ L+         TK+G+T +H AA  G I++ +LL+E++ + +   K G  P+ +A  + H+ IV+LL+N      C AR+G  P
Sbjct:  473 PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTP 638          

HSP 2 Score: 106.686 bits (265), Expect = 1.272e-22
Identity = 57/196 (29.08%), Postives = 101/196 (51.53%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLK 766
            P+H+A   G  ++AE ++ ++ +   + K G  PLH    + HL+IV+LLL+K    +C   +G  P+H A      + A+ L+      + Q+ QG T +H AA  GH ++V LL+ K+ N  + +K    P+ +A   GH+ I ++L+++        R G AP      + + K ++FL  +QH   + +  K
Sbjct:  572 PLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFL--LQHQANVNAVTK 765          

HSP 3 Score: 101.679 bits (252), Expect = 4.277e-21
Identity = 47/149 (31.54%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K+ N    NK+   PLH     GHL+I ++L+S D  +  +T  G  P+H AC  G+ ++ K L+     ++  TK G+T +H AA  GH ++V LL++     +    +G  P+ IA   G+I +  +L
Sbjct:  671 PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 4 Score: 99.3673 bits (246), Expect = 2.564e-20
Identity = 55/176 (31.25%), Postives = 86/176 (48.86%), Query Frame = 2
Query:  152 IIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            I DIT +   P+H+A + G   +A+ +++K         NG+ PLH  C   H+ +++LLL     I+  T  G+ P+H A   GH  I K L+ K    ++ + +  T +H AA   H +V   LI+ K   + + KD   P+  A   GH E+V+LL+ N      P   G  P
Sbjct:  364 IDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTP 539          

HSP 5 Score: 95.9005 bits (237), Expect = 2.952e-19
Identity = 52/169 (30.77%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCP---ARDGVAP 676
            P+H+A  +   + A  ++         +  G  PLH     GH D+V LLLSK   ++      + P+H A   GH  IA+ L++ D  +  +T+ G+  +H A   G+I+VVK L++ + N +   K G  P+  A   GH +IV LL+ N     CP   + +G+ P
Sbjct:  638 PLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKN---GACPNQASMNGITP 803          

HSP 6 Score: 95.5153 bits (236), Expect = 3.468e-19
Identity = 51/170 (30.00%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            T   P+HIA +     +A+ ++N+  N  ++ +NG   LH     G++ +V+LLL +  +I+  T D + P+H A  NGH  I++ L+     +  +TK G + IH A+   H++ V+LL++ + + D    D   P+ +A   GH  + KLL++    S   A +G  P
Sbjct:  238 TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTP 407          

HSP 7 Score: 95.1301 bits (235), Expect = 4.828e-19
Identity = 50/166 (30.12%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + E ++    + +   ++G  PLH     GHL IV+ LL K    N  +     P+H A    H ++A  LI     ++ + K   T +H AA +GH E+V+LL+E   + D     G  P+ +    GH +  +LL++NQ       + G  P
Sbjct:  407 PLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTP 572          

HSP 8 Score: 93.2041 bits (230), Expect = 2.024e-18
Identity = 48/150 (32.00%), Postives = 76/150 (50.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H A   G   ++E +++     +   KNG  P+H      HLD V+LLL     I+  T D + P+H A   GH  +AK L+ K    + +   G+T +H A    HI V++LL++   + D   + G  P+ +A   GH+ IVK L+
Sbjct:  308 PLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLL 457          

HSP 9 Score: 89.3521 bits (220), Expect = 2.976e-17
Identity = 46/151 (30.46%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +HIA  +G   M   ++++    +   K+   PLH    NGH+ I ++LL     I  +T +G+ PIH A    H +  + L+     +D  T    T +H AA  GH  V KLL++K   ++ +  +G  P+ IAC   HI +++LL+ +
Sbjct:  276 LHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS 426          

HSP 10 Score: 80.4925 bits (197), Expect = 1.284e-14
Identity = 43/147 (29.25%), Postives = 72/147 (48.98%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            A   G  + A   +    +    N+NG   LH     GH+ +V  LL KD  +   T  G   +H A   G  ++ +EL+     ++ Q+++G+T ++ AA   H+ VVK L+E   N ++  +DG  P+ +A   GH  +V  LI+
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS 198          

HSP 11 Score: 79.7221 bits (195), Expect = 2.363e-14
Identity = 51/183 (27.87%), Postives = 88/183 (48.09%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVA 673
            L++K I + T T+     +HIA   G  ++   +VN   N    ++ G+ PL+      HL +V+ LL      N  T DG  P+  A   GH  +   LI+      ++ K    ++H AA N       +L++   N D+  K G  P+ IA  Y ++ + +LL+N   N++F P ++G++
Sbjct:   97 LLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS----YGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTP-QNGIS 274          

HSP 12 Score: 78.9518 bits (193), Expect = 3.797e-14
Identity = 41/166 (24.70%), Postives = 71/166 (42.77%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G +EM   ++    + +     G  PLH     GH    +LLL         T  G  P+H A   G  +IA+ L+ ++   +   K G T +H A  + H+ +V+LL+ K  +     ++G  P+ +A     ++  + L+         +  GV P
Sbjct:  506 PLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTP 671          

HSP 13 Score: 77.7962 bits (190), Expect = 1.023e-13
Identity = 41/152 (26.97%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA        A  ++    N +  +K G+ PLH      +L++ QLLL++   +N    +G+  +H A   G+  + + L+ +   +D  TK   T +H A  NGH+ + ++L++       + K+G  PI +A    H++ V+LL+  Q
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQ 361          

HSP 14 Score: 73.9442 bits (180), Expect = 1.448e-12
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+LD     L    +IN    +G+  +H +   GH ++  EL+ KD +L+  TK+G T++H AA  G  +VV+ L+    N + Q + G  P+ +A    H+ +VK L+ N         DG  P
Sbjct:   56 GNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTP 180          
BLAST of SMED30023739 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 107.842 bits (268), Expect = 5.616e-23
Identity = 51/166 (30.72%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A      ++A+F++  K       K+   PLH    +GH ++V+LLL      +  T  G  P+H     GH + A+ L+         TK+G+T +H AA  G I++ +LL+E++ + +   K G  P+ +A  + H+ IV+LL+N      C AR+G  P
Sbjct:  473 PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTP 638          

HSP 2 Score: 106.686 bits (265), Expect = 1.430e-22
Identity = 57/196 (29.08%), Postives = 101/196 (51.53%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLK 766
            P+H+A   G  ++AE ++ ++ +   + K G  PLH    + HL+IV+LLL+K    +C   +G  P+H A      + A+ L+      + Q+ QG T +H AA  GH ++V LL+ K+ N  + +K    P+ +A   GH+ I ++L+++        R G AP      + + K ++FL  +QH   + +  K
Sbjct:  572 PLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFL--LQHQANVNAVTK 765          

HSP 3 Score: 101.679 bits (252), Expect = 4.932e-21
Identity = 47/149 (31.54%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K+ N    NK+   PLH     GHL+I ++L+S D  +  +T  G  P+H AC  G+ ++ K L+     ++  TK G+T +H AA  GH ++V LL++     +    +G  P+ IA   G+I +  +L
Sbjct:  671 PLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKNGACPNQASMNGITPLAIAKRLGYISVTDVL 819          

HSP 4 Score: 98.9821 bits (245), Expect = 2.957e-20
Identity = 55/176 (31.25%), Postives = 86/176 (48.86%), Query Frame = 2
Query:  152 IIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            I DIT +   P+H+A + G   +A+ +++K         NG+ PLH  C   H+ +++LLL     I+  T  G+ P+H A   GH  I K L+ K    ++ + +  T +H AA   H +V   LI+ K   + + KD   P+  A   GH E+V+LL+ N      P   G  P
Sbjct:  364 IDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTP 539          

HSP 5 Score: 95.5153 bits (236), Expect = 3.376e-19
Identity = 52/169 (30.77%), Postives = 84/169 (49.70%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCP---ARDGVAP 676
            P+H+A  +   + A  ++         +  G  PLH     GH D+V LLLSK   ++      + P+H A   GH  IA+ L++ D  +  +T+ G+  +H A   G+I+VVK L++ + N +   K G  P+  A   GH +IV LL+ N     CP   + +G+ P
Sbjct:  638 PLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKN---GACPNQASMNGITP 803          

HSP 6 Score: 95.5153 bits (236), Expect = 3.867e-19
Identity = 51/170 (30.00%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            T   P+HIA +     +A+ ++N+  N  ++ +NG   LH     G++ +V+LLL +  +I+  T D + P+H A  NGH  I++ L+     +  +TK G + IH A+   H++ V+LL++ + + D    D   P+ +A   GH  + KLL++    S   A +G  P
Sbjct:  238 TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTP 407          

HSP 7 Score: 94.7449 bits (234), Expect = 5.475e-19
Identity = 50/166 (30.12%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + E ++    + +   ++G  PLH     GHL IV+ LL K    N  +     P+H A    H ++A  LI     ++ + K   T +H AA +GH E+V+LL+E   + D     G  P+ +    GH +  +LL++NQ       + G  P
Sbjct:  407 PLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTP 572          

HSP 8 Score: 92.8189 bits (229), Expect = 2.257e-18
Identity = 48/150 (32.00%), Postives = 76/150 (50.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H A   G   ++E +++     +   KNG  P+H      HLD V+LLL     I+  T D + P+H A   GH  +AK L+ K    + +   G+T +H A    HI V++LL++   + D   + G  P+ +A   GH+ IVK L+
Sbjct:  308 PLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLL 457          

HSP 9 Score: 88.9669 bits (219), Expect = 3.374e-17
Identity = 46/151 (30.46%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +HIA  +G   M   ++++    +   K+   PLH    NGH+ I ++LL     I  +T +G+ PIH A    H +  + L+     +D  T    T +H AA  GH  V KLL++K   ++ +  +G  P+ IAC   HI +++LL+ +
Sbjct:  276 LHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS 426          

HSP 10 Score: 80.4925 bits (197), Expect = 1.361e-14
Identity = 43/147 (29.25%), Postives = 72/147 (48.98%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            A   G  + A   +    +    N+NG   LH     GH+ +V  LL KD  +   T  G   +H A   G  ++ +EL+     ++ Q+++G+T ++ AA   H+ VVK L+E   N ++  +DG  P+ +A   GH  +V  LI+
Sbjct:   52 AARAGNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS 198          

HSP 11 Score: 79.7221 bits (195), Expect = 2.462e-14
Identity = 50/177 (28.25%), Postives = 83/177 (46.89%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCP 655
            L++K I + T T+     +HIA   G  ++   +VN   N    ++ G+ PL+      HL +V+ LL      N  T DG  P+  A   GH  +   LI+      ++ K    ++H AA N       +L++   N D+  K G  P+ IA  Y ++ + +LL+N   N++F P
Sbjct:   97 LLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS----YGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTP 269          

HSP 12 Score: 78.9518 bits (193), Expect = 4.162e-14
Identity = 41/166 (24.70%), Postives = 71/166 (42.77%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G +EM   ++    + +     G  PLH     GH    +LLL         T  G  P+H A   G  +IA+ L+ ++   +   K G T +H A  + H+ +V+LL+ K  +     ++G  P+ +A     ++  + L+         +  GV P
Sbjct:  506 PLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTP 671          

HSP 13 Score: 77.411 bits (189), Expect = 1.093e-13
Identity = 41/152 (26.97%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA        A  ++    N +  +K G+ PLH      +L++ QLLL++   +N    +G+  +H A   G+  + + L+ +   +D  TK   T +H A  NGH+ + ++L++       + K+G  PI +A    H++ V+LL+  Q
Sbjct:  210 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQ 361          

HSP 14 Score: 73.9442 bits (180), Expect = 1.496e-12
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+LD     L    +IN    +G+  +H +   GH ++  EL+ KD +L+  TK+G T++H AA  G  +VV+ L+    N + Q + G  P+ +A    H+ +VK L+ N         DG  P
Sbjct:   56 GNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTP 180          
BLAST of SMED30023739 vs. Ensembl Xenopus
Match: ANK1 (ankyrin 1 [Source:NCBI gene;Acc:613080])

HSP 1 Score: 106.686 bits (265), Expect = 1.193e-22
Identity = 51/166 (30.72%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A      ++A+F++  K       K+   PLH    +GH ++V+LLL      +  T  G  P+H     GH + A+ L+         TK+G+T +H AA  G I++ +LL+E++ + +   K G  P+ +A  + H+ IV+LL+N      C AR+G  P
Sbjct:  431 PLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTP 596          

HSP 2 Score: 105.916 bits (263), Expect = 2.416e-22
Identity = 57/196 (29.08%), Postives = 101/196 (51.53%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLK 766
            P+H+A   G  ++AE ++ ++ +   + K G  PLH    + HL+IV+LLL+K    +C   +G  P+H A      + A+ L+      + Q+ QG T +H AA  GH ++V LL+ K+ N  + +K    P+ +A   GH+ I ++L+++        R G AP      + + K ++FL  +QH   + +  K
Sbjct:  530 PLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFL--LQHQANVNAVTK 723          

HSP 3 Score: 98.2117 bits (243), Expect = 4.350e-20
Identity = 55/176 (31.25%), Postives = 86/176 (48.86%), Query Frame = 2
Query:  152 IIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            I DIT +   P+H+A + G   +A+ +++K         NG+ PLH  C   H+ +++LLL     I+  T  G+ P+H A   GH  I K L+ K    ++ + +  T +H AA   H +V   LI+ K   + + KD   P+  A   GH E+V+LL+ N      P   G  P
Sbjct:  322 IDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTP 497          

HSP 4 Score: 95.1301 bits (235), Expect = 4.895e-19
Identity = 51/170 (30.00%), Postives = 90/170 (52.94%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            T   P+HIA +     +A+ ++N+  N  ++ +NG   LH     G++ +V+LLL +  +I+  T D + P+H A  NGH  I++ L+     +  +TK G + IH A+   H++ V+LL++ + + D    D   P+ +A   GH  + KLL++    S   A +G  P
Sbjct:  196 TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTP 365          

HSP 5 Score: 93.9745 bits (232), Expect = 1.042e-18
Identity = 50/166 (30.12%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + E ++    + +   ++G  PLH     GHL IV+ LL K    N  +     P+H A    H ++A  LI     ++ + K   T +H AA +GH E+V+LL+E   + D     G  P+ +    GH +  +LL++NQ       + G  P
Sbjct:  365 PLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKVETPLHMAARAAHTDVADFLIQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTP 530          

HSP 6 Score: 93.9745 bits (232), Expect = 1.097e-18
Identity = 54/180 (30.00%), Postives = 86/180 (47.78%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGV-------APSVAGEIH 697
            P+H+A  +   + A  ++         +  G  PLH     GH D+V LLLSK   ++      + P+H A   GH  IA+ L++ D  +  +T+ G+  +H A   G+I+VVK L++ + N +   K G  P+  A   GH +IV LL+ N     CP +  +        P +A E H
Sbjct:  596 PLHMAVKQRSVDTARALLQFGATCNAQSLQGVTPLHLAAQEGHGDMVTLLLSKQANVHLGNKSSLTPLHLASQEGHLNIAEVLVSHDASVAAETRMGFAPLHVACHYGNIKVVKFLLQHQANVNAVTKLGFTPLHQAAQQGHTDIVTLLLKN---GACPNQASMVSALTLSPPQLANERH 772          

HSP 7 Score: 92.4337 bits (228), Expect = 2.962e-18
Identity = 48/150 (32.00%), Postives = 76/150 (50.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H A   G   ++E +++     +   KNG  P+H      HLD V+LLL     I+  T D + P+H A   GH  +AK L+ K    + +   G+T +H A    HI V++LL++   + D   + G  P+ +A   GH+ IVK L+
Sbjct:  266 PLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLL 415          

HSP 8 Score: 88.5817 bits (218), Expect = 4.366e-17
Identity = 46/151 (30.46%), Postives = 77/151 (50.99%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +HIA  +G   M   ++++    +   K+   PLH    NGH+ I ++LL     I  +T +G+ PIH A    H +  + L+     +D  T    T +H AA  GH  V KLL++K   ++ +  +G  P+ IAC   HI +++LL+ +
Sbjct:  234 LHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHIDDITLDHLTPLHVAAHCGHHRVAKLLLDKGAKSNARALNGFTPLHIACKKSHIRVMELLLKS 384          

HSP 9 Score: 79.337 bits (194), Expect = 2.753e-14
Identity = 40/124 (32.26%), Postives = 66/124 (53.23%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            N+NG   LH     GH+ +V  LL KD  +   T  G   +H A   G  ++ +EL+     ++ Q+++G+T ++ AA   H+ VVK L+E   N ++  +DG  P+ +A   GH  +V  LI+
Sbjct:   33 NQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS 156          

HSP 10 Score: 78.5666 bits (192), Expect = 4.502e-14
Identity = 51/183 (27.87%), Postives = 88/183 (48.09%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVA 673
            L++K I + T T+     +HIA   G  ++   +VN   N    ++ G+ PL+      HL +V+ LL      N  T DG  P+  A   GH  +   LI+      ++ K    ++H AA N       +L++   N D+  K G  P+ IA  Y ++ + +LL+N   N++F P ++G++
Sbjct:   55 LLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLIS----YGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTP-QNGIS 232          

HSP 11 Score: 78.1814 bits (191), Expect = 6.265e-14
Identity = 41/166 (24.70%), Postives = 71/166 (42.77%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G +EM   ++    + +     G  PLH     GH    +LLL         T  G  P+H A   G  +IA+ L+ ++   +   K G T +H A  + H+ +V+LL+ K  +     ++G  P+ +A     ++  + L+         +  GV P
Sbjct:  464 PLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLHLTTRGGHTQTAELLLDNQAAHTSMTKKGFTPLHVAAKYGKIQIAELLLEREAHPNSAGKTGLTPLHVAVYHNHLNIVRLLLNKGASPHCTARNGYTPLHMAVKQRSVDTARALLQFGATCNAQSLQGVTP 629          

HSP 12 Score: 76.6406 bits (187), Expect = 1.733e-13
Identity = 41/152 (26.97%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA        A  ++    N +  +K G+ PLH      +L++ QLLL++   +N    +G+  +H A   G+  + + L+ +   +D  TK   T +H A  NGH+ + ++L++       + K+G  PI +A    H++ V+LL+  Q
Sbjct:  168 LHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNRGANVNFTPQNGISALHIASRRGNVIMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQ 319          

HSP 13 Score: 73.1738 bits (178), Expect = 2.459e-12
Identity = 39/125 (31.20%), Postives = 63/125 (50.40%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+LD     L    +IN    +G+  +H +   GH ++  EL+ KD +L+  TK+G T++H AA  G  +VV+ L+    N + Q + G  P+ +A    H+ +VK L+ N         DG  P
Sbjct:   14 GNLDKALDHLRNGVDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHLPVVKFLLENGANQNLATEDGFTP 138          

HSP 14 Score: 52.7582 bits (125), Expect = 4.132e-6
Identity = 119/535 (22.24%), Postives = 208/535 (38.88%), Query Frame = 2
Query:  446 LDIQT--KQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCLEFL---GGIQH--SKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXK-PVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVW-DRAKKD-------AEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLE--TSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETILPLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENIL 1990
            +DI T  + G  ++H ++  GH+++V  L+ K    +   K G   + IA   G  ++V+ L+N+       ++ G  P    A E HL    ++FL   G  Q+  ++  F+ L              +    ++ K R+  L  A  N+      +++   P  D   +T   PL+         + +  L R        G  +  +PQ           S L IA   S RG +  I+ + + D+    D   KD       A +N  + I   + D    + ++ +  LS +H A   ++ D V+ +L      D D+    +      AH  HH++   +L++    A +  + L   T LH A         + L+ +   ID V   G+T LH A   G   + + LL+KGA    +   +                 E  L +  +   T  + FL  + N+A  N R  ++   +H AA     E+   LLE+G   D   +  +T L   L T+     +  +L
Sbjct:   27 VDINTCNQNGLNALHLSSKEGHVKMVTELLHKDIVLETTTKKGNTALHIAALAGQEDVVRELVNHGANVNSQSQKGFTPLYMAAQENHL--PVVKFLLENGANQNLATEDGFTPLAVALQQGHENVVAYLISYGMKGKVRLPALHIAARNDDTRTAAVLLQNDPNADVLSKTGFTPLHIAAHYENLNVAQLLLNR--------GANVNFTPQN--------GISALHIA---SRRGNV--IMVRLLLDRGAQIDACTKDELTPLHCAVRNGHVRISEILLDHGAPIQAKTKNGLSPIHMASQGDHLDCVRLLLQYQAHID-DITLDHLTPLHVAAHCGHHRVAKLLLDK---GAKSNARALNGFTPLHIACKKSHIRVMELLLKSGASIDAVTESGLTPLHVASFMGHLPIVKTLLQKGASPNVFSVKV-----------------ETPLHMAARAAHTDVADFL--IQNKAKVNARAKDDQTPLHCAARSGHYEMVRLLLENGAHPDPPTTAGHTPLH--LTTRGGHTQTAELL 513          
BLAST of SMED30023739 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 107.457 bits (267), Expect = 6.180e-23
Identity = 57/174 (32.76%), Postives = 84/174 (48.28%), Query Frame = 2
Query:  164 TTNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TTN R    +H+A   G  E+  ++V      E   K+   PLH     G  DIVQ LL +    N  T  G  P+H A   GH ++A  L+     L I TK+G+T +H AA  G +EV  LL++K  + D   K G  P+ +A  Y + ++  LL++        A++G  P
Sbjct:  469 TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTP 642          

HSP 2 Score: 97.4413 bits (241), Expect = 7.072e-20
Identity = 52/197 (26.40%), Postives = 95/197 (48.22%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKN 769
            P+H+A   G  E+A  ++ K  + + + K+G  PLH      +  +  LLL +    +    +G  P+H A      +IA  L+      +  T+QG  S+H AA  GH+++V LL+ +  N ++ +K G  P+ +A     + + ++L+N         + G  P   G  + + K + FL  +QHS ++ +  KN
Sbjct:  576 PLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKN 770          

HSP 3 Score: 93.9745 bits (232), Expect = 8.972e-19
Identity = 46/157 (29.30%), Postives = 85/157 (54.14%), Query Frame = 2
Query:  158 DITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            DIT    P+H+A  +G   M + ++++    +   ++G  PLH    +GH  +V++LL +   I  +T +G+ P+H A    H    + L+  +  +D  T    T++H AA  GH +V K+L++KK + + +  +G  P+ IAC    I +++LL+
Sbjct:  276 DIT----PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL 428          

HSP 4 Score: 93.5893 bits (231), Expect = 1.109e-18
Identity = 49/196 (25.00%), Postives = 101/196 (51.53%), Query Frame = 2
Query:   89 FVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
             +LQN+     D+ +  ++N+  +  +   P+HIA + G   +A  ++N+    +++ +N   PLH     G+ ++V+LLL +  +I+ +T DG+ P+H    +GH ++ + L+ +   +  +TK G + +H A    H+  V+LL++     D    D    + +A   GH ++ K+L++ +      A +G  P
Sbjct:  220 LLLQNDTNA--DVESKMVVNRATE--SGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTP 411          

HSP 5 Score: 92.4337 bits (228), Expect = 2.629e-18
Identity = 46/165 (27.88%), Postives = 80/165 (48.48%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A + G +++A+ +++KK +      NG+ PLH  C    + +++LLL     I   T  G+ PIH A   GH  I  +L+      +    +G T++H AA +G  EVV+ L++     + + KD   P+ I+   G  +IV+ L+            G  P
Sbjct:  379 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTP 543          

HSP 6 Score: 92.0485 bits (227), Expect = 3.389e-18
Identity = 59/211 (27.96%), Postives = 101/211 (47.87%), Query Frame = 2
Query:   35 NYCNLILIRMSESEIFKDFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N   L+L R +      DF  +N++  +   S   N N++  ++D    I   TR    P+H     G  ++ E ++++        KNG  PLH      HL+ VQLLL  +  ++  TND +  +H A   GH+++AK L+ K    + +   G+T +H A     I V++LL++   +     + G  PI +A   GH+ IV  L+++
Sbjct:  257 NVATLLLNRAAAV----DFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH 463          

HSP 7 Score: 91.2781 bits (225), Expect = 5.538e-18
Identity = 42/152 (27.63%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIA  K   ++A  ++    +     + G   +H     GH+D+V LLLS++  +N     G+ P+H A       +A+ L+ +   +D QTK G+T +H     G+I++V  L++     + + K+G   +  A   GH  I+ +L+ N
Sbjct:  642 PLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQN 793          

HSP 8 Score: 90.8929 bits (224), Expect = 7.019e-18
Identity = 39/148 (26.35%), Postives = 79/148 (53.38%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            +H+A  +G  +M   ++++  N   SNK+G  PLH       +++ ++L+++   ++ QT  G  P+H  C  G+ +I   L+     ++ +TK G+T++H AA  GH  ++ +L++   + +    +G   + IA   G+I +V  L
Sbjct:  676 VHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 9 Score: 89.3521 bits (220), Expect = 2.039e-17
Identity = 42/148 (28.38%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            A   G  E A   +    +    N+NG   LH     GH+++V  LL ++  ++  T  G   +H A   G  E+ K L+     ++ Q++ G+T ++ AA   H+EVV+ L++   +  +  +DG  P+ +A   GH ++V LL+ N
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 195          

HSP 10 Score: 87.4261 bits (215), Expect = 8.451e-17
Identity = 40/166 (24.10%), Postives = 76/166 (45.78%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   +++   +   +N  G   LH    +G  ++V+ L+    ++  +  D   P+H +   G  +I ++L+ +    +  T  G+T +H AA  GH +V   L++   +  I  K G  P+ +A  YG +E+  LL+          + G+ P
Sbjct:  444 PIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTP 609          

HSP 11 Score: 86.6557 bits (213), Expect = 1.581e-16
Identity = 49/210 (23.33%), Postives = 99/210 (47.14%), Query Frame = 2
Query:   50 ILIRMSESEIFKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVAP 676
            I  R+ +++I +  + Q         ++PN        T+   P+H+A  +G  ++A F+++   +   + K G+ PLH     G L++  LLL K    +     G+ P+H A    + ++A  L+ +        K G+T +H AA    +++   L+E   + +   + G   + +A   GH+++V LL++ N N++    + G+ P
Sbjct:  513 ISARLGKADIVQQLLQQG--------ASPNAAT-----TSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLS-NKSGLTP 708          

HSP 12 Score: 83.9593 bits (206), Expect = 9.031e-16
Identity = 38/125 (30.40%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            GHL+     +    ++N    +G+  +H A   GH E+  EL+ ++  +D  TK+G T++H A+  G  EVVK+L+    N + Q ++G  P+ +A    H+E+V+ L++N         DG  P
Sbjct:   52 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTP 176          

HSP 13 Score: 82.0333 bits (201), Expect = 3.709e-15
Identity = 49/178 (27.53%), Postives = 82/178 (46.07%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSV---AGEIHLD 703
            P+HI+   G  ++ + ++ +  +   +  +G+ PLH     GH D+   LL     ++  T  G  P+H A   G  E+A  L+ K    D   K G T +H AA   + +V  LL+++  +     K+G  P+ IA     ++I   L+     +    R G+A SV   A E H+D
Sbjct:  510 PLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIA-SVHLAAQEGHVD 686          

HSP 14 Score: 80.1073 bits (196), Expect = 1.643e-14
Identity = 58/233 (24.89%), Postives = 95/233 (40.77%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEI-----------------------------AKELIAKDCLLDIQTK--------QGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKN 769
            +HIA   G  E+ + +V    N    ++NG+ PL+      HL++V+ LL      +  T DG  P+  A   GH ++                             A  L+  D   D+++K         G+T +H AA  G+I V  LL+ +    D   ++   P+ +A   G+  +VKLL++         RDG+ P   G     ++ +E L  +  S  I S  KN
Sbjct:  111 LHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML--LDRSAPILSKTKN 341          

HSP 15 Score: 78.1814 bits (191), Expect = 5.017e-14
Identity = 47/202 (23.27%), Postives = 85/202 (42.08%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIE-----------------------------KKCNTDIQDK--------DGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A  +G  E+   ++ ++ N + + K G   LH     G  ++V++L++    +N Q+ +G  P++ A    H E+ + L+       + T+ G+T +  A   GH +VV LL+E                                N D++ K         G  P+ IA  YG+I +  LL+N        AR+ + P
Sbjct:   78 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKMVVNRATESGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITP 279          

HSP 16 Score: 67.781 bits (164), Expect = 7.322e-11
Identity = 41/133 (30.83%), Postives = 65/133 (48.87%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLL 526
            +N NL NK     +   P+H+A  +    +AE +VN+  + +   K G+ PLH  C  G++ IV  LL    ++N +T +G   +H A   GH  I   L+  +   +  T  G T++  A   G+I VV  L
Sbjct:  696 ANVNLSNK-----SGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 823          

HSP 17 Score: 57.3806 bits (137), Expect = 1.358e-7
Identity = 34/107 (31.78%), Postives = 54/107 (50.47%), Query Frame = 2
Query:  389 ACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLD 703
            A   GH E A + I     ++I  + G  ++H A+  GH+EVV  L++++ N D   K G   + IA   G  E+VK+L+ N       +++G  P    A E HL+
Sbjct:   48 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLE 154          

HSP 18 Score: 51.2174 bits (121), Expect = 9.326e-6
Identity = 61/255 (23.92%), Postives = 106/255 (41.57%), Query Frame = 2
Query: 1379 TALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGAD-----CTRYI----------ENIPQFMLDSKETILPLTTKENALTLCIKI-HGTIYSCFL---DNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALAS 2086
            T +  A  + H   +  L  +    NT N   ET+LH A  SG     +YL+ +  +++       T LH +   G  D+ ++LL++GA       + Y           E++  F+LD   + L +TTK+    L +   +G +    L    + S +A G     +    +H+AA     +V L LL+ G           T L   +  K NQ          + +   L+E+G+D N ++  G + + LA+
Sbjct:  443 TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK----SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH--IAAKKNQ----------MDIATSLLEYGADANAVTRQGIASVHLAA 680          
BLAST of SMED30023739 vs. Ensembl Mouse
Match: Ank1 (ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88024])

HSP 1 Score: 106.301 bits (264), Expect = 9.463e-23
Identity = 55/191 (28.80%), Postives = 94/191 (49.21%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQI 751
            P+H+A   G   +AE ++    +   + KNG  PLH    + +LDIV+LLL +    +    +G  P+H A      E+A+ L+      + ++ QG T +H AA  GH E+V LL+ K+ N ++ +K G  P+ +    GH+ +  +LI +        R G  P      + + K ++FL  +QH   +
Sbjct:  136 PLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFL--LQHQADV 324          

HSP 2 Score: 101.293 bits (251), Expect = 3.746e-21
Identity = 58/204 (28.43%), Postives = 101/204 (49.51%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLEFLG 727
            ++PN+ N  ++      P+H+A   G  E+A++++  K       K+   PLH     GH  +V+LLL      N  T  G  P+H A   GH + A  L+ K+      TK+G+T +H AA  G + + +LL+E   + +   K+G  P+ +A  + +++IVKLL+        PA +G  P    +   +I + +  L++ G
Sbjct:   25 ASPNVSNVKVET-----PLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGG 223          

HSP 3 Score: 100.908 bits (250), Expect = 4.368e-21
Identity = 51/166 (30.72%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA  +   E+A  ++    +    +  G  PLH     GH ++V LLLSK    N     G+ P+H     GH  +A  LI     +D  T+ G+T +H A+  G+I++VK L++ + + + + K G  P+  A   GH +IV LL+ N       + +G  P
Sbjct:  202 PLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTP 367          

HSP 4 Score: 97.8265 bits (242), Expect = 4.637e-20
Identity = 43/149 (28.86%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  EM   +++K+ N    NK+G  PLH     GH+ +  +L+     ++  T  G  P+H A   G+ ++ K L+     ++ +TK G++ +H AA  GH ++V LL++   + +    +G  P+ IA   G+I +  +L
Sbjct:  235 PLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTPLHLVSQEGHVPVADVLIKHGVTVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSNGTTPLAIAKRLGYISVTDVL 383          

HSP 5 Score: 89.7373 bits (221), Expect = 1.423e-17
Identity = 49/183 (26.78%), Postives = 85/183 (46.45%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            ++PNL       T    P+H A  +G  + A  ++ K+ +     K G+ PLH     G + + +LLL  D   N    +G+ P+H A  + + +I K L+ +          G+T +H AA    IEV + L++   + + +   G  P+ +A   GH E+V LL++ Q       + G+ P
Sbjct:   91 ASPNLAT-----TAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTPLHLAAQEGHTEMVALLLSKQANGNLGNKSGLTP 268          

HSP 6 Score: 83.1889 bits (204), Expect = 1.200e-15
Identity = 49/191 (25.65%), Postives = 86/191 (45.03%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFL---GGIQHS 742
            P+H+A   G   + + ++ +  +   SN     PLH     GH ++ + LL    + N +  D   P+H A   GH  + K L+      ++ T  G T +H AA  GH++    L+EK+ +     K G  P+ +A  YG + + +LL+ +        ++G+ P      H +   ++ L   GG  HS
Sbjct:    4 PLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHS 194          

HSP 7 Score: 82.8037 bits (203), Expect = 1.589e-15
Identity = 44/166 (26.51%), Postives = 73/166 (43.98%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G   M + ++    +   +   G  PLH     GH+D    LL K+    C T  G  P+H A   G   +A+ L+  D   +   K G T +H A  + ++++VKLL+ +  +      +G  P+ IA     IE+ + L+     +   +  GV P
Sbjct:   70 PLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLEHDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQIEVARSLLQYGGSANAESVQGVTP 235          

HSP 8 Score: 72.4034 bits (176), Expect = 2.731e-12
Identity = 46/154 (29.87%), Postives = 69/154 (44.81%), Query Frame = 2
Query:  269 GWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLE 718
            G  PLH     GHL IV+ LL +    N        P+H A   GH E+AK L+      + + K   T +H AA  GH  +VKLL+E   + ++    G  P+  A   GH++    L+  +    C  + G  P    +  G++ L +  LE
Sbjct:    1 GLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKANAKAKDDQTPLHCAARIGHTGMVKLLLENGASPNLATTAGHTPLHTAAREGHVDTALALLEKEASQACMTKKGFTPLHVAAKYGKVRLAELLLE 154          
BLAST of SMED30023739 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 106.301 bits (264), Expect = 1.436e-22
Identity = 57/174 (32.76%), Postives = 84/174 (48.28%), Query Frame = 2
Query:  164 TTNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TTN R    +H+A   G  E+  ++V      E   K+   PLH     G  DIVQ LL +    N  T  G  P+H A   GH ++A  L+     L I TK+G+T +H AA  G +EV  LL++K  + D   K G  P+ +A  Y + ++  LL++        A++G  P
Sbjct:  444 TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTP 617          

HSP 2 Score: 97.0561 bits (240), Expect = 9.191e-20
Identity = 52/197 (26.40%), Postives = 95/197 (48.22%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKN 769
            P+H+A   G  E+A  ++ K  + + + K+G  PLH      +  +  LLL +    +    +G  P+H A      +IA  L+      +  T+QG  S+H AA  GH+++V LL+ +  N ++ +K G  P+ +A     + + ++L+N         + G  P   G  + + K + FL  +QHS ++ +  KN
Sbjct:  551 PLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKN 745          

HSP 3 Score: 92.8189 bits (229), Expect = 1.537e-18
Identity = 46/180 (25.56%), Postives = 92/180 (51.11%), Query Frame = 2
Query:  137 NLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N  N  ++  +   P+HIA + G   +A  ++N+    +++ +N   PLH     G+ ++V+LLL +  +I+ +T DG+ P+H    +GH ++ + L+ +   +  +TK G + +H A    H+  V+LL++     D    D    + +A   GH ++ K+L++ +      A +G  P
Sbjct:  207 NDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTP 386          

HSP 4 Score: 92.8189 bits (229), Expect = 1.604e-18
Identity = 46/157 (29.30%), Postives = 85/157 (54.14%), Query Frame = 2
Query:  158 DITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            DIT    P+H+A  +G   M + ++++    +   ++G  PLH    +GH  +V++LL +   I  +T +G+ P+H A    H    + L+  +  +D  T    T++H AA  GH +V K+L++KK + + +  +G  P+ IAC    I +++LL+
Sbjct:  251 DIT----PLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL 403          

HSP 5 Score: 91.2781 bits (225), Expect = 5.304e-18
Identity = 46/165 (27.88%), Postives = 80/165 (48.48%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A + G +++A+ +++KK +      NG+ PLH  C    + +++LLL     I   T  G+ PIH A   GH  I  +L+      +    +G T++H AA +G  EVV+ L++     + + KD   P+ I+   G  +IV+ L+            G  P
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTP 518          

HSP 6 Score: 90.8929 bits (224), Expect = 6.075e-18
Identity = 59/211 (27.96%), Postives = 101/211 (47.87%), Query Frame = 2
Query:   35 NYCNLILIRMSESEIFKDFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N   L+L R +      DF  +N++  +   S   N N++  ++D    I   TR    P+H     G  ++ E ++++        KNG  PLH      HL+ VQLLL  +  ++  TND +  +H A   GH+++AK L+ K    + +   G+T +H A     I V++LL++   +     + G  PI +A   GH+ IV  L+++
Sbjct:  232 NVATLLLNRAAAV----DFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH 438          

HSP 7 Score: 90.5077 bits (223), Expect = 9.363e-18
Identity = 42/152 (27.63%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIA  K   ++A  ++    +     + G   +H     GH+D+V LLLS++  +N     G+ P+H A       +A+ L+ +   +D QTK G+T +H     G+I++V  L++     + + K+G   +  A   GH  I+ +L+ N
Sbjct:  617 PLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQN 768          

HSP 8 Score: 90.1225 bits (222), Expect = 1.271e-17
Identity = 39/148 (26.35%), Postives = 79/148 (53.38%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            +H+A  +G  +M   ++++  N   SNK+G  PLH       +++ ++L+++   ++ QT  G  P+H  C  G+ +I   L+     ++ +TK G+T++H AA  GH  ++ +L++   + +    +G   + IA   G+I +V  L
Sbjct:  651 VHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 9 Score: 89.3521 bits (220), Expect = 1.941e-17
Identity = 107/502 (21.31%), Postives = 204/502 (40.64%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIE-EKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVME----PLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYD-KEVWDRAKKD------AEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADC 1651
            +HIA  K   + A  ++    N +  +K+G+ PLH     G++++  LLL++   ++    + + P+H A   G+  + K L+ +   +D +T+ G T +H  A +GH +VV++L+++      + K+G  P+ +A    H+  V+LL+ + N+      D V       +H+   C    G  + +K +     + +    + F    T + I  +K RI V+E   ++                  IQ V E    P++     G   I    ++              +SP T N     V+    E A+  ++R    ++++  + D  +V  +AK D      + +  + +I+ ++  +    ++   +  + LH A  + + D+  ++LD+   A   +   +  T L  A          +L Q +   +   K   T LH A           L+D           G T LH A  K   D+   LL  GAD 
Sbjct:  189 LHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH-NVPV----DDVTNDYLTALHVAAHC----GHYKVAKVLLDKKASPNAKALNGF----TPLHIACKKNRIRVMELLLKHGA---------------SIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG------------ASPNTTN-----VRG---ETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHG--ASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADA 640          

HSP 10 Score: 88.1965 bits (217), Expect = 4.095e-17
Identity = 42/148 (28.38%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            A   G  E A   +    +    N+NG   LH     GH+++V  LL ++  ++  T  G   +H A   G  E+ K L+     ++ Q++ G+T ++ AA   H+EVV+ L++   +  +  +DG  P+ +A   GH ++V LL+ N
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 178          

HSP 11 Score: 86.2705 bits (212), Expect = 1.730e-16
Identity = 40/166 (24.10%), Postives = 76/166 (45.78%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   +++   +   +N  G   LH    +G  ++V+ L+    ++  +  D   P+H +   G  +I ++L+ +    +  T  G+T +H AA  GH +V   L++   +  I  K G  P+ +A  YG +E+  LL+          + G+ P
Sbjct:  419 PIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTP 584          

HSP 12 Score: 85.5001 bits (210), Expect = 2.644e-16
Identity = 49/210 (23.33%), Postives = 99/210 (47.14%), Query Frame = 2
Query:   50 ILIRMSESEIFKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVAP 676
            I  R+ +++I +  + Q         ++PN        T+   P+H+A  +G  ++A F+++   +   + K G+ PLH     G L++  LLL K    +     G+ P+H A    + ++A  L+ +        K G+T +H AA    +++   L+E   + +   + G   + +A   GH+++V LL++ N N++    + G+ P
Sbjct:  488 ISARLGKADIVQQLLQQG--------ASPNAAT-----TSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLS-NKSGLTP 683          

HSP 13 Score: 84.7297 bits (208), Expect = 5.574e-16
Identity = 47/194 (24.23%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIE-----------------------------KKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A  +G  E+   ++ ++ N + + K G   LH     G  ++V++L++    +N Q+ +G  P++ A    H E+ + L+       + T+ G+T +  A   GH +VV LL+E                                N D++ K G  P+ IA  YG+I +  LL+N        AR+ + P
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITP 254          

HSP 14 Score: 83.5741 bits (205), Expect = 1.165e-15
Identity = 38/125 (30.40%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            GHL+     +    ++N    +G+  +H A   GH E+  EL+ ++  +D  TK+G T++H A+  G  EVVK+L+    N + Q ++G  P+ +A    H+E+V+ L++N         DG  P
Sbjct:   35 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTP 159          

HSP 15 Score: 81.2629 bits (199), Expect = 6.621e-15
Identity = 51/197 (25.89%), Postives = 92/197 (46.70%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKN 769
            P+++A  +   E+  F+++   +   + ++G+ PL      GH  +V LLL  D +   +    +  +H A      + A  L+  D   D+++K G+T +H AA  G+I V  LL+ +    D   ++   P+ +A   G+  +VKLL++         RDG+ P   G     ++ +E L  +  S  I S  KN
Sbjct:  126 PLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML--LDRSAPILSKTKN 316          

HSP 16 Score: 80.8777 bits (198), Expect = 7.267e-15
Identity = 47/177 (26.55%), Postives = 80/177 (45.20%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPS--VAGEIHLD 703
            P+HI+   G  ++ + ++ +  +   +  +G+ PLH     GH D+   LL     ++  T  G  P+H A   G  E+A  L+ K    D   K G T +H AA   + +V  LL+++  +     K+G  P+ IA     ++I   L+     +    R G+A     A E H+D
Sbjct:  485 PLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVD 661          

HSP 17 Score: 67.781 bits (164), Expect = 8.349e-11
Identity = 41/133 (30.83%), Postives = 65/133 (48.87%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLL 526
            +N NL NK     +   P+H+A  +    +AE +VN+  + +   K G+ PLH  C  G++ IV  LL    ++N +T +G   +H A   GH  I   L+  +   +  T  G T++  A   G+I VV  L
Sbjct:  671 ANVNLSNK-----SGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 18 Score: 56.9954 bits (136), Expect = 1.429e-7
Identity = 34/107 (31.78%), Postives = 54/107 (50.47%), Query Frame = 2
Query:  389 ACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLD 703
            A   GH E A + I     ++I  + G  ++H A+  GH+EVV  L++++ N D   K G   + IA   G  E+VK+L+ N       +++G  P    A E HL+
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLE 137          

HSP 19 Score: 51.6026 bits (122), Expect = 6.053e-6
Identity = 71/302 (23.51%), Postives = 127/302 (42.05%), Query Frame = 2
Query: 1379 TALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGAD-----CTRYI----------ENIPQFMLDSKETILPLTTKENALTLCIKI-HGTIYSCFL---DNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETIFLFPF----KEKWFDFADKLVN 2215
            T +  A  + H   +  L  +    NT N   ET+LH A  SG     +YL+ +  +++       T LH +   G  D+ ++LL++GA       + Y           E++  F+LD   + L +TTK+    L +   +G +    L    + S +A G     +    +H+AA     +V L LL+ G           T L   +  K NQ          + +   L+E+G+D N ++  G + + LA+      ++  L+S++  + N++    L P     +E   + A+ LVN
Sbjct:  418 TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK----SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH--IAAKKNQ----------MDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANV-NLSNKSGLTPLHLAAQEDRVNVAEVLVN 701          
BLAST of SMED30023739 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 106.301 bits (264), Expect = 1.518e-22
Identity = 57/174 (32.76%), Postives = 84/174 (48.28%), Query Frame = 2
Query:  164 TTNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TTN R    +H+A   G  E+  ++V      E   K+   PLH     G  DIVQ LL +    N  T  G  P+H A   GH ++A  L+     L I TK+G+T +H AA  G +EV  LL++K  + D   K G  P+ +A  Y + ++  LL++        A++G  P
Sbjct:  444 TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTP 617          

HSP 2 Score: 96.6709 bits (239), Expect = 1.186e-19
Identity = 52/197 (26.40%), Postives = 95/197 (48.22%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKN 769
            P+H+A   G  E+A  ++ K  + + + K+G  PLH      +  +  LLL +    +    +G  P+H A      +IA  L+      +  T+QG  S+H AA  GH+++V LL+ +  N ++ +K G  P+ +A     + + ++L+N         + G  P   G  + + K + FL  +QHS ++ +  KN
Sbjct:  551 PLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKN 745          

HSP 3 Score: 92.8189 bits (229), Expect = 1.575e-18
Identity = 46/167 (27.54%), Postives = 88/167 (52.69%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            L+N+   +    R    P+H+A  +G   M + ++++    +   ++G  PLH    +GH  +V++LL +   I  +T +G+ P+H A    H    + L+  +  +D  T    T++H AA  GH +V K+L++KK + + +  +G  P+ IAC    I +++LL+
Sbjct:  237 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL 403          

HSP 4 Score: 92.8189 bits (229), Expect = 1.700e-18
Identity = 46/180 (25.56%), Postives = 92/180 (51.11%), Query Frame = 2
Query:  137 NLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N  N  ++  +   P+HIA + G   +A  ++N+    +++ +N   PLH     G+ ++V+LLL +  +I+ +T DG+ P+H    +GH ++ + L+ +   +  +TK G + +H A    H+  V+LL++     D    D    + +A   GH ++ K+L++ +      A +G  P
Sbjct:  207 NDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTP 386          

HSP 5 Score: 91.2781 bits (225), Expect = 6.010e-18
Identity = 46/165 (27.88%), Postives = 80/165 (48.48%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A + G +++A+ +++KK +      NG+ PLH  C    + +++LLL     I   T  G+ PIH A   GH  I  +L+      +    +G T++H AA +G  EVV+ L++     + + KD   P+ I+   G  +IV+ L+            G  P
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTP 518          

HSP 6 Score: 90.8929 bits (224), Expect = 6.486e-18
Identity = 59/211 (27.96%), Postives = 101/211 (47.87%), Query Frame = 2
Query:   35 NYCNLILIRMSESEIFKDFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N   L+L R +      DF  +N++  +   S   N N++  ++D    I   TR    P+H     G  ++ E ++++        KNG  PLH      HL+ VQLLL  +  ++  TND +  +H A   GH+++AK L+ K    + +   G+T +H A     I V++LL++   +     + G  PI +A   GH+ IV  L+++
Sbjct:  232 NVATLLLNRAAAV----DFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH 438          

HSP 7 Score: 90.5077 bits (223), Expect = 1.043e-17
Identity = 42/152 (27.63%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIA  K   ++A  ++    +     + G   +H     GH+D+V LLLS++  +N     G+ P+H A       +A+ L+ +   +D QTK G+T +H     G+I++V  L++     + + K+G   +  A   GH  I+ +L+ N
Sbjct:  617 PLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQN 768          

HSP 8 Score: 89.7373 bits (221), Expect = 1.514e-17
Identity = 39/148 (26.35%), Postives = 79/148 (53.38%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            +H+A  +G  +M   ++++  N   SNK+G  PLH       +++ ++L+++   ++ QT  G  P+H  C  G+ +I   L+     ++ +TK G+T++H AA  GH  ++ +L++   + +    +G   + IA   G+I +V  L
Sbjct:  651 VHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 9 Score: 88.5817 bits (218), Expect = 3.503e-17
Identity = 107/502 (21.31%), Postives = 204/502 (40.64%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIE-EKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVME----PLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYD-KEVWDRAKKD------AEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADC 1651
            +HIA  K   + A  ++    N +  +K+G+ PLH     G++++  LLL++   ++    + + P+H A   G+  + K L+ +   +D +T+ G T +H  A +GH +VV++L+++      + K+G  P+ +A    H+  V+LL+ + N+      D V       +H+   C    G  + +K +     + +    + F    T + I  +K RI V+E   ++                  IQ V E    P++     G   I    ++              +SP T N     V+    E A+  ++R    ++++  + D  +V  +AK D      + +  + +I+ ++  +    ++   +  + LH A  + + D+  ++LD+   A   +   +  T L  A          +L Q +   +   K   T LH A           L+D           G T LH A  K   D+   LL  GAD 
Sbjct:  189 LHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH-NVPV----DDVTNDYLTALHVAAHC----GHYKVAKVLLDKKASPNAKALNGF----TPLHIACKKNRIRVMELLLKHGA---------------SIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG------------ASPNTTN-----VRG---ETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDH--GASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADA 640          

HSP 10 Score: 88.1965 bits (217), Expect = 4.080e-17
Identity = 42/148 (28.38%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            A   G  E A   +    +    N+NG   LH     GH+++V  LL ++  ++  T  G   +H A   G  E+ K L+     ++ Q++ G+T ++ AA   H+EVV+ L++   +  +  +DG  P+ +A   GH ++V LL+ N
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 178          

HSP 11 Score: 86.2705 bits (212), Expect = 1.843e-16
Identity = 40/166 (24.10%), Postives = 76/166 (45.78%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   +++   +   +N  G   LH    +G  ++V+ L+    ++  +  D   P+H +   G  +I ++L+ +    +  T  G+T +H AA  GH +V   L++   +  I  K G  P+ +A  YG +E+  LL+          + G+ P
Sbjct:  419 PIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTP 584          

HSP 12 Score: 85.5001 bits (210), Expect = 2.768e-16
Identity = 49/210 (23.33%), Postives = 99/210 (47.14%), Query Frame = 2
Query:   50 ILIRMSESEIFKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVAP 676
            I  R+ +++I +  + Q         ++PN        T+   P+H+A  +G  ++A F+++   +   + K G+ PLH     G L++  LLL K    +     G+ P+H A    + ++A  L+ +        K G+T +H AA    +++   L+E   + +   + G   + +A   GH+++V LL++ N N++    + G+ P
Sbjct:  488 ISARLGKADIVQQLLQQG--------ASPNAAT-----TSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLS-NKSGLTP 683          

HSP 13 Score: 84.3445 bits (207), Expect = 6.243e-16
Identity = 47/194 (24.23%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIE-----------------------------KKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A  +G  E+   ++ ++ N + + K G   LH     G  ++V++L++    +N Q+ +G  P++ A    H E+ + L+       + T+ G+T +  A   GH +VV LL+E                                N D++ K G  P+ IA  YG+I +  LL+N        AR+ + P
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITP 254          

HSP 14 Score: 83.1889 bits (204), Expect = 1.384e-15
Identity = 38/125 (30.40%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            GHL+     +    ++N    +G+  +H A   GH E+  EL+ ++  +D  TK+G T++H A+  G  EVVK+L+    N + Q ++G  P+ +A    H+E+V+ L++N         DG  P
Sbjct:   35 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTP 159          

HSP 15 Score: 80.8777 bits (198), Expect = 7.096e-15
Identity = 51/197 (25.89%), Postives = 92/197 (46.70%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKN 769
            P+++A  +   E+  F+++   +   + ++G+ PL      GH  +V LLL  D +   +    +  +H A      + A  L+  D   D+++K G+T +H AA  G+I V  LL+ +    D   ++   P+ +A   G+  +VKLL++         RDG+ P   G     ++ +E L  +  S  I S  KN
Sbjct:  126 PLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML--LDRSAPILSKTKN 316          

HSP 16 Score: 80.8777 bits (198), Expect = 7.465e-15
Identity = 47/177 (26.55%), Postives = 80/177 (45.20%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPS--VAGEIHLD 703
            P+HI+   G  ++ + ++ +  +   +  +G+ PLH     GH D+   LL     ++  T  G  P+H A   G  E+A  L+ K    D   K G T +H AA   + +V  LL+++  +     K+G  P+ IA     ++I   L+     +    R G+A     A E H+D
Sbjct:  485 PLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVD 661          

HSP 17 Score: 67.3958 bits (163), Expect = 9.358e-11
Identity = 41/133 (30.83%), Postives = 65/133 (48.87%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLL 526
            +N NL NK     +   P+H+A  +    +AE +VN+  + +   K G+ PLH  C  G++ IV  LL    ++N +T +G   +H A   GH  I   L+  +   +  T  G T++  A   G+I VV  L
Sbjct:  671 ANVNLSNK-----SGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 18 Score: 56.9954 bits (136), Expect = 1.542e-7
Identity = 34/107 (31.78%), Postives = 54/107 (50.47%), Query Frame = 2
Query:  389 ACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLD 703
            A   GH E A + I     ++I  + G  ++H A+  GH+EVV  L++++ N D   K G   + IA   G  E+VK+L+ N       +++G  P    A E HL+
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLE 137          

HSP 19 Score: 51.9878 bits (123), Expect = 5.550e-6
Identity = 71/302 (23.51%), Postives = 127/302 (42.05%), Query Frame = 2
Query: 1379 TALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGAD-----CTRYI----------ENIPQFMLDSKETILPLTTKENALTLCIKI-HGTIYSCFL---DNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETIFLFPF----KEKWFDFADKLVN 2215
            T +  A  + H   +  L  +    NT N   ET+LH A  SG     +YL+ +  +++       T LH +   G  D+ ++LL++GA       + Y           E++  F+LD   + L +TTK+    L +   +G +    L    + S +A G     +    +H+AA     +V L LL+ G           T L   +  K NQ          + +   L+E+G+D N ++  G + + LA+      ++  L+S++  + N++    L P     +E   + A+ LVN
Sbjct:  418 TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK----SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH--IAAKKNQ----------MDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANV-NLSNKSGLTPLHLAAQEDRVNVAEVLVN 701          
BLAST of SMED30023739 vs. Ensembl Mouse
Match: Ank3 (ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:88026])

HSP 1 Score: 105.916 bits (263), Expect = 1.539e-22
Identity = 57/174 (32.76%), Postives = 84/174 (48.28%), Query Frame = 2
Query:  164 TTNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TTN R    +H+A   G  E+  ++V      E   K+   PLH     G  DIVQ LL +    N  T  G  P+H A   GH ++A  L+     L I TK+G+T +H AA  G +EV  LL++K  + D   K G  P+ +A  Y + ++  LL++        A++G  P
Sbjct:  444 TTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTP 617          

HSP 2 Score: 96.6709 bits (239), Expect = 1.173e-19
Identity = 52/197 (26.40%), Postives = 95/197 (48.22%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKN 769
            P+H+A   G  E+A  ++ K  + + + K+G  PLH      +  +  LLL +    +    +G  P+H A      +IA  L+      +  T+QG  S+H AA  GH+++V LL+ +  N ++ +K G  P+ +A     + + ++L+N         + G  P   G  + + K + FL  +QHS ++ +  KN
Sbjct:  551 PLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFL--LQHSAKVNAKTKN 745          

HSP 3 Score: 93.2041 bits (230), Expect = 1.544e-18
Identity = 46/167 (27.54%), Postives = 88/167 (52.69%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            L+N+   +    R    P+H+A  +G   M + ++++    +   ++G  PLH    +GH  +V++LL +   I  +T +G+ P+H A    H    + L+  +  +D  T    T++H AA  GH +V K+L++KK + + +  +G  P+ IAC    I +++LL+
Sbjct:  237 LLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLL 403          

HSP 4 Score: 92.8189 bits (229), Expect = 1.625e-18
Identity = 46/180 (25.56%), Postives = 92/180 (51.11%), Query Frame = 2
Query:  137 NLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N  N  ++  +   P+HIA + G   +A  ++N+    +++ +N   PLH     G+ ++V+LLL +  +I+ +T DG+ P+H    +GH ++ + L+ +   +  +TK G + +H A    H+  V+LL++     D    D    + +A   GH ++ K+L++ +      A +G  P
Sbjct:  207 NDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTP 386          

HSP 5 Score: 91.2781 bits (225), Expect = 5.794e-18
Identity = 46/165 (27.88%), Postives = 80/165 (48.48%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A + G +++A+ +++KK +      NG+ PLH  C    + +++LLL     I   T  G+ PIH A   GH  I  +L+      +    +G T++H AA +G  EVV+ L++     + + KD   P+ I+   G  +IV+ L+            G  P
Sbjct:  354 LHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTP 518          

HSP 6 Score: 90.8929 bits (224), Expect = 6.253e-18
Identity = 59/211 (27.96%), Postives = 101/211 (47.87%), Query Frame = 2
Query:   35 NYCNLILIRMSESEIFKDFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N   L+L R +      DF  +N++  +   S   N N++  ++D    I   TR    P+H     G  ++ E ++++        KNG  PLH      HL+ VQLLL  +  ++  TND +  +H A   GH+++AK L+ K    + +   G+T +H A     I V++LL++   +     + G  PI +A   GH+ IV  L+++
Sbjct:  232 NVATLLLNRAAAV----DFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHNVPVDDVTNDYLTALHVAAHCGHYKVAKVLLDKKASPNAKALNGFTPLHIACKKNRIRVMELLLKHGASIQAVTESGLTPIHVAAFMGHVNIVSQLMHH 438          

HSP 7 Score: 90.1225 bits (222), Expect = 1.049e-17
Identity = 42/152 (27.63%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIA  K   ++A  ++    +     + G   +H     GH+D+V LLLS++  +N     G+ P+H A       +A+ L+ +   +D QTK G+T +H     G+I++V  L++     + + K+G   +  A   GH  I+ +L+ N
Sbjct:  617 PLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQN 768          

HSP 8 Score: 89.7373 bits (221), Expect = 1.435e-17
Identity = 39/148 (26.35%), Postives = 79/148 (53.38%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            +H+A  +G  +M   ++++  N   SNK+G  PLH       +++ ++L+++   ++ QT  G  P+H  C  G+ +I   L+     ++ +TK G+T++H AA  GH  ++ +L++   + +    +G   + IA   G+I +V  L
Sbjct:  651 VHLAAQEGHVDMVSLLLSRNANVNLSNKSGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 9 Score: 88.9669 bits (219), Expect = 2.575e-17
Identity = 107/502 (21.31%), Postives = 204/502 (40.64%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIE-EKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVME----PLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYD-KEVWDRAKKD------AEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADC 1651
            +HIA  K   + A  ++    N +  +K+G+ PLH     G++++  LLL++   ++    + + P+H A   G+  + K L+ +   +D +T+ G T +H  A +GH +VV++L+++      + K+G  P+ +A    H+  V+LL+ + N+      D V       +H+   C    G  + +K +     + +    + F    T + I  +K RI V+E   ++                  IQ V E    P++     G   I    ++              +SP T N     V+    E A+  ++R    ++++  + D  +V  +AK D      + +  + +I+ ++  +    ++   +  + LH A  + + D+  ++LD+   A   +   +  T L  A          +L Q +   +   K   T LH A           L+D           G T LH A  K   D+   LL  GAD 
Sbjct:  189 LHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEMLLDRSAPILSKTKNGLSPLHMATQGDHLNCVQLLLQH-NVPV----DDVTNDYLTALHVAAHC----GHYKVAKVLLDKKASPNAKALNGF----TPLHIACKKNRIRVMELLLKHGA---------------SIQAVTESGLTPIHVAAFMGHVNIVSQLMHHG------------ASPNTTN-----VRG---ETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDH--GASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADA 640          

HSP 10 Score: 88.5817 bits (218), Expect = 4.035e-17
Identity = 42/148 (28.38%), Postives = 74/148 (50.00%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            A   G  E A   +    +    N+NG   LH     GH+++V  LL ++  ++  T  G   +H A   G  E+ K L+     ++ Q++ G+T ++ AA   H+EVV+ L++   +  +  +DG  P+ +A   GH ++V LL+ N
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLEN 178          

HSP 11 Score: 86.2705 bits (212), Expect = 1.839e-16
Identity = 40/166 (24.10%), Postives = 76/166 (45.78%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   +++   +   +N  G   LH    +G  ++V+ L+    ++  +  D   P+H +   G  +I ++L+ +    +  T  G+T +H AA  GH +V   L++   +  I  K G  P+ +A  YG +E+  LL+          + G+ P
Sbjct:  419 PIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTP 584          

HSP 12 Score: 85.5001 bits (210), Expect = 2.832e-16
Identity = 49/210 (23.33%), Postives = 99/210 (47.14%), Query Frame = 2
Query:   50 ILIRMSESEIFKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVAP 676
            I  R+ +++I +  + Q         ++PN        T+   P+H+A  +G  ++A F+++   +   + K G+ PLH     G L++  LLL K    +     G+ P+H A    + ++A  L+ +        K G+T +H AA    +++   L+E   + +   + G   + +A   GH+++V LL++ N N++    + G+ P
Sbjct:  488 ISARLGKADIVQQLLQQG--------ASPNAAT-----TSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANVNLS-NKSGLTP 683          

HSP 13 Score: 84.3445 bits (207), Expect = 6.280e-16
Identity = 47/194 (24.23%), Postives = 85/194 (43.81%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIE-----------------------------KKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A  +G  E+   ++ ++ N + + K G   LH     G  ++V++L++    +N Q+ +G  P++ A    H E+ + L+       + T+ G+T +  A   GH +VV LL+E                                N D++ K G  P+ IA  YG+I +  LL+N        AR+ + P
Sbjct:   61 LHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITP 254          

HSP 14 Score: 83.5741 bits (205), Expect = 1.312e-15
Identity = 38/125 (30.40%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            GHL+     +    ++N    +G+  +H A   GH E+  EL+ ++  +D  TK+G T++H A+  G  EVVK+L+    N + Q ++G  P+ +A    H+E+V+ L++N         DG  P
Sbjct:   35 GHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLDNGASQSLATEDGFTP 159          

HSP 15 Score: 81.2629 bits (199), Expect = 6.902e-15
Identity = 51/197 (25.89%), Postives = 92/197 (46.70%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKN 769
            P+++A  +   E+  F+++   +   + ++G+ PL      GH  +V LLL  D +   +    +  +H A      + A  L+  D   D+++K G+T +H AA  G+I V  LL+ +    D   ++   P+ +A   G+  +VKLL++         RDG+ P   G     ++ +E L  +  S  I S  KN
Sbjct:  126 PLYMAAQENHLEVVRFLLDNGASQSLATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVR----LPALHIAARKDDTKAAALLLQNDTNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFTARNDITPLHVASKRGNANMVKLLLDRGAKIDAKTRDGLTPLHCGARSGHEQVVEML--LDRSAPILSKTKN 316          

HSP 16 Score: 80.8777 bits (198), Expect = 7.385e-15
Identity = 47/177 (26.55%), Postives = 80/177 (45.20%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPS--VAGEIHLD 703
            P+HI+   G  ++ + ++ +  +   +  +G+ PLH     GH D+   LL     ++  T  G  P+H A   G  E+A  L+ K    D   K G T +H AA   + +V  LL+++  +     K+G  P+ IA     ++I   L+     +    R G+A     A E H+D
Sbjct:  485 PLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGASLSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMDIATSLLEYGADANAVTRQGIASVHLAAQEGHVD 661          

HSP 17 Score: 67.781 bits (164), Expect = 9.108e-11
Identity = 41/133 (30.83%), Postives = 65/133 (48.87%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLL 526
            +N NL NK     +   P+H+A  +    +AE +VN+  + +   K G+ PLH  C  G++ IV  LL    ++N +T +G   +H A   GH  I   L+  +   +  T  G T++  A   G+I VV  L
Sbjct:  671 ANVNLSNK-----SGLTPLHLAAQEDRVNVAEVLVNQGAHVDAQTKMGYTPLHVGCHYGNIKIVNFLLQHSAKVNAKTKNGYTALHQAAQQGHTHIINVLLQNNASPNELTVNGNTALAIARRLGYISVVDTL 798          

HSP 18 Score: 56.9954 bits (136), Expect = 1.439e-7
Identity = 34/107 (31.78%), Postives = 54/107 (50.47%), Query Frame = 2
Query:  389 ACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLD 703
            A   GH E A + I     ++I  + G  ++H A+  GH+EVV  L++++ N D   K G   + IA   G  E+VK+L+ N       +++G  P    A E HL+
Sbjct:   31 AARAGHLEKALDYIKNGVDVNICNQNGLNALHLASKEGHVEVVSELLQREANVDAATKKGNTALHIASLAGQAEVVKVLVTNGANVNAQSQNGFTPLYMAAQENHLE 137          

HSP 19 Score: 51.9878 bits (123), Expect = 4.641e-6
Identity = 71/302 (23.51%), Postives = 127/302 (42.05%), Query Frame = 2
Query: 1379 TALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGAD-----CTRYI----------ENIPQFMLDSKETILPLTTKENALTLCIKI-HGTIYSCFL---DNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETIFLFPF----KEKWFDFADKLVN 2215
            T +  A  + H   +  L  +    NT N   ET+LH A  SG     +YL+ +  +++       T LH +   G  D+ ++LL++GA       + Y           E++  F+LD   + L +TTK+    L +   +G +    L    + S +A G     +    +H+AA     +V L LL+ G           T L   +  K NQ          + +   L+E+G+D N ++  G + + LA+      ++  L+S++  + N++    L P     +E   + A+ LVN
Sbjct:  418 TPIHVAAFMGHVNIVSQLMHHGASPNTTNVRGETALHMAARSGQAEVVRYLVQDGAQVEAKAKDDQTPLHISARLGKADIVQQLLQQGASPNAATTSGYTPLHLAAREGHEDVAAFLLDHGAS-LSITTKKGFTPLHVAAKYGKLEVASLLLQKSASPDAAGK----SGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLH--IAAKKNQ----------MDIATSLLEYGADANAVTRQGIASVHLAAQEGHVDMVSLLLSRNANV-NLSNKSGLTPLHLAAQEDRVNVAEVLVN 701          
BLAST of SMED30023739 vs. UniProt/SwissProt
Match: sp|P16157|ANK1_HUMAN (Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=3)

HSP 1 Score: 102.449 bits (254), Expect = 1.499e-20
Identity = 56/183 (30.60%), Postives = 94/183 (51.37%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            ++PN+ N  ++      P+H+A   G  E+A++++  K       K+   PLH     GH ++V+LLL  +   N  T  G  P+H A   GH E    L+ K+      TK+G+T +H AA  G + V +LL+E+  + +   K+G  P+ +A  + +++IVKLL+        PA +G  P
Sbjct:  428 ASPNVSNVKVET-----PLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTP 605          

HSP 2 Score: 97.4413 bits (241), Expect = 5.028e-19
Identity = 55/191 (28.80%), Postives = 96/191 (50.26%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQI 751
            P+H+A   G   +AE ++ +  +   + KNG  PLH    + +LDIV+LLL +    +    +G  P+H A      E+A+ L+      + ++ QG T +H AA  GH E+V LL+ K+ N ++ +K G  P+ +    GH+ +  +LI +  +     R G  P      + + K ++FL  +QH   +
Sbjct:  539 PLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFL--LQHQADV 727          

HSP 3 Score: 97.0561 bits (240), Expect = 6.215e-19
Identity = 53/163 (32.52%), Postives = 84/163 (51.53%), Query Frame = 2
Query:  149 KIIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +I DIT +   P+H+A + G   +A+ +++K         NG+ PLH  C   H+ +++LLL     I+  T  G+ P+H A   GH  I K L+ +    ++   +  T +H AA  GH EV K L++ K   + + KD   P+  A   GH  +VKLL+ N
Sbjct:  330 EIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLEN 492          

HSP 4 Score: 96.6709 bits (239), Expect = 7.554e-19
Identity = 53/166 (31.93%), Postives = 79/166 (47.59%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + E ++    + +   ++G  PLH     GHL IV+ LL +    N        P+H A   GH E+AK L+     ++ + K   T +H AA  GH  +VKLL+E   N ++    G  P+ IA   GH+E V  L+  +    C  + G  P
Sbjct:  374 PLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTP 539          

HSP 5 Score: 96.2857 bits (238), Expect = 1.174e-18
Identity = 53/182 (29.12%), Postives = 95/182 (52.20%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            NP++++K     T   P+HIA +     +A+ ++N+  +  ++ +NG  PLH     G++ +V+LLL +  +I  +T D + P+H A  NGH  I++ L+     +  +TK G + IH AA   H++ V+LL++     D    D   P+ +A   GH  + K+L++        A +G  P
Sbjct:  198 NPDVLSK-----TGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTP 374          

HSP 6 Score: 95.5153 bits (236), Expect = 1.953e-18
Identity = 52/166 (31.33%), Postives = 83/166 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA  +   E+A  ++    +    +  G  PLH     GH ++V LLLSK    N     G+ P+H     GH  +A  LI    ++D  T+ G+T +H A+  G+I++VK L++ + + + + K G  P+  A   GH +IV LL+ N       + DG  P
Sbjct:  605 PLHIAAKQNQVEVARSLLQYGGSANAESVQGVTPLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTP 770          

HSP 7 Score: 95.1301 bits (235), Expect = 2.742e-18
Identity = 53/167 (31.74%), Postives = 86/167 (51.50%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            L+++   I T T+    P+H A   G   ++E +++     +   KNG  P+H      HLD V+LLL  D EI+  T D + P+H A   GH  +AK L+ K    + +   G+T +H A    H+ V++LL++   + D   + G  P+ +A   GH+ IVK L+
Sbjct:  258 LLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLLKTGASIDAVTESGLTPLHVASFMGHLPIVKNLL 424          

HSP 8 Score: 92.0485 bits (227), Expect = 2.116e-17
Identity = 47/150 (31.33%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+HIA  +G   M   ++++    E   K+   PLH    NGH+ I ++LL     I  +T +G+ PIH A    H +  + L+  D  +D  T    T +H AA  GH  V K+L++K    + +  +G  P+ IAC   H+ +++LL+
Sbjct:  242 PLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLLQYDAEIDDITLDHLTPLHVAAHCGHHRVAKVLLDKGAKPNSRALNGFTPLHIACKKNHVRVMELLL 391          

HSP 9 Score: 90.8929 bits (224), Expect = 4.462e-17
Identity = 44/149 (29.53%), Postives = 79/149 (53.02%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  EM   +++K+ N    NK+G  PLH     GH+ +  +L+     ++  T  G  P+H A   G+ ++ K L+     ++ +TK G++ +H AA  GH ++V LL++   + +    DG  P+ IA   G+I +  +L
Sbjct:  638 PLHLAAQEGHAEMVALLLSKQANGNLGNKSGLTPLHLVAQEGHVPVADVLIKHGVMVDATTRMGYTPLHVASHYGNIKLVKFLLQHQADVNAKTKLGYSPLHQAAQQGHTDIVTLLLKNGASPNEVSSDGTTPLAIAKRLGYISVTDVL 786          

HSP 10 Score: 87.8113 bits (216), Expect = 4.362e-16
Identity = 54/201 (26.87%), Postives = 92/201 (45.77%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFL---GGIQHS 742
            ID  T +   P+H+A   G   + + ++ +  +   SN     PLH     GH ++ + LL    ++N +  D   P+H A   GH  + K L+  +   ++ T  G T +H AA  GH+E V  L+EK+ +     K G  P+ +A  YG + + +LL+          ++G+ P      H +   ++ L   GG  HS
Sbjct:  397 IDAVTESGLTPLHVASFMGHLPIVKNLLQRGASPNVSNVKVETPLHMAARAGHTEVAKYLLQNKAKVNAKAKDDQTPLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHS 597          

HSP 11 Score: 81.6481 bits (200), Expect = 3.483e-14
Identity = 42/124 (33.87%), Postives = 67/124 (54.03%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            N+NG   LH     GH+ +V  LL K+  +   T  G   +H A   G  E+ +EL+     ++ Q+++G+T ++ AA   H+EVVK L+E   N ++  +DG  P+ +A   GH  +V  LIN
Sbjct:   42 NQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLIN 165          

HSP 12 Score: 79.337 bits (194), Expect = 1.801e-13
Identity = 44/168 (26.19%), Postives = 86/168 (51.19%), Query Frame = 2
Query:  137 NLINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            N++  +I+  T  +     +HIA        A  ++    N +  +K G+ PLH      +L++ QLLL++   +N    +G+ P+H A   G+  + + L+ +   ++ +TK   T +H AA NGH+ + ++L++       + K+G  PI +A    H++ V+LL+
Sbjct:  158 NVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLDRGAQIETKTKDELTPLHCAARNGHVRISEILLDHGAPIQAKTKNGLSPIHMAAQGDHLDCVRLLL 325          

HSP 13 Score: 77.411 bits (189), Expect = 6.690e-13
Identity = 44/166 (26.51%), Postives = 75/166 (45.18%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G   M + ++    N   +   G  PLH     GH++ V  LL K+    C T  G  P+H A   G   +A+ L+ +D   +   K G T +H A  + ++++VKLL+ +  +      +G  P+ IA     +E+ + L+     +   +  GV P
Sbjct:  473 PLHCAARIGHTNMVKLLLENNANPNLATTAGHTPLHIAAREGHVETVLALLEKEASQACMTKKGFTPLHVAAKYGKVRVAELLLERDAHPNAAGKNGLTPLHVAVHHNNLDIVKLLLPRGGSPHSPAWNGYTPLHIAAKQNQVEVARSLLQYGGSANAESVQGVTP 638          

HSP 14 Score: 77.0258 bits (188), Expect = 7.992e-13
Identity = 43/129 (33.33%), Postives = 69/129 (53.49%), Query Frame = 2
Query:  299 NGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN---NQNISFCPARDGVAP 676
            +G+LD     L    +IN    +G+  +H A   GH ++  EL+ K+ +L+  TK+G T++H AA  G  EVV+ L+    N + Q + G  P+ +A    H+E+VK L+    NQN++     DG  P
Sbjct:   22 SGNLDKALDHLRNGVDINTCNQNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVA---TEDGFTP 147          

HSP 15 Score: 70.4774 bits (171), Expect = 8.402e-11
Identity = 55/218 (25.23%), Postives = 92/218 (42.20%), Query Frame = 2
Query:   98 QNNLKGIMDLSNP-------NLINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELI-----------------------------AKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            QN L G+   S          L++K I + T T+     +HIA   G  E+   +VN   N    ++ G+ PL+      HL++V+ LL      N  T DG  P+  A   GH  +   LI                               D   D+ +K G+T +H AA   ++ V +LL+ +  + +   ++G  P+ IA   G++ +V+LL++
Sbjct:   43 QNGLNGLHLASKEGHVKMVVELLHKEIILETTTKKGNTALHIAALAGQDEVVRELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQNVATEDGFTPLAVALQQGHENVVAHLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLNVAQLLLNRGASVNFTPQNGITPLHIASRRGNVIMVRLLLD 260          
BLAST of SMED30023739 vs. UniProt/SwissProt
Match: sp|O75832|PSD10_HUMAN (26S proteasome non-ATPase regulatory subunit 10 OS=Homo sapiens OX=9606 GN=PSMD10 PE=1 SV=1)

HSP 1 Score: 93.5893 bits (231), Expect = 5.347e-20
Identity = 47/150 (31.33%), Postives = 81/150 (54.00%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            +H AC+ G  E+ EF++         +  GW PLH   + G  +IV+ LL K  ++N    +G  P+H+A +    EIA  L+      D +     T++H AA  G+++++ +L+  K +T+IQD +G  P+ +AC    +E  KLL++
Sbjct:   44 LHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVS 193          

HSP 2 Score: 71.633 bits (174), Expect = 1.912e-12
Identity = 39/147 (26.53%), Postives = 74/147 (50.34%), Query Frame = 2
Query:  188 IACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +A +    E+ E ++  K     ++++    LH  C+ GH +IV+ LL     +N + + G  P+H A + G  EI K L+ K   ++   + G T +H+AA     E+  +L+E   N D +D      +  A A G+++++ +L+
Sbjct:   13 LAYSGKLEELKESILADKSLATRTDQDSRTALHWACSAGHTEIVEFLLQLGVPVNDKDDAGWSPLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILL 159          

HSP 3 Score: 60.8474 bits (146), Expect = 8.873e-9
Identity = 35/137 (25.55%), Postives = 66/137 (48.18%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIA 589
            P+HIA + G  E+ + ++ K       N+NG  PLH+  +    +I  +LL      + + +     +H A A G+ ++   L+      +IQ  +G T +H A     +E  KLL+ +  +  I++K+   P+ +A
Sbjct:   76 PLHIAASAGRDEIVKALLGKGAQVNAVNQNGCTPLHYAASKNRHEIAVMLLEGGANPDAKDHYEATAMHRAAAKGNLKMIHILLYYKASTNIQDTEGNTPLHLACDEERVEEAKLLVSQGASIYIENKEEKTPLQVA 212          
BLAST of SMED30023739 vs. UniProt/SwissProt
Match: sp|P57078|RIPK4_HUMAN (Receptor-interacting serine/threonine-protein kinase 4 OS=Homo sapiens OX=9606 GN=RIPK4 PE=1 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.025e-19
Identity = 47/154 (30.52%), Postives = 77/154 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSK-DCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            P+H+AC  G   +   ++ +  +     K+ W PLH+    GHL IV+LL  +    +N QT DG  P+H A   GH+ +A+ LI     +++ +    T +H AA  GH    +LL+ +    +    DG   + +A   GH+  VKLL+  +
Sbjct:  588 PMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTPLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEK 741          

HSP 2 Score: 78.9518 bits (193), Expect = 1.617e-13
Identity = 52/198 (26.26%), Postives = 93/198 (46.97%), Query Frame = 2
Query:   86 DFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISF-CPARDGVAP 676
            D ++  +   +M +  P  ++  +D  +    +H+A   G  E A++++    N   SN+ G  PLH         +V+LLL++   +N +  D    +HFA  NG     + L+ K+  ++    +G T +H A  +G   +V++L+ +  +  +Q KD   P+  A   GH+ IVKLL     +S      DG  P
Sbjct:  460 DAIVSGDTSKLMKILQPQDVDLALD--SGASLLHLAVEAGQEECAKWLLLNNANPNLSNRRGSTPLHMAVERRVRGVVELLLARKISVNAKDEDQWTALHFAAQNGDESSTRLLLEKNASVNEVDFEGRTPMHVACQHGQENIVRILLRRGVDVSLQGKDAWLPLHYAAWQGHLPIVKLLAKQPGVSVNAQTLDGRTP 655          

HSP 3 Score: 75.0998 bits (183), Expect = 2.303e-12
Identity = 44/163 (26.99%), Postives = 75/163 (46.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL------INNQNISF 649
            P+H+A  +G + +A  +++   +    +     PLH     GH    +LLL +       T+DG   +H A  NGH    K L+ +   +  +     T++H AA +GH EVV+ L+      D+ D+ G   + +A    H + V+ L      IN Q++ F
Sbjct:  655 PLHLAAQRGHYRVARILIDLCSDVNVCSLLAQTPLHVAAETGHTSTARLLLHRGAGKEAMTSDGYTALHLAARNGHLATVKLLVEEKADVLARGPLNQTALHLAAAHGHSEVVEELVSADV-IDLFDEQGLSALHLAAQGRHAQTVETLLRHGAHINLQSLKF 816          
BLAST of SMED30023739 vs. UniProt/SwissProt
Match: sp|Q8C8R3|ANK2_MOUSE (Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2)

HSP 1 Score: 98.9821 bits (245), Expect = 1.808e-19
Identity = 56/196 (28.57%), Postives = 104/196 (53.06%), Query Frame = 2
Query:   89 FVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
             +LQN+     D+ +  ++N+  +  +   P+HIA + G   +A  ++N+    +++ +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH ++ + L+ +   L  +TK G + +H AA   H+E VK L++ K   D    D    + +A   GH  + KLL++ +      A +G  P
Sbjct:  210 LLLQNDHNA--DVQSKMMVNRTTE--SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 401          

HSP 2 Score: 94.3597 bits (233), Expect = 4.464e-18
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H+A  +G   M + ++++    +   ++G  PLH    +GH  +V+LLL +   +  +T +G+ P+H A    H E  K L+     +D  T    T++H AA  GH  V KLL++K+ N + +  +G  P+ IAC    I++++LL+
Sbjct:  269 PLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLV 418          

HSP 3 Score: 88.9669 bits (219), Expect = 1.875e-16
Identity = 47/166 (28.31%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  ++ K  +   + KNG+ PLH       + I   LL+   E N  T  G+ P+H A   GH ++   L+ K   + + TK G TS+H AA    + V  +L +   + D   K G  P+++AC YG++++V  L+          ++G  P
Sbjct:  599 PLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTP 764          

HSP 4 Score: 86.6557 bits (213), Expect = 1.194e-15
Identity = 53/189 (28.04%), Postives = 88/189 (46.56%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCLEFLGGIQHS 742
            +H+A + G + + + +++K+ N      NG+ PLH  C    + +++LL+     I   T  G+ PIH A   GH  I   L+      D+   +G T++H AA  G +EVV+ L+      D + ++   P+ IA   G  EIV+LL+ +         +G  P    A E  +D   +    G  HS
Sbjct:  369 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHS 557          

HSP 5 Score: 82.0333 bits (201), Expect = 3.090e-14
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N+NG   LH     GH+ +VQ LL +   ++  T  G   +H A   G  E+ K L+ +   ++ Q++ G+T ++ AA   HI+VVK L+E   N     +DG  P+ +A   GH + V +L+ N
Sbjct:   61 NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN 185          

HSP 6 Score: 80.1073 bits (196), Expect = 1.145e-13
Identity = 41/125 (32.80%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+LD V   L    +IN    +G+  +H A   GH  + +EL+ +   +D  TK+G T++H A+  G  EVVK+L+++  N + Q ++G  P+ +A    HI++VK L+ N         DG  P
Sbjct:   42 GNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTP 166          

HSP 7 Score: 80.1073 bits (196), Expect = 1.194e-13
Identity = 45/152 (29.61%), Postives = 72/152 (47.37%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIA  K   ++A  ++N         K G  PLH     GH D+V LLL K   I+  T  G+  +H A       +A  L       D  TK G+T +  A   G++++V  L+++  N + + K+G  P+  A   GH  I+ +L+ +
Sbjct:  632 PLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQH 783          

HSP 8 Score: 79.7221 bits (195), Expect = 1.539e-13
Identity = 47/166 (28.31%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA   G  E+ + ++    + + +  NG+ PLH     G +D+  +LL      +  T  G  P+H A   G  ++AK L+ +    D   K G T +H AA   + +V  LL+EK  +     K+G  P+ IA     ++I   L+N    +    + GV P
Sbjct:  500 PLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTP 665          

HSP 9 Score: 78.9518 bits (193), Expect = 2.598e-13
Identity = 60/241 (24.90%), Postives = 100/241 (41.49%), Query Frame = 2
Query:   86 DFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLH--------------------------------HCCAN-GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            DF  +N +  +   S   N N++  ++D    I   TR    P+H A   G  ++ E ++ +K       KNG  PLH                                H  A+ GH  + +LLL K    N +  +G  P+H AC     ++ + L+     +   T+ G T IH AA  GH+ +V LL++   + D+ +  G   + +A   G +E+V+ L+ N  +    AR+   P
Sbjct:  260 DFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERKAPLLARTKNGLSPLHMAAQGDHVECVKHLLQYKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 500          

HSP 10 Score: 78.5666 bits (192), Expect = 2.850e-13
Identity = 43/166 (25.90%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K   ++ E +V    + +   ++G  P+H     GHL+IV LLL      +     G   +H A   G  E+ + L+    L+D + ++  T +H A+  G  E+V+LL++   + D    +G  P+ I+   G +++  +L+          + G  P
Sbjct:  401 PLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTP 566          

HSP 11 Score: 77.7962 bits (190), Expect = 4.978e-13
Identity = 47/173 (27.17%), Postives = 81/173 (46.82%), Query Frame = 2
Query:  167 TNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TN R    +H+A   G  E+   ++      +   +    PLH     G  +IVQLLL      +  T +G  P+H +   G  ++A  L+       + TK+G+T +H AA  G ++V KLL++++   D   K+G  P+ +A  Y + ++  LL+         A++G  P
Sbjct:  460 TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTP 632          

HSP 12 Score: 77.0258 bits (188), Expect = 9.950e-13
Identity = 41/166 (24.70%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   ++    + + +N  G   LH     G +++V+ LL     ++ +  +   P+H A   G  EI + L+      D  T  G+T +H +A  G ++V  +L+E      +  K G  P+ +A  YG +++ KLL+  +  +    ++G+ P
Sbjct:  434 PIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 599          

HSP 13 Score: 76.2554 bits (186), Expect = 1.597e-12
Identity = 41/156 (26.28%), Postives = 74/156 (47.44%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            T    P+HI+  +G  ++A  ++        + K G+ PLH     G LD+ +LLL +    +    +G+ P+H A    + ++A  L+ K        K G+T +H AA    +++   L+     T+   K G  P+ +A   GH ++V LL++
Sbjct:  528 TNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNTVTKQGVTPLHLASQEGHTDMVTLLLD 683          

HSP 14 Score: 71.633 bits (174), Expect = 4.523e-11
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K  N   S K+G   LH       +++  +L     + +  T  G  P+  AC  G+ ++   L+ +   ++ +TK G+T +H AA  GH  ++ +L++     +    +G   + IA   G+I +V  L
Sbjct:  665 PLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADRDAYTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 15 Score: 68.5514 bits (166), Expect = 3.100e-10
Identity = 49/215 (22.79%), Postives = 88/215 (40.93%), Query Frame = 2
Query:  155 IDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDK--------DGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            IDI T  +     +H+A  +G   + + ++ +  + + + K G   LH     G  ++V++L+ +   IN Q+ +G  P++ A    H ++ K L+         T+ G+T +  A   GH + V +L+E                                N D+Q K         G  P+ IA  YG++ +  LL+N        AR+G+ P
Sbjct:   55 IDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITP 269          
BLAST of SMED30023739 vs. UniProt/SwissProt
Match: sp|Q01484|ANK2_HUMAN (Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=4)

HSP 1 Score: 98.9821 bits (245), Expect = 1.842e-19
Identity = 56/196 (28.57%), Postives = 104/196 (53.06%), Query Frame = 2
Query:   89 FVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
             +LQN+     D+ +  ++N+  +  +   P+HIA + G   +A  ++N+    +++ +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH ++ + L+ +   L  +TK G + +H AA   H+E VK L++ K   D    D    + +A   GH  + KLL++ +      A +G  P
Sbjct:  210 LLLQNDHNA--DVQSKMMVNRTTE--SGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 401          

HSP 2 Score: 94.3597 bits (233), Expect = 4.665e-18
Identity = 46/150 (30.67%), Postives = 82/150 (54.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H+A  +G   M + ++++    +   ++G  PLH    +GH  +V+LLL +   +  +T +G+ P+H A    H E  K L+     +D  T    T++H AA  GH  V KLL++K+ N + +  +G  P+ IAC    I++++LL+
Sbjct:  269 PLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLV 418          

HSP 3 Score: 89.7373 bits (221), Expect = 1.200e-16
Identity = 47/166 (28.31%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  ++ K  +   + KNG+ PLH       + I   LL+   E N  T  G+ P+H A   GH ++   L+ K   + + TK G TS+H AA    + V  +L +   + D   K G  P+++AC YG++++V  L+          ++G  P
Sbjct:  599 PLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTP 764          

HSP 4 Score: 86.2705 bits (212), Expect = 1.369e-15
Identity = 53/189 (28.04%), Postives = 88/189 (46.56%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCLEFLGGIQHS 742
            +H+A + G + + + +++K+ N      NG+ PLH  C    + +++LL+     I   T  G+ PIH A   GH  I   L+      D+   +G T++H AA  G +EVV+ L+      D + ++   P+ IA   G  EIV+LL+ +         +G  P    A E  +D   +    G  HS
Sbjct:  369 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHS 557          

HSP 5 Score: 81.6481 bits (200), Expect = 3.396e-14
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N+NG   LH     GH+ +VQ LL +   ++  T  G   +H A   G  E+ K L+ +   ++ Q++ G+T ++ AA   HI+VVK L+E   N     +DG  P+ +A   GH + V +L+ N
Sbjct:   61 NQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLEN 185          

HSP 6 Score: 80.8777 bits (198), Expect = 7.082e-14
Identity = 45/152 (29.61%), Postives = 72/152 (47.37%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIA  K   ++A  ++N         K G  PLH     GH D+V LLL K   I+  T  G+  +H A       +A  L       D  TK G+T +  A   G++++V  L+++  N + + K+G  P+  A   GH  I+ +L+ +
Sbjct:  632 PLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQH 783          

HSP 7 Score: 79.7221 bits (195), Expect = 1.237e-13
Identity = 41/125 (32.80%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+LD V   L    +IN    +G+  +H A   GH  + +EL+ +   +D  TK+G T++H A+  G  EVVK+L+++  N + Q ++G  P+ +A    HI++VK L+ N         DG  P
Sbjct:   42 GNLDKVVEYLKGGIDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTP 166          

HSP 8 Score: 79.337 bits (194), Expect = 1.935e-13
Identity = 47/166 (28.31%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA   G  E+ + ++    + + +  NG+ PLH     G +D+  +LL      +  T  G  P+H A   G  ++AK L+ +    D   K G T +H AA   + +V  LL+EK  +     K+G  P+ IA     ++I   L+N    +    + GV P
Sbjct:  500 PLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTP 665          

HSP 9 Score: 78.5666 bits (192), Expect = 3.213e-13
Identity = 43/166 (25.90%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K   ++ E +V    + +   ++G  P+H     GHL+IV LLL      +     G   +H A   G  E+ + L+    L+D + ++  T +H A+  G  E+V+LL++   + D    +G  P+ I+   G +++  +L+          + G  P
Sbjct:  401 PLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTP 566          

HSP 10 Score: 78.1814 bits (191), Expect = 4.620e-13
Identity = 42/156 (26.92%), Postives = 75/156 (48.08%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            T    P+HI+  +G  ++A  ++        + K G+ PLH     G LD+ +LLL +    +    +G+ P+H A    + ++A  L+ K        K G+T +H AA    +++   L+     T+I  K G  P+ +A   GH ++V LL++
Sbjct:  528 TNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTPLHIAAKKNQMQIASTLLNYGAETNIVTKQGVTPLHLASQEGHTDMVTLLLD 683          

HSP 11 Score: 77.7962 bits (190), Expect = 5.658e-13
Identity = 47/173 (27.17%), Postives = 81/173 (46.82%), Query Frame = 2
Query:  167 TNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TN R    +H+A   G  E+   ++      +   +    PLH     G  +IVQLLL      +  T +G  P+H +   G  ++A  L+       + TK+G+T +H AA  G ++V KLL++++   D   K+G  P+ +A  Y + ++  LL+         A++G  P
Sbjct:  460 TNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTPLHVAAHYDNQKVALLLLEKGASPHATAKNGYTP 632          

HSP 12 Score: 76.6406 bits (187), Expect = 1.103e-12
Identity = 41/166 (24.70%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   ++    + + +N  G   LH     G +++V+ LL     ++ +  +   P+H A   G  EI + L+      D  T  G+T +H +A  G ++V  +L+E      +  K G  P+ +A  YG +++ KLL+  +  +    ++G+ P
Sbjct:  434 PIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQVDVASVLLEAGAAHSLATKKGFTPLHVAAKYGSLDVAKLLLQRRAAADSAGKNGLTP 599          

HSP 13 Score: 76.2554 bits (186), Expect = 1.799e-12
Identity = 59/241 (24.48%), Postives = 99/241 (41.08%), Query Frame = 2
Query:   86 DFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLH--------------------------------HCCAN-GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            DF  +N +  +   S   N N++  ++D    I   TR    P+H A   G  ++ E ++ +        KNG  PLH                                H  A+ GH  + +LLL K    N +  +G  P+H AC     ++ + L+     +   T+ G T IH AA  GH+ +V LL++   + D+ +  G   + +A   G +E+V+ L+ N  +    AR+   P
Sbjct:  260 DFTARNGITPLHVASKRGNTNMVKLLLDRGGQIDAKTRDGLTPLHCAARSGHDQVVELLLERGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRIKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVTNIRGETALHMAARAGQVEVVRCLLRNGALVDARAREEQTP 500          

HSP 14 Score: 72.4034 bits (176), Expect = 2.638e-11
Identity = 37/149 (24.83%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K  N   S K+G   LH       +++  +L     + +  T  G  P+  AC  G+ ++   L+ +   ++ +TK G+T +H AA  GH  ++ +L++     +    +G   + IA   G+I +V  L
Sbjct:  665 PLHLASQEGHTDMVTLLLDKGANIHMSTKSGLTSLHLAAQEDKVNVADILTKHGADQDAHTKLGYTPLIVACHYGNVKMVNFLLKQGANVNAKTKNGYTPLHQAAQQGHTHIINVLLQHGAKPNATTANGNTALAIAKRLGYISVVDTL 813          

HSP 15 Score: 68.5514 bits (166), Expect = 3.434e-10
Identity = 49/215 (22.79%), Postives = 88/215 (40.93%), Query Frame = 2
Query:  155 IDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDK--------DGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            IDI T  +     +H+A  +G   + + ++ +  + + + K G   LH     G  ++V++L+ +   IN Q+ +G  P++ A    H ++ K L+         T+ G+T +  A   GH + V +L+E                                N D+Q K         G  P+ IA  YG++ +  LL+N        AR+G+ P
Sbjct:   55 IDINTCNQNGLNALHLAAKEGHVGLVQELLGRGSSVDSATKKGNTALHIASLAGQAEVVKVLVKEGANINAQSQNGFTPLYMAAQENHIDVVKYLLENGANQSTATEDGFTPLAVALQQGHNQAVAILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKMMVNRTTESGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITP 269          
BLAST of SMED30023739 vs. TrEMBL
Match: B3EU24 (Uncharacterized protein OS=Amoebophilus asiaticus (strain 5a2) OX=452471 GN=Aasi_1435 PE=4 SV=1)

HSP 1 Score: 161.77 bits (408), Expect = 2.309e-36
Identity = 215/952 (22.58%), Postives = 389/952 (40.86%), Query Frame = 2
Query:  140 LINKIIDITTNTRP----IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETILPLTTKENALTL---CIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKS---HQLNNVTETIFLFPFK----------------------EKW--FDFADKLVNLLCKDFLL---------QNISKEIIQSCLEHDKISLVKSLFDKASD-DVQQSVLEGIIYHAAGTANKEFFLYMIDKDLKCPKXXXXXXXXXXXXXXXRKFEFCKEILSSKNGYKHVRSKNNKSQYPMHVAIDVGDIQMIDELIQESHEFNEEDDNGRTPL--TQLFEKLSTADEVL-----INYVQKDIYSIIQTSTKIKLVLSIKTTIRCGSNIHKVMRSGGTAI 2842
            L+ K  +I   +R     ++ AC +G  E+ +++V K  + + +N++G   LH   +N HL++V+ L+ K  +IN    DG   +H  C N + E+ K L+ K   ++I    GWT +H+A  NG +E+VK L+EK  + ++ D  G   +  AC  G++E+VK L+           D  A    GE  L   C         +K     +K +  DK +        ++I+   + + L FAT  +                     +E +  L D+G  +          KN+ +E   I++            +K  LE+      +G   DI    + +K  W  A   A +   +EI+  + D+   ++ +     + LH A   N+ ++VKY+LD    AD ++ N    TAL FA   +H   + +L +   D N +NK   T+LH+A  +G     +YL+D   +I+  N+   TALHFA       + + LL KGAD                   +    KE   TL   C   H  I    LD  ++    N+++ ++   +H A      E+   LL+ G  ++  N+   TAL     T+ +           + +V+ L++ G+DIN       + L  A+ +    ++  L+ K    H  N  +ET+ ++  K                      ++W    F  +  +L    +LL                +    E+D + +VK L DK +D +V+ +     ++ A    + E   Y++DK         +    L         E  K +L        +  KNN     +H A     ++++  L+ +  + N ++++  T L     ++ L     +L     IN   K+ ++ +  +T+   +  +K  +  G++IH   + G T +
Sbjct:  655 LLEKGANIQAKSRESESLLYWACREGDLEVIKYLVEKGVDIQATNEDGETLLHCAYSNNHLELVKYLVEKGADINITDGDGATLLHCICKNDNIELVKYLVEKGADINITDGDGWTPLHYACENGELEIVKYLVEKGADINVIDGYGVTSLHYACREGNLEVVKYLVE-------KGADINATDEDGETLLHYAC---------NKGNLEVVKLL-VDKGAD-------INIKSNDQCTALHFATRYDH--------------------LEIVKYLLDKGADI--------QAKNKEVETLLIYA-----------CKKGDLEVVKNLVDKG--SDI---NVKNKNQW-TALHFATRYGHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKG--ADINVKNNDQWTALHFATRYNHLEIVKLLLEKGADINAKNKYGNTTLHKACENGHLEVVKYLLDKGADINVKNNDQWTALHFATRYNHLKIVKLLLDKGAD-------------------INAKNKEGNTTLHKACENDHLEIVKLLLDKGADI---NVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWTALH--FATRYDH----------LKIVKYLLDKGADINVKDNDQWTALHFATRYDHLKIVKLLLEKGADIHAKNKESETLLIYACKKGDLELVKYLLDKGADINVKNNDQWTALHFVTRYNHLEIVKYLLDKGADINAKNKYGNTTLHKACENDHLEIVKLLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWIALHFATRYNHLEIVKYLLDKG---ADINVKNNDQWIALHFATRYNHLKIVKLLLDKGADINVKNNDQWTALHFATRYDHLEIVKYLLDKGADINVKNKNQWTALHFATRYNHLKIVKLLLDKGADIHAKNKYGNTPL 1498          

HSP 2 Score: 110.153 bits (274), Expect = 1.817e-20
Identity = 55/167 (32.93%), Postives = 94/167 (56.29%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            LI K +DI    +    P+  AC+KG  E+ +++V K  +   ++++G   LH  C N ++++V+ L+ K  +IN     G+ P+H+AC +G+ E+ K L+ K   +  + K G T  HWA  N H+EVVK L+EK  N   + ++    +  AC  G +E++K L+
Sbjct:  523 LIEKGVDIHAKNKHGNTPLCYACDKGHLEVVKYLVEKGADINATDEDGETLLHCVCKNDNIELVKYLVEKGVDINVIDGYGVTPLHYACRDGNLEVVKYLVEKGADIQAKNKDGETPFHWAHDNDHLEVVKYLLEKGANIQAKSRESESLLYWACREGDLEVIKYLV 689          

HSP 3 Score: 109.383 bits (272), Expect = 3.001e-20
Identity = 57/169 (33.73%), Postives = 93/169 (55.03%), Query Frame = 2
Query:  137 NLINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            NL++K  DI    +     +H A   G  E+ +++++K  +    N + W  LH      HL+IV+ LL K  +IN + ND    +HFA    H EI K L+ K   ++ + K G T++H A  NGH+EVVK L++K  + ++++ D    +  A  Y H++IVKLL++
Sbjct:  918 NLVDKGSDINVKNKNQWTALHFATRYGHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKYLLDKGADINVKNNDQWTALHFATRYNHLEIVKLLLEKGADINAKNKYGNTTLHKACENGHLEVVKYLLDKGADINVKNNDQWTALHFATRYNHLKIVKLLLD 1086          

HSP 4 Score: 107.071 bits (266), Expect = 1.460e-19
Identity = 56/183 (30.60%), Postives = 94/183 (51.37%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            L++K  DI          +H A      E+ +++++K  +    N + W  LH      HL IV+LLL K  +IN + ND    +HFA    H EI K L+ K   ++++ K  WT++H+A    H+++VKLL++K  +   ++K G  P+  AC  GH+E++K L+          ++G  P
Sbjct: 1348 LLDKGADINVKNNDQWIALHFATRYNHLEIVKYLLDKGADINVKNNDQWIALHFATRYNHLKIVKLLLDKGADINVKNNDQWTALHFATRYDHLEIVKYLLDKGADINVKNKNQWTALHFATRYNHLKIVKLLLDKGADIHAKNKYGNTPLHKACENGHLEVIKYLVEKGADINAKNKNGNTP 1530          

HSP 5 Score: 104.375 bits (259), Expect = 1.031e-18
Identity = 58/166 (34.94%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            L++K  DI          +H A      E+ +++++K  +    NKN W  LH      HL IV+LLL K  +I+ +   G  P+H AC NGH E+ K L+ K   ++ + K G T +H A  NGH+EVVK L++K  +   ++K+G  PI IA    +  +V LL
Sbjct: 1414 LLDKGADINVKNNDQWTALHFATRYDHLEIVKYLLDKGADINVKNKNQWTALHFATRYNHLKIVKLLLDKGADIHAKNKYGNTPLHKACENGHLEVIKYLVEKGADINAKNKNGNTPLHKACENGHLEVVKYLLDKGADIQAKNKNGNTPIDIAKQKKYGALVNLL 1579          

HSP 6 Score: 103.605 bits (257), Expect = 1.732e-18
Identity = 52/150 (34.67%), Postives = 84/150 (56.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H AC  G  E  ++++ K  +    NK+G  PL + C  GHL++V+ L+ K  +IN    DG   +H  C N + E+ K L+ K   +++    G T +H+A  +G++EVVK L+EK  +   ++KDG  P   A    H+E+VK L+
Sbjct:  507 PLHKACRIGNLEAVKYLIEKGVDIHAKNKHGNTPLCYACDKGHLEVVKYLVEKGADINATDEDGETLLHCVCKNDNIELVKYLVEKGVDINVIDGYGVTPLHYACRDGNLEVVKYLVEKGADIQAKNKDGETPFHWAHDNDHLEVVKYLL 656          

HSP 7 Score: 95.9005 bits (237), Expect = 3.748e-16
Identity = 47/151 (31.13%), Postives = 84/151 (55.63%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYG--HIEIVKLLI 628
            +H  C     E+ +++V K  +    +  G  PLH+ C +G+L++V+ L+ K  +I  +  DG  P H+A  N H E+ K L+ K   +  ++++  + ++WA   G +EV+K L+EK  +    ++DG    L+ CAY   H+E+VK L+
Sbjct:  574 LHCVCKNDNIELVKYLVEKGVDINVIDGYGVTPLHYACRDGNLEVVKYLVEKGADIQAKNKDGETPFHWAHDNDHLEVVKYLLEKGANIQAKSRESESLLYWACREGDLEVIKYLVEKGVDIQATNEDG--ETLLHCAYSNNHLELVKYLV 722          

HSP 8 Score: 84.3445 bits (207), Expect = 1.282e-12
Identity = 44/133 (33.08%), Postives = 71/133 (53.38%), Query Frame = 2
Query:  278 PLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PLH  C  G+L+ V+ L+ K  +I+ +   G  P+ +AC  GH E+ K L+ K   ++   + G T +H    N +IE+VK L+EK  + ++ D  G  P+  AC  G++E+VK L+          +DG  P
Sbjct:  507 PLHKACRIGNLEAVKYLIEKGVDIHAKNKHGNTPLCYACDKGHLEVVKYLVEKGADINATDEDGETLLHCVCKNDNIELVKYLVEKGVDINVIDGYGVTPLHYACRDGNLEVVKYLVEKGADIQAKNKDGETP 639          

HSP 9 Score: 83.1889 bits (204), Expect = 2.774e-12
Identity = 44/136 (32.35%), Postives = 70/136 (51.47%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEK 535
            L++K  DI    +     +H A      ++ + +++K  +    NK G  PLH  C NGHL++++ L+ K  +IN +  +G  P+H AC NGH E+ K L+ K   +  + K G T I  A    +  +V LL EK
Sbjct: 1447 LLDKGADINVKNKNQWTALHFATRYNHLKIVKLLLDKGADIHAKNKYGNTPLHKACENGHLEVIKYLVEKGADINAKNKNGNTPLHKACENGHLEVVKYLLDKGADIQAKNKNGNTPIDIAKQKKYGALVNLLTEK 1582          
BLAST of SMED30023739 vs. TrEMBL
Match: Q16FJ0 (AAEL014741-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014741 PE=4 SV=1)

HSP 1 Score: 143.28 bits (360), Expect = 5.294e-35
Identity = 60/165 (36.36%), Postives = 93/165 (56.36%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +++  + G+ EM +F+++   N +  + NGW PLH    NGHL++V+LL+     ++   N G  P+H A  NGH E+ K LI     +     +GWT +H A+ NGH+EVVK LI+ + N D     G  P+ +A   GH+E+VKLLI+N    +    +G  P
Sbjct:   16 VYLTADNGYIEMVKFLIDHNANIDTKDDNGWTPLHRASQNGHLEVVKLLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTQNEGWTPLHVASLNGHLEVVKSLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTENEGWTP 180          

HSP 2 Score: 139.428 bits (350), Expect = 1.094e-33
Identity = 59/153 (38.56%), Postives = 90/153 (58.82%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            P+H A   G  E+ + +++ + N + +   GW PLH    NGHL++V+LL+     +    N+G  P+H A  NGH E+ K LI     +D    +GWT +H A+ NGH+EVVKLLI+   N    + +G  P+ +A   GH+E+VKLLI+N+
Sbjct:   48 PLHRASQNGHLEVVKLLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTQNEGWTPLHVASLNGHLEVVKSLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTENEGWTPLHVASQNGHLEVVKLLIDNR 200          

HSP 3 Score: 110.538 bits (275), Expect = 1.357e-23
Identity = 49/134 (36.57%), Postives = 73/134 (54.48%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTD 550
            +D T N    P+H+A   G  E+ + +++   N   +   GW PLH    NGHL++V+ L+     ++   N G  P+H A  NGH E+ K LI     +     +GWT +H A+ NGH+EVVKLLI+ + N D
Sbjct:   71 VDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTQNEGWTPLHVASLNGHLEVVKSLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTENEGWTPLHVASQNGHLEVVKLLIDNRANVD 204          

HSP 4 Score: 86.2705 bits (212), Expect = 3.145e-15
Identity = 42/120 (35.00%), Postives = 67/120 (55.83%), Query Frame = 2
Query:  371 MRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLE 718
            M+ ++    NG+ E+ K LI  +  +D +   GWT +H A+ NGH+EVVKLLI+ + N D     G  P+ +A   GH+E+VKLLI+N    +    +G  P    S+ G + + K  ++
Sbjct:   13 MQLVYLTADNGYIEMVKFLIDHNANIDTKDDNGWTPLHRASQNGHLEVVKLLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTQNEGWTPLHVASLNGHLEVVKSLID 132          

HSP 5 Score: 80.4925 bits (197), Expect = 2.911e-13
Identity = 32/94 (34.04%), Postives = 52/94 (55.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQT 460
            P+H+A   G  E+ + +++ + N + +   GW PLH    NGHL++V+LL+     +    N+G  P+H A  NGH E+ K LI     +D +T
Sbjct:  114 PLHVASLNGHLEVVKSLIDNRANVDTTQNKGWTPLHVASQNGHLEVVKLLIDNGANVYTTENEGWTPLHVASQNGHLEVVKLLIDNRANVDAKT 207          
BLAST of SMED30023739 vs. TrEMBL
Match: Q16FI9 (AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AAEL014742 PE=4 SV=1)

HSP 1 Score: 150.984 bits (380), Expect = 1.244e-33
Identity = 65/166 (39.16%), Postives = 97/166 (58.43%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G  E+ +F+++ + N + +   GW PLH    NGHL++V+LL+     ++ + N+G  P+HFA  NGH E+ K LI     +D    +GWT +H AA NGH+EVVKLLIE + N D +   G  P+ +A   GH+E+VK LI+N+        +G  P
Sbjct:  154 PLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTP 319          

HSP 2 Score: 148.673 bits (374), Expect = 8.048e-33
Identity = 67/176 (38.07%), Postives = 100/176 (56.82%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +D T N    P+++A   G  E+ + +++ K N + ++  GW PLH    NGHL++V+LL+     ++   N G+ P+HFA  NGH E+ K LI     +D    +GWT +H A+ NGH+EVVKLLIE + N D     G  P+  A   GH+E+VKLLI+N+        +G  P
Sbjct:  551 VDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTP 726          

HSP 3 Score: 148.288 bits (373), Expect = 9.429e-33
Identity = 74/226 (32.74%), Postives = 121/226 (53.54%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEF 856
            P+H+A   G  E+ + +++ + N +     GW PLH    NGHL++V+LL+     ++ + N+G  P+HFA  NGH E+ K LI     +D    +GWT +H A+ NGH+EVVKLLIE + N D +  +G  P+  A   GH+E+VK LI+N+        +G  P     +HL  +     G ++  K +     N+D  K +  + P+ + S  +   + V++F
Sbjct:   88 PLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTP-----LHLAAEN----GHLEVVKLLIENRANVDTKK-NGGWTPLHVAS--QNGHLEVVKF 301          

HSP 4 Score: 147.902 bits (372), Expect = 1.239e-32
Identity = 64/163 (39.26%), Postives = 96/163 (58.90%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +D T N    P+H A   G  E+ + +++ + N + +   GW PLH    NGHL++V+LL+     ++   N G+ P+HFA  NGH E+ K LI     +D    +GWT +H A+ NGH+EVVKLLI+ + N D     G  P+ +A   GH+E+VKLLI+N+
Sbjct:  617 VDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNR 779          

HSP 5 Score: 147.132 bits (370), Expect = 2.099e-32
Identity = 61/166 (36.75%), Postives = 96/166 (57.83%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A   G+ E+ + +++   N + +   GW PLH    NGHL++V+LL+     ++ + N G  P+H A  NGH E+ K LI     +D +  +GWT +H+A+ NGH+EVVK LI+ + N D    +G  P+ +A   GH+E+VKLLI N+        +G  P
Sbjct:   55 PLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTP 220          

HSP 6 Score: 145.206 bits (365), Expect = 1.057e-31
Identity = 62/153 (40.52%), Postives = 91/153 (59.48%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            P+H A   G  E+ +F+++ + N + +   GW PLH    NGHL++V+LL+     ++ + N G  P+H A  NGH E+ K LI     +D    +GWT +H A+ NGH+EVVKLLI+ K N D     G  P+  A   GH+E+VKLLI+N+
Sbjct:  220 PLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNR 372          

HSP 7 Score: 142.895 bits (359), Expect = 4.782e-31
Identity = 65/176 (36.93%), Postives = 98/176 (55.68%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +D T N    P+++A   G  E+ + +++ K N + +   GW PLH    NGHL++V+LL+     ++   N G+ P++ A  NGH E+ K LI     +D    +GWT +H A+ NGH+EVVKLLIE + N D     G  P+  A   GH+E+VKLLI+N+        +G  P
Sbjct:  485 VDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTP 660          

HSP 8 Score: 142.124 bits (357), Expect = 9.474e-31
Identity = 59/166 (35.54%), Postives = 92/166 (55.42%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A   G  E+ + ++  + N +     GW PLH    NGHL++V+ L+     ++   ++G  P+H A  NGH E+ K LI     +D +   GWT +H A+ NGH+EVVK LI+ + N D    +G  P+ +A   GH+E+VKLLI+N+         G+ P
Sbjct:  187 PLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTPLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITP 352          

HSP 9 Score: 141.739 bits (356), Expect = 1.159e-30
Identity = 64/176 (36.36%), Postives = 97/176 (55.11%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +D T N    P+H A   G  E+ + ++  + N   +   GW PLH    NGHL++V+LL+     ++   N+G  P++ A  NGH E+ K LI     +D    +GWT ++ A+ NGH+EVVKLLI+ K N D    +G  P+ +A   GH+E+VKLLI+N+         G+ P
Sbjct:  386 VDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITP 561          

HSP 10 Score: 140.198 bits (352), Expect = 4.127e-30
Identity = 60/166 (36.14%), Postives = 94/166 (56.63%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G  E+ + ++  + N + +   GW PL+    NGHL++V+LL++    ++   N+G  P++ A  NGH E+ K LI     +D    +GWT +H A+ NGH+EVVKLLI+ + N D     G  P+ +A   GH+E+VKLLI+N+        +G  P
Sbjct:  429 PLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTP 594          

HSP 11 Score: 139.813 bits (351), Expect = 5.606e-30
Identity = 66/177 (37.29%), Postives = 97/177 (54.80%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEI---------NCQT--NDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A   G  E+ + +++ K N + +   G  PLH    NGHL++V+LL+     +         N  T  N G+ P+HFA  NGH E+ K LI     +     +GWT +H+A+ NGH+EVVKLLIE + N D    +G  P+ +A   GH+E+VKLLINN+        +G  P
Sbjct:  319 PLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTP 495          

HSP 12 Score: 139.043 bits (349), Expect = 9.312e-30
Identity = 64/176 (36.36%), Postives = 99/176 (56.25%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +D T N    P+++A   G  E+ + ++N + N + +   GW PL+    NGHL++V+LL+     ++   N+G  P+H A  NGH E+ K LI     +D    +G T ++ A+ NGH+EVVKLLI+ K N D  D +G  P+ +A   GH+E+VKLLI N+         G+ P
Sbjct:  452 VDTTQNEGWTPLYVASINGHLEVVKLLINNRANVDTTQNEGWTPLYVASKNGHLEVVKLLIDNKANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITP 627          

HSP 13 Score: 138.658 bits (348), Expect = 1.109e-29
Identity = 59/166 (35.54%), Postives = 93/166 (56.02%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A   G  ++ + +++   N +     GW PLH    NG+L++V+LL+     ++   ++G  P+H A  NGH E+ K LI     +D +   GWT +H A+ NGH+EVVKLLIE + N D +  +G  P+  A   GH+E+VK LI+N+        +G  P
Sbjct:   22 PLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTPLHFASQNGHLEVVKFLIDNRANVDTTQDEGWTP 187          

HSP 14 Score: 138.658 bits (348), Expect = 1.287e-29
Identity = 65/192 (33.85%), Postives = 104/192 (54.17%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFL 724
            +D T N    P+H+A   G  E+ + ++  + N + +   G  PLH    NGHL++V+LL+     ++   N+G  P+H A  NGH E+ K LI     +D    +G T +H+A+ NGH+EVVKLLI+ + N D    +G  P+ +A   GH+E+VKLLI+N+         G+ P     I+   + ++ L
Sbjct:  584 VDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLL 775          

HSP 15 Score: 135.576 bits (340), Expect = 1.174e-28
Identity = 62/176 (35.23%), Postives = 98/176 (55.68%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +D T N    P+H+A   G  E+ + +++ + N + +   G  PL+    NGHL++V+LL+     ++   N+G  P+H A  NGH E+ K LI     +D    +G T +H+A+ NGH+EVVKLLI+ + N D    +G  P+ +A   GH+E+VKLLI N+         G+ P
Sbjct:  518 VDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTKNKGITPLYVASKNGHLEVVKLLIDNKANVDTTDNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITP 693          

HSP 16 Score: 135.191 bits (339), Expect = 1.281e-28
Identity = 65/193 (33.68%), Postives = 101/193 (52.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELI-----------AKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFL 724
            P+H+A   G  E+ +F+++ + N + +   GW PLH    NGHL++V+LL+     ++   N G+ P+HFA  NGH E+ K LI                +D    +G T +H+A+ NGH+EVVKLLIE + N      +G  P+  A   GH+E+VKLLI N+        +G  P     I+   + ++ L
Sbjct:  286 PLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTPLHFASRNGHLEVVKLLIENRANVDTTQNEGWTPLYVASINGHLEVVKLL 478          

HSP 17 Score: 130.183 bits (326), Expect = 4.816e-27
Identity = 58/154 (37.66%), Postives = 88/154 (57.14%), Query Frame = 2
Query:  215 MAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            M +F+++   N + +N  G  PLH    NGHL +V+LL+     ++ + ++G  P+H A  NG+ E+ K LI     +D    +GWT +H AA NGH+EVVKLLI+ + N D +   G  P+ +A   GH+E+VKLLI N+        +G  P
Sbjct:    1 MVKFLIDHNANIDTANNGGRTPLHVASQNGHLKVVKLLIDNGANVDTEGDEGWTPLHLAAENGYLEVVKLLIDNGANVDTTQDEGWTPLHLAAENGHLEVVKLLIDNRANVDTKKNGGWTPLHVASQNGHLEVVKLLIENRANVDTKKNEGWTP 154          

HSP 18 Score: 126.716 bits (317), Expect = 6.662e-26
Identity = 60/177 (33.90%), Postives = 89/177 (50.28%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEV-----------VKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A   G  E+ + ++  + N +     GW PLH    NGHL++V+ L+     ++    +G  P+H A  NGH E+ K LI     +D    +G T +H+A+ NGH+EV           VKLLIE + N D     G  P+  A   GH+E+VKLLI N+        +G  P
Sbjct:  253 PLHLAAENGHLEVVKLLIENRANVDTKKNGGWTPLHVASQNGHLEVVKFLIDNRANVDTTQYEGWTPLHVASQNGHLEVVKLLIDNKANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIENRANVGTTQNEGWTP 429          

HSP 19 Score: 108.612 bits (270), Expect = 3.001e-20
Identity = 49/140 (35.00%), Postives = 77/140 (55.00%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDG 568
            +D T N    P+H+A   G  E+ + ++  + N + +   G  PLH    NGHL++V+LL+     ++   N+G  P+H A  NGH E+ K LI     +D    +G T ++ A+ NGH+EVVKLLI+ + N D    +G
Sbjct:  650 VDTTQNEGWTPLHVASQNGHLEVVKLLIENRANVDTTQNKGITPLHFASQNGHLEVVKLLIDNRANVDTTQNEGWTPLHVASQNGHLEVVKLLIDNRANVDTTQNKGITPLYVASINGHLEVVKLLIDNRANVDTTQNEG 789          
BLAST of SMED30023739 vs. TrEMBL
Match: W4XM80 (ANK_REP_REGION domain-containing protein OS=Strongylocentrotus purpuratus OX=7668 PE=4 SV=1)

HSP 1 Score: 151.369 bits (381), Expect = 3.540e-33
Identity = 127/520 (24.42%), Postives = 235/520 (45.19%), Query Frame = 2
Query:  143 INKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAG--EIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEF-ATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIE-----ECFLYRCIKNRHMEGFKIFSSPQT-INRPRKLVQKSFLEIAVEFSSRGFIKDI--LQKTIYDKEVWDRAK----KDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTR 1657
            +N++I    +  P+H A   G+ ++ + ++++    +    +G+ PLH     GHL +V+ L+    ++N +  +   P++ A   GH +I K LI +   +D +   G T +  A+  GH+ VVK L  ++ + D+ D DGC P+  A   GH ++V+ L+N        A DG  P  A   + HLD   +++L  I     I S  +  +C        P+ + S+     ++V+++  T+    ++       P+     +   + +  L + G  + +     +  L+   +  H++  K  ++    INR R    ++ L +A   S RG +  +  L     DK+  D++      DA Q    +++  + +    ++   +   + LH A  + + D+VKY+++    AD D   P   T L  A +  H   +  L     D +  +K   T LH+A   G H   QYL++   E+++    G T LH A  KG  D+ + L+ KGAD  R
Sbjct:  196 VNRLI---YDDSPLHAASENGYLDVVKCLISEGAEIDRDGDDGYTPLHLASLEGHLTVVECLVDAGADVNTKAKNEWTPMYAASNKGHLDIVKYLITRGADIDRRGYNGKTPLGVASIYGHLAVVKYLTSQRADKDMGDNDGCTPLYAASQKGHYDVVQYLVNEGAEVNKAANDGSTPLYAASHKGHLD--IVKYL--INKGADIDS--RGPNCKT------PLGIASL--CGHLAVVKYLITQRADKDMGNTDGYTPLYGASQEGHHDVVQYLVNEGAEVNKAANDGDLSLHAAARPGHLDILKFLTNRGADINR-RGYNGETPLGVA---SFRGHLAAVKYLISQRADKDAGDKSGYTPLHDASQEGYHDVVQYLVNEGAEVNKATKHGSTPLHAASQNGHLDIVKYLINKG--ADIDSRRPNCKTPLGIASLCGHLAAVKYLISQRADKDAGDKSGYTPLHDASQEGHHDVVQYLVNEGAEVNKATKRGSTPLHVASHKGHLDIVKYLINKGADIDR 692          

HSP 2 Score: 121.709 bits (304), Expect = 4.600e-24
Identity = 145/650 (22.31%), Postives = 262/650 (40.31%), Query Frame = 2
Query:  155 IDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVAPSVAGEIHLD-KKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAK----KDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETILPLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALAS 2086
            +D   NT  +HIA  +G  ++  ++++   + E  N++G  PLH+   +GH D+VQ L+ K  +IN   ++G  PI+ A   G+F + + L+     ++  +  G T I+ +A  GH++VVK L+ K    D     G   +  A   GH+ + K L++   +++     D    + +   +LD  KCL             S    ID D     Y P+ L S+E    ++V+E   +   +            + + +    P+   +++G   I +  + R                  I+R R    K+ L +A  +     +K  L     DK++ D         A Q    +++  + +    ++       + L+ A    + D+VKY+++    AD D   P   T L  A +  H   +  L     D +  N    T L+ A   G H   QYL++   E+++  + G  +LH A   G  D+ + L  +GAD  R   N         ET L + +    L     +           +S  A  +  D +    +H A+     +V   L+  G  V+K     +T L       ++QN         + +V+ L+  G+DI++      + L +AS
Sbjct:   34 VDPDGNTS-LHIASEEGHIDLVTYLIDLGADLEKRNRSGDSPLHYASRSGHQDVVQYLIGKGADINIGDSNGYTPIYLASEKGNFGVVECLVNSGADVNKASYNGSTPIYTSASKGHLDVVKYLLTKGVEIDRDSGGGYTRLYSALQEGHLALDKFLVDAGADVNRLIYDDSPLHAASENGYLDVVKCL------------ISEGAEIDRDG-DDGYTPLHLASLE--GHLTVVECLVDAGAD-----------VNTKAKNEWTPMYAASNKGHLDIVKYLITRGAD---------------IDR-RGYNGKTPLGVASIYGHLAVVK-YLTSQRADKDMGDNDGCTPLYAASQKGHYDVVQYLVNEGAEVNKAANDGSTPLYAASHKGHLDIVKYLINKG--ADIDSRGPNCKTPLGIASLCGHLAVVKYLITQRADKDMGNTDGYTPLYGASQEGHHDVVQYLVNEGAEVNKAANDGDLSLHAAARPGHLDILKFLTNRGADINRRGYN--------GETPLGVASFRGHLAAVKYL-----------ISQRADKDAGDKSGYTPLHDASQEGYHDVVQYLVNEGAEVNKATKHGSTPLH-----AASQNG-------HLDIVKYLINKGADIDSRRPNCKTPLGIAS 606          

HSP 3 Score: 118.242 bits (295), Expect = 5.074e-23
Identity = 63/180 (35.00%), Postives = 96/180 (53.33%), Query Frame = 2
Query:  140 LINKIIDITTN----TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            LINK  DI +       P+ IA   G     +++++++ + +  +K+G+ PLH     GH D+VQ L+++  E+N  T  G  P+H A   GH +I K LI K   +D +   G T +  A+  GHIEVVK LI +  + D+ D DGC P+  A   GH ++V+ L+N        A DG
Sbjct:  584 LINKGADIDSRRPNCKTPLGIASLCGHLAAVKYLISQRADKDAGDKSGYTPLHDASQEGHHDVVQYLVNEGAEVNKATKRGSTPLHVASHKGHLDIVKYLINKGADIDRKGCHGITPLRAASYCGHIEVVKFLISQGADKDMGDNDGCTPLFAASHAGHHDVVQYLVNKGAEVNKAANDG 763          

HSP 4 Score: 115.161 bits (287), Expect = 5.005e-22
Identity = 115/543 (21.18%), Postives = 218/543 (40.15%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRP---------------ITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRG-----RFLIEECF------------LYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAK----KDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGAD 1648
            L++   D+ T  +    P++ A NKG  ++ ++++ +  + +    NG  PL      GHL +V+ L S+  + +   NDG  P++ A   GH+++ + L+ +   ++     G T ++ A+  GH+++VK LI K  + D +  +   P+ IA   GH+ +VK LI  +        DG  P            +++L  +    ++     + D        RP               I       +T + V  F         +          D  ++   PL++ +  G     ++L+ E              L+   +N H++  K   +       R+   K+ L IA        +K ++ +   DK+  D++      DA Q    +++  + +    ++   +   + LH A    + D+VKY+++    AD D       T L  A    H   +  L     D +  +    T L  A  +G H   QYL++   E+++  + G  +LH A   G  D+ E L+ KGA+
Sbjct:  254 LVDAGADVNTKAKNEWTPMYAASNKGHLDIVKYLITRGADIDRRGYNGKTPLGVASIYGHLAVVKYLTSQRADKDMGDNDGCTPLYAASQKGHYDVVQYLVNEGAEVNKAANDGSTPLYAASHKGHLDIVKYLINKGADIDSRGPNCKTPLGIASLCGHLAVVKYLITQRADKDMGNTDGYTPLYGASQEGHHDVVQYL--VNEGAEVNKAANDGDL-SLHAAARPGHLDILKFLTNRGADINRRGYNGETPLGVASFRGHLAAVKYLISQRADKDAGD--KSGYTPLHDASQEGYHDVVQYLVNEGAEVNKATKHGSTPLHAASQNGHLDIVKYLINKGADIDSRRPNCKTPLGIASLCGHLAAVKYLISQRA-DKDAGDKSGYTPLHDASQEGHHDVVQYLVNEGAEVNKATKRGSTPLHVASHKGHLDIVKYLINKG--ADIDRKGCHGITPLRAASYCGHIEVVKFLISQGADKDMGDNDGCTPLFAASHAGHHDVVQYLVNKGAEVNKAANDGDLSLHAAARMGHLDVIEYLITKGAN 788          

HSP 5 Score: 96.6709 bits (239), Expect = 2.691e-16
Identity = 54/178 (30.34%), Postives = 93/178 (52.25%), Query Frame = 2
Query:  110 KGIMDLSNPNLINKIIDITTNT----RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            KG +D+    LINK  DI +       P+ IA   G   + ++++ ++ + +  N +G+ PL+     GH D+VQ L+++  E+N   NDG   +H A   GH +I K L  +   ++ +   G T +  A+  GH+  VK LI ++ + D  DK G  P+  A   G+ ++V+ L+N
Sbjct:  377 KGHLDIVK-YLINKGADIDSRGPNCKTPLGIASLCGHLAVVKYLITQRADKDMGNTDGYTPLYGASQEGHHDVVQYLVNEGAEVNKAANDGDLSLHAAARPGHLDILKFLTNRGADINRRGYNGETPLGVASFRGHLAAVKYLISQRADKDAGDKSGYTPLHDASQEGYHDVVQYLVN 553          

HSP 6 Score: 95.5153 bits (236), Expect = 4.712e-16
Identity = 53/218 (24.31%), Postives = 98/218 (44.95%), Query Frame = 2
Query:  140 LINKIIDIT----TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGW--------------------------------RPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVA 685
            L+N   D+       + PI+ + +KG  ++ ++++ K    +  +  G+                                 PLH    NG+LD+V+ L+S+  EI+   +DG  P+H A   GH  + + L+     ++ + K  WT ++ A+  GH+++VK LI +  + D +  +G  P+ +A  YGH+ +VK L + +        DG  P  A
Sbjct:  123 LVNSGADVNKASYNGSTPIYTSASKGHLDVVKYLLTKGVEIDRDSGGGYTRLYSALQEGHLALDKFLVDAGADVNRLIYDDSPLHAASENGYLDVVKCLISEGAEIDRDGDDGYTPLHLASLEGHLTVVECLVDAGADVNTKAKNEWTPMYAASNKGHLDIVKYLITRGADIDRRGYNGKTPLGVASIYGHLAVVKYLTSQRADKDMGDNDGCTPLYA 340          

HSP 7 Score: 82.0333 bits (201), Expect = 6.609e-12
Identity = 44/164 (26.83%), Postives = 84/164 (51.22%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVK 619
            L+N+  ++   T+    P+H+A +KG  ++ ++++NK  + +    +G  PL      GH+++V+ L+S+  + +   NDG  P+  A   GH ++ + L+ K   ++     G  S+H AA  GH++V++ LI K  N +  +  G          GH E +K
Sbjct:  650 LVNEGAEVNKATKRGSTPLHVASHKGHLDIVKYLINKGADIDRKGCHGITPLRAASYCGHIEVVKFLISQGADKDMGDNDGCTPLFAASHAGHHDVVQYLVNKGAEVNKAANDGDLSLHAAARMGHLDVIEYLITKGANIEAHNIYGWTAFHCLADNGHFECLK 813          

HSP 8 Score: 65.4698 bits (158), Expect = 9.233e-7
Identity = 52/193 (26.94%), Postives = 81/193 (41.97%), Query Frame = 2
Query:  110 KGIMDLSNPNLINKIIDITT----NTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKD---------------CLLD-----------------------------IQTKQGWTSIHWAACNGHIEVVKLLIEKKCN 544
            KG +D+    LINK  DI         P+  A   G  E+ +F++++  + +  + +G  PL      GH D+VQ L++K  E+N   NDG   +H A   GH ++ + LI K                CL D                             +QT +G TS+  AA  GH++ V+LL+E   +
Sbjct:  674 KGHLDIVK-YLINKGADIDRKGCHGITPLRAASYCGHIEVVKFLISQGADKDMGDNDGCTPLFAASHAGHHDVVQYLVNKGAEVNKAANDGDLSLHAAARMGHLDVIEYLITKGANIEAHNIYGWTAFHCLADNGHFECLKHFLRNNSSGSSGYSLIALKVGLQTLEGVTSLMVAARGGHLDCVRLLLENNAD 865          
BLAST of SMED30023739 vs. TrEMBL
Match: J9HSB7 (AAEL017480-PA (Fragment) OS=Aedes aegypti OX=7159 GN=AaeL_AAEL017480 PE=4 SV=1)

HSP 1 Score: 142.124 bits (357), Expect = 3.643e-33
Identity = 71/236 (30.08%), Postives = 119/236 (50.42%), Query Frame = 2
Query:  155 IDITTNTR--PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEF 856
            +D T N    P+H A   G  E+ +F+++   N + ++  GW PLH+   NGHL++V+LL+     ++   N+G  P+H+A  NG  E+ K +I     +D    +GWT +H+A+ NG +EVVK LI+   N D    +G  P+  A   GH+E+VKLLI+++        +G  P     +H        +G ++  K +     N+D        RP +L    +  R+ V++ 
Sbjct:   68 VDTTQNEEWTPLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTP-----LH----DASLIGHLEVVKLLIDNGANVDT---KNTRRPTSLHIASQNGRLEVVKL 291          

HSP 2 Score: 134.035 bits (336), Expect = 2.172e-30
Identity = 59/176 (33.52%), Postives = 94/176 (53.41%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN-------QNISFCP 655
            +D T N    P+H A   G  E+ + +++ + N + +    W PLH+   NG L++V+ L+     ++   N+G  P+H+A  NGH E+ K LI     +D    +GWT +H+A+ NG +EVVK +I+   N D  D +G  P+  A   G +E+VK LI+N       QN  + P
Sbjct:   35 VDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTPLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTP 210          

HSP 3 Score: 132.109 bits (331), Expect = 1.109e-29
Identity = 60/162 (37.04%), Postives = 93/162 (57.41%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +D T N    P+H A   G  E+ +FM++   N + ++  GW PLH+   NG L++V+ L+     ++   N+G  P+H+A  NGH E+ K LI  +  +D    +GWT +H A+  GH+EVVKLLI+   N D ++      + IA   G +E+VKLLI+N
Sbjct:  134 VDTTRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQNGRLEVVKLLIDN 295          

HSP 4 Score: 130.954 bits (328), Expect = 2.603e-29
Identity = 60/176 (34.09%), Postives = 93/176 (52.84%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +D T N    P+H A   G  E+ + +++   N + +   GW PLH    NGHL++V+LL+     ++   N+   P+H+A  NG  E+ K LI     +D    +GWT +H+A+ NGH+EVVKLLI+   N D    +G  P+  A   G +E+VK +I+N         +G  P
Sbjct:    2 VDTTRNEGWTPLHYASLNGHLEVVKLLIDNGANVDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTPLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTPLHYASRNGRLEVVKFMIDNGANVDTTDNEGWTP 177          

HSP 5 Score: 128.257 bits (321), Expect = 2.111e-28
Identity = 61/162 (37.65%), Postives = 94/162 (58.02%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +D T N    P+H A   G  E+ +F+++   N + +   GW PLH+   NGHL++V+LL+  +  ++   N+G  P+H A   GH E+ K LI     +D +  +  TS+H A+ NG +EVVKLLI+   N D ++  G   + IA   GH+E+VKLLI+N
Sbjct:  167 VDTTDNEGWTPLHYASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQNGRLEVVKLLIDNGANVDTKNTRGSTSLHIASRNGHLEVVKLLIDN 328          

HSP 6 Score: 124.79 bits (312), Expect = 2.873e-27
Identity = 56/144 (38.89%), Postives = 80/144 (55.56%), Query Frame = 2
Query:  245 NFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N + +   GW PLH+   NGHL++V+LL+     ++   N G  P+HFA  NGH E+ K LI     +D    + WT +H+A+ NG +EVVK LI+   N D  D +G  P+  A   GH+E+VKLLI+N         +G  P
Sbjct:    1 NVDTTRNEGWTPLHYASLNGHLEVVKLLIDNGANVDTTQNKGWTPLHFASQNGHLEVVKLLIDNRANVDTTQNEEWTPLHYASRNGRLEVVKFLIDNGANVDTTDNEGWTPLHYASRNGHLEVVKLLIDNGANVDTTRNEGWTP 144          

HSP 7 Score: 98.2117 bits (243), Expect = 3.612e-18
Identity = 51/136 (37.50%), Postives = 76/136 (55.88%), Query Frame = 2
Query:  155 IDITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRP--IHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTD 550
            +D T N    P+H A   G  E+ + +++ + N + ++  GW PLH     GHL++V+LL+  D   N  T +  RP  +H A  NG  E+ K LI     +D +  +G TS+H A+ NGH+EVVKLLI+   N D
Sbjct:  200 VDTTQNEGWTPLHYASRNGHLEVVKLLIDDEANVDTTDNEGWTPLHDASLIGHLEVVKLLI--DNGANVDTKNTRRPTSLHIASQNGRLEVVKLLIDNGANVDTKNTRGSTSLHIASRNGHLEVVKLLIDNGANVD 333          

HSP 8 Score: 64.3142 bits (155), Expect = 5.019e-7
Identity = 90/375 (24.00%), Postives = 154/375 (41.07%), Query Frame = 2
Query:  542 NTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRG-----RFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADC 1651
            N D    +G  P+  A   GH+E+VKLLI+N          G  P     +H   +     G ++  K +     N+D  + +  + P+   S     R+ V++F  +N  N           TD+E  T   PL+  +  G     + LI+        +N   EG+          R         LE+ V+F     I +       D E W      A +N ++E++  + D    + + +    + LH A  + + ++VK ++D  D A+ D  +    T L  A ++ H   + +L     + +T+N    TSLH A  +G     + LIDN   +D  N+ G T+LH A   G  ++ + L+  GA+ 
Sbjct:    1 NVDTTRNEGWTPLHYASLNGHLEVVKLLIDNGANVDTTQNKGWTP-----LHFASQN----GHLEVVKLLIDNRANVDTTQ-NEEWTPLHYAS--RNGRLEVVKFLIDNGANVD--------TTDNEGWT---PLHYASRNGHLEVVKLLIDNGANVDTTRN---EGWTPLHYASRNGR---------LEV-VKF----MIDNGANVDTTDNEGWTPLHY-ASRNGRLEVVKFLIDNGANVDTTQNEGWTPLHYASRNGHLEVVKLLID--DEANVDTTDNEGWTPLHDASLIGHLEVVKLLIDNGANVDTKNTRRPTSLHIASQNGRLEVVKLLIDNGANVDTKNTRGSTSLHIASRNGHLEVVKLLIDNGANV 332          
BLAST of SMED30023739 vs. Ensembl Cavefish
Match: ank1a (ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GENE-041010-44])

HSP 1 Score: 105.916 bits (263), Expect = 1.158e-22
Identity = 50/166 (30.12%), Postives = 83/166 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A   G  ++AE ++ +  N   + KNG  PLH    + +LD+V LL+SK    +    +G  P+H A      E+A  L+      + ++ QG T +H AA  G  ++V LLI K+ N ++ +K G  P+ +    GH+ I  +L+      +   R G  P
Sbjct:  511 PLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTP 676          

HSP 2 Score: 103.219 bits (256), Expect = 8.345e-22
Identity = 53/151 (35.10%), Postives = 80/151 (52.98%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            P+HIAC K    + + ++    + E   ++G  PLH     GHL+IV++LL K    N        P+H A   GH E+A+ L+     +D + K   TS+H AA  GH E+VKLL+E K N +     G  P+ IA   GH + V++L++
Sbjct:  346 PLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLD 496          

HSP 3 Score: 100.523 bits (249), Expect = 5.708e-21
Identity = 53/183 (28.96%), Postives = 92/183 (50.27%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            ++PN  N  ++      P+H+A   G  E+AEF++      +   K+    LH     GH ++V+LLL      N  T  G  P+H A   GH +  + L+  +      TK+G+T +H AA  G ++V +LL+E+  N +   K+G  P+ +A  + ++++V LL++        AR+G  P
Sbjct:  400 ASPNASNVKVET-----PLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTP 577          

HSP 4 Score: 97.8265 bits (242), Expect = 4.142e-20
Identity = 43/149 (28.86%), Postives = 80/149 (53.69%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K+ N    NK+G  PLH     GH+ I  +L+ +   +   T  G  P+H AC  G+ ++ K L+ +   ++ +T+ G+T +H AA  GH ++V LL++     +    +G   + IA   G+I ++ +L
Sbjct:  610 PLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLLKHGAQPNEITTNGTSALAIAKRLGYISVIDVL 758          

HSP 5 Score: 95.1301 bits (235), Expect = 2.367e-19
Identity = 51/170 (30.00%), Postives = 87/170 (51.18%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            T   P+HIA +     +A+ ++N+  N  ++ KNG  PLH     G++ +V+LLL +   I+ +T D + P+H A  NGH  I + L+ +   +  +TK G + IH AA   H++ V+ L++     D    D   P+ +A   GH  + K+L++        A +G  P
Sbjct:  177 TGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTP 346          

HSP 6 Score: 94.7449 bits (234), Expect = 3.529e-19
Identity = 46/150 (30.67%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+HIA  +   E+A  ++    +    +  G  PLH     G  D+V LL+SK   +N     G+ P+H     GH  IA  L+ +   +   T+ G+T +H A   G+I++VK L++++ N + + + G  P+  A   GH +IV LL+
Sbjct:  577 PLHIASKQNQVEVASSLLQYGASANAESLQGVTPLHLAAQEGRADMVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNGKTRAGYTPLHQAAQQGHTDIVTLLL 726          

HSP 7 Score: 93.5893 bits (231), Expect = 7.846e-19
Identity = 46/166 (27.71%), Postives = 83/166 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA  +G   M   ++++    +   K+   PLH    NGH+ I+++LL +   I  +T +G+ PIH A    H +  ++L+  +  +D  T    T +H AA  GH  + K+L++K    + +  +G  P+ IAC   H+ ++ LL+ +          G+ P
Sbjct:  214 PLHIASRRGNVIMVRLLLDRGATIDAKTKDELTPLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTP 379          

HSP 8 Score: 91.2781 bits (225), Expect = 3.356e-18
Identity = 52/164 (31.71%), Postives = 81/164 (49.39%), Query Frame = 2
Query:  149 KIIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +I DIT +   P+H+A + G   MA+ +++K         NG+ PLH  C   HL ++ LLL     +   T  G+ P+H A   GH  I K L+ K    +    +  T +H A+  GH EV + L++     D + KD    +  A   GH E+VKLL+ ++
Sbjct:  302 EIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKDDQTSLHCAARMGHKELVKLLLEHK 465          

HSP 9 Score: 79.337 bits (194), Expect = 1.938e-14
Identity = 46/195 (23.59%), Postives = 80/195 (41.03%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEI---------------------------------NCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARD 664
            P+H A   G   + E ++++    +   KNG  P+H      H+D V+ LL  + EI                                 N +  +G  P+H AC   H  +   L+     L+  T+ G T +H A+  GH+ +VK+L++K  + +  +     P+ +A   GH E+ + L+ N       A+D
Sbjct:  247 PLHCAARNGHVRIIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNTRALNGFTPLHIACKKNHLRVMDLLLKHSASLEAVTESGLTPLHVASFMGHLNIVKILLQKGASPNASNVKVETPLHMASRAGHCEVAEFLLQNAAPVDAKAKD 441          

HSP 10 Score: 76.6406 bits (187), Expect = 1.094e-13
Identity = 42/165 (25.45%), Postives = 74/165 (44.85%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H A   G  E+ + ++  K N   +   G  PLH     GH   V++LL  + +    T  G  P+H A   G  ++A+ L+ +    +   K G T +H A  + +++VV LL+ K  +     ++G  P+ IA     +E+   L+     +   +  GV P
Sbjct:  446 LHCAARMGHKELVKLLLEHKANPNSTTTAGHTPLHIAAREGHTQTVRILLDMNAQQTKMTKKGFTPLHVAAKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTPLHIASKQNQVEVASSLLQYGASANAESLQGVTP 610          

HSP 11 Score: 69.707 bits (169), Expect = 1.411e-11
Identity = 35/112 (31.25%), Postives = 59/112 (52.68%), Query Frame = 2
Query:  299 NGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            +G+LD     +    +IN    +G+  +H A   GH ++  EL+    +L+  TK+G T++H AA  G  +VV  L+    N + Q + G  P+ +A    H+E+VK L+ N
Sbjct:   20 SGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLEN 131          

HSP 12 Score: 67.0106 bits (162), Expect = 9.919e-11
Identity = 47/199 (23.62%), Postives = 81/199 (40.70%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDK------------------------------------DGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVAP 676
            A   G  + A   +    +   +N+NG   LH     GH+ +V  LL     +   T  G   +H A   G  ++  EL+     ++ Q+++G+T ++ AA   H+EVVK L+E   N  I  +                                     G  P+ IA  Y ++ + +LL+N   N++F P ++G+ P
Sbjct:   17 AARSGNLDKALDHIKNGIDINTANQNGLNGLHLASKEGHVKMVLELLHNGVVLETTTKKGNTALHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEVKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTP-KNGITP 214          

HSP 13 Score: 62.3882 bits (150), Expect = 2.967e-9
Identity = 47/198 (23.74%), Postives = 92/198 (46.46%), Query Frame = 2
Query:   98 QNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGH-FEIAKELIAKDCLL----DIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            + ++K +++L +  ++ +      NT  +HIA   G  ++   +VN   N    ++ G+ PL+      HL++V+ LL      +  T   ++P   + AN + F +     A    L       T  G+T +H AA   ++ V +LL+ +  N +   K+G  P+ IA   G++ +V+LL++         +D + P
Sbjct:   53 EGHVKMVLELLHNGVVLETTTKKGNTA-LHIAALAGQEQVVTELVNYGANVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTE--VKPSAVSLANSYSFPLYLSTNASHITLKNVCSFITATGFTPLHIAAHYENLNVAQLLLNRGANVNFTPKNGITPLHIASRRGNVIMVRLLLDRGATIDAKTKDELTP 247          
BLAST of SMED30023739 vs. Ensembl Cavefish
Match: ENSAMXT00000037173.1 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21074007:21119253:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000037173.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 99.7525 bits (247), Expect = 1.685e-21
Identity = 50/166 (30.12%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA + G   +A  ++N+    +++ +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH    + L+ +   +  +TK G + +H AA   H+E VK L++ K   D    D    + +A   GH  + KLL++ +      A +G  P
Sbjct:  212 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 377          

HSP 2 Score: 96.6709 bits (239), Expect = 1.408e-20
Identity = 46/150 (30.67%), Postives = 80/150 (53.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H+A  +G   M   ++++    +   ++G  PLH    +GH   V+LLL +   I  +T +G+ P+H A    H E  K L+     +D  T    T++H AA  GH  V KLL++K+ N + +  +G  P+ IAC    +++++LL+
Sbjct:  245 PLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLV 394          

HSP 3 Score: 87.8113 bits (216), Expect = 1.238e-17
Identity = 41/126 (32.54%), Postives = 69/126 (54.76%), Query Frame = 2
Query:  257 SNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            SN+NG   LH     GH+D+VQ LL +   ++  T  G   +H A   G  E+ K L+ +   ++ Q++ G+T ++ A+   H++VV+ L+E   N     +DG  P+ IA   GH ++V +L+ N
Sbjct:   44 SNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN 169          

HSP 4 Score: 87.0409 bits (214), Expect = 1.770e-17
Identity = 43/152 (28.29%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA  K   + A  ++    N +  +K+G+ PLH     G++++  LLL++   ++    +G+ P+H A   G+  + + L+ +   +D +T+ G T +H AA +GH   V+LL+E+      + K+G  P+ +A    H+E VK L+ ++
Sbjct:  180 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHK 331          

HSP 5 Score: 85.5001 bits (210), Expect = 5.853e-17
Identity = 53/221 (23.98%), Postives = 97/221 (43.89%), Query Frame = 2
Query:  107 LKGIMDL--SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            LKG +D+  SN N +N           +H+A  +G  ++ + ++ +  + + + K G   LH     G  ++V++L+ +  +IN Q+ +G  P++ A    H ++ + L+         T+ G+T +  A   GH +VV +L+E                                N D+Q K G  P+ IA  YG++ +  LL+N        AR+G+ P
Sbjct:   35 LKGGVDIGTSNQNGLN----------ALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITP 245          

HSP 6 Score: 80.1073 bits (196), Expect = 3.555e-15
Identity = 42/147 (28.57%), Postives = 75/147 (51.02%), Query Frame = 2
Query:  239 KCN-FEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +CN F  SN +  R        G++D V   L    +I     +G+  +H A   GH ++ +EL+ +   +D  TK+G T++H A+  G  EVVK+L+++  + + Q ++G  P+ +A    H+++V+ L+ N         DG  P
Sbjct:    8 QCNKFSDSNTSFLR----AARAGNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTP 150          

HSP 7 Score: 74.7146 bits (182), Expect = 2.016e-13
Identity = 44/212 (20.75%), Postives = 90/212 (42.45%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCE-----------------------------INCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            L+ +  DI   ++    P+++A  +   ++  +++    N   + ++G+ PL      GH  +V +LL  D +                              + Q+  G  P+H A   G+  +A  L+ +   +D   + G T +H A+  G+  +V+LL+++    D + +DG  P+  A   GH   V+LL+          ++G++P
Sbjct:  100 LVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSP 311          

HSP 8 Score: 64.3142 bits (155), Expect = 3.325e-10
Identity = 53/217 (24.42%), Postives = 84/217 (38.71%), Query Frame = 2
Query:   35 NYCNLILIRMSESEIFKDFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLH--------------------------------HCCAN-GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDI 553
            N   L+L R +      DF  +N +  +   S   N N++  ++D    I   TR    P+H A   G     E ++ +        KNG  PLH                                H  A+ GH  + +LLL K    N +  +G  P+H AC     ++ + L+     +   T+ G T IH AA  GH+ +V LL++   + D+
Sbjct:  223 NVATLLLNRGAAV----DFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDV 435          
BLAST of SMED30023739 vs. Ensembl Cavefish
Match: ank1b (ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GENE-091113-6])

HSP 1 Score: 100.523 bits (249), Expect = 5.779e-21
Identity = 52/183 (28.42%), Postives = 92/183 (50.27%), Query Frame = 2
Query:  128 SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            ++PN  N  ++      P+H+A   G  E+A+F++      +   K+   PLH     GH ++V+LLL      +  T  G  P+H A   GH    + L+  +      TK+G+T +H A   G ++V +LL+E+  N +   K+G  P+ +A  + ++++VKLL++        AR+G  P
Sbjct:  403 ASPNASNVKVET-----PLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTP 580          

HSP 2 Score: 99.3673 bits (246), Expect = 1.113e-20
Identity = 53/182 (29.12%), Postives = 96/182 (52.75%), Query Frame = 2
Query:  131 NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            NP++++K     T   P+HIA +     +A+ ++N+  N  ++ KNG  PLH     G++ +V+LLL +  +I+ +T D + P+H A  NGH  + + L+ +   +  +TK G + IH AA   H++ V+ L++     D    D   P+ +A   GH  + K+L++    +   A +G  P
Sbjct:  173 NPDVLSK-----TGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTP 349          

HSP 3 Score: 97.4413 bits (241), Expect = 5.458e-20
Identity = 53/166 (31.93%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K      + ++    + E   ++G  PLH     GHL+IV+ LL +    N        P+H A   GH E+A+ L+     +D + K   T +H AA  GH E+VKLL+E K N D     G  P+ IA   GH    ++L++         + G  P
Sbjct:  349 PLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTP 514          

HSP 4 Score: 95.5153 bits (236), Expect = 1.905e-19
Identity = 49/168 (29.17%), Postives = 84/168 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDK-----DGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            P+H+AC  G  ++AE ++ +  N   + KNG  PLH    + +LD+V+LL+SK    +    +G  P+H A      E+A  L+      + ++ QG T +H AA  G  ++V LLI K+ N ++ +K         P+ +    GH+ I  +L+      +  +R G
Sbjct:  514 PLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMG 681          

HSP 5 Score: 94.3597 bits (233), Expect = 4.383e-19
Identity = 52/164 (31.71%), Postives = 81/164 (49.39%), Query Frame = 2
Query:  149 KIIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +I DIT +   P+H+A + G   MA+ +++K         NG+ PLH  C   H+  + LLL     +   T  G+ P+H A   GH  I K L+ +    +    +  T +H AA  GH EV + L++     D + KD   P+  A   GH E+VKLL+ ++
Sbjct:  305 EIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTPLHCAARMGHKELVKLLLEHK 468          

HSP 6 Score: 90.8929 bits (224), Expect = 5.199e-18
Identity = 45/166 (27.11%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA  +G   M   ++++    +   K+   PLH    NGH+ ++++LL +   I  +T +G+ PIH A    H +  ++L+  +  +D  T    T +H AA  GH  + K+L++K    + +  +G  P+ IAC   H+  + LL+ +          G+ P
Sbjct:  217 PLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTP 382          

HSP 7 Score: 87.8113 bits (216), Expect = 4.423e-17
Identity = 43/159 (27.04%), Postives = 75/159 (47.17%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQN 640
            T    P+HIA  +G       +++         K G+ PLH  C  G +D+ +LLL +    N    +G+ P+H A  + + ++ K L++K        + G+T +H AA    +EV   L++   N + +   G  P+ +A   G  ++V LLI+ Q 
Sbjct:  476 TAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQG 634          

HSP 8 Score: 83.5741 bits (205), Expect = 7.673e-16
Identity = 42/149 (28.19%), Postives = 78/149 (52.35%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +HIA        A  ++    N +  +K G+ PLH      +L + QLLL++   +N    +G+ P+H A   G+  + + L+ +   +D +TK   T +H AA NGH+ V+++L+++      + K+G  PI +A    H++ V+ L+
Sbjct:  152 LHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLDRGAQIDARTKDELTPLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLL 300          

HSP 9 Score: 83.1889 bits (204), Expect = 1.224e-15
Identity = 41/154 (26.62%), Postives = 78/154 (50.65%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNK-----NGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   +++K+ N    NK         PLH     GH+ I  +L+ +   +   +  G   +H AC  G+ ++ K L+ +   ++ +T+ G+T +H AA  GH ++V LL++     +    +G  P+ IA   G+I ++ +L
Sbjct:  613 PLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 10 Score: 82.8037 bits (203), Expect = 1.355e-15
Identity = 46/171 (26.90%), Postives = 83/171 (48.54%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTN-----DGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA  +   E+A  ++    N    +  G  PLH     G  D+V LL+SK   +N           + P+H     GH  IA  L+ +   +   ++ G+T++H A   G+I++VK L++++ + + + + G  P+  A   GH +IV LL+ +  +      +G +P
Sbjct:  580 PLHIAAKQNQLEVASSLLQCGANANSESLQGITPLHLAAQEGRPDMVALLISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSP 750          

HSP 11 Score: 81.6481 bits (200), Expect = 3.478e-15
Identity = 41/150 (27.33%), Postives = 72/150 (48.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H A   G  E+ + ++  K N + +   G  PLH     GH    ++LL  + +    T  G  P+H AC  G  ++A+ L+ +    +   K G T +H A  + +++VVKLL+ K  +     ++G  P+ IA     +E+   L+
Sbjct:  448 PLHCAARMGHKELVKLLLEHKANPDSATTAGHTPLHIAAREGHAHTTRILLDGNAQQTKMTKKGFTPLHVACKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVKLLVSKGGSPHSTARNGYTPLHIAAKQNQLEVASSLL 597          

HSP 12 Score: 79.7221 bits (195), Expect = 1.151e-14
Identity = 40/125 (32.00%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  257 SNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            +N+NG   LH     GH+ +V  LL    ++   T  G   +H A   G  ++  EL+     ++ Q+++G++ ++ AA   H+EVVK L+E   N  +  +DG  P+ +A   GH  +V LLIN
Sbjct:   16 ANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLIN 140          

HSP 13 Score: 76.2554 bits (186), Expect = 1.545e-13
Identity = 47/199 (23.62%), Postives = 79/199 (39.70%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEI---------------------------------NCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G   + E ++++    +   KNG  P+H      H+D V+ LL  + EI                                 N +  +G  P+H AC   H      L+     L+  T+ G T +H AA  GH+ +VK L+++  + +  +     P+ +A   GH E+ + L+ N       A+D   P
Sbjct:  250 PLHCAARNGHVRVIEILLDQGAPIQAKTKNGLSPIHMAAQGDHMDCVRQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKANARALNGFTPLHIACKKNHMRSMDLLLKHSASLEAVTESGLTPLHVAAFMGHLNIVKSLLQRGASPNASNVKVETPLHMAARAGHCEVAQFLLQNLAQVDAKAKDDQTP 448          

HSP 14 Score: 73.1738 bits (178), Expect = 1.344e-12
Identity = 39/137 (28.47%), Postives = 68/137 (49.64%), Query Frame = 2
Query:  116 IMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLL 526
            I    N NL NK+    T   P+H+   +G   +A+ +V +  +   +++ G+  LH  C  G++ +V+ LL +   +NC+T  G  P+H A   GH +I   L+    L +  T  G + +  A   G+I V+ +L
Sbjct:  630 ISKQGNVNLGNKVRTQLTALTPLHLVAQEGHVGIADMLVKQGASVYSASRMGYTALHVACHYGNIKMVKFLLQQQAHVNCKTRVGYTPLHQAAQQGHTDIVTLLLKHGALPNEITTNGTSPLGIAKRLGYISVIDVL 766          

HSP 15 Score: 72.4034 bits (176), Expect = 2.124e-12
Identity = 49/197 (24.87%), Postives = 87/197 (44.16%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEI-----------------------------AKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            L++  ID+ T T+     +HIA   G  ++   +V+   N    ++ G+ PL+      HL++V+ LL      +  T DG  P+  A   GH  +                             A  L+  D   D+ +K G+T +H AA   ++ V +LL+ +  N +   K+G  P+ IA   G++ +V+LL++
Sbjct:   39 LLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTPKNGITPLHIAARRGNVIMVRLLLD 235          

HSP 16 Score: 72.4034 bits (176), Expect = 2.160e-12
Identity = 48/195 (24.62%), Postives = 82/195 (42.05%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLI-----------------------------EKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVAP 676
            +H+A  +G  +M   +++   + E + K G   LH     G   +V  L+     +N Q+  G  P++ A    H E+ K L+       + T+ G+T +  A   GH  VV LLI                             +   N D+  K G  P+ IA  Y ++ + +LL+N   N++F P ++G+ P
Sbjct:   24 LHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTPLAVALQQGHENVVALLINYGTKGKVRLPALHIAARNDDTRTAAVLLQNDPNPDVLSKTGFTPLHIAAHYENLSVAQLLLNRGANVNFTP-KNGITP 217          

HSP 17 Score: 71.2478 bits (173), Expect = 4.960e-12
Identity = 36/110 (32.73%), Postives = 55/110 (50.00%), Query Frame = 2
Query:  347 INCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            IN    +G+  +H A   GH ++  EL+     L+  TK+G T++H AA  G  +VV  L+    N + Q + G  P+ +A    H+E+VK L+ N      P  DG  P
Sbjct:   13 INTANQNGLNGLHLASKEGHVKMVLELLHHGIDLETTTKKGNTALHIAALAGQEKVVAELVHYGANVNAQSQKGFSPLYMAAQENHLEVVKFLLENGANQSLPTEDGFTP 122          
BLAST of SMED30023739 vs. Ensembl Cavefish
Match: ank3b (ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2])

HSP 1 Score: 98.2117 bits (243), Expect = 3.428e-20
Identity = 54/174 (31.03%), Postives = 86/174 (49.43%), Query Frame = 2
Query:  164 TTNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TTN R    +H+A   G  E+ +++V      +  +K+   PLH     G  +I+Q LL      +  T  G  P+H A   GH ++A  L+ +   L I TK+G+T +H AA  G IEV  LL++K+   D   K G  P+ +A  Y + ++  LL++        A++G  P
Sbjct:  408 TTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTP 581          

HSP 2 Score: 94.7449 bits (234), Expect = 3.140e-19
Identity = 54/176 (30.68%), Postives = 86/176 (48.86%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKK 709
            +H+A + G +++A+ +V+KK N      NG+ PLH  C    + +++LLL     I   T  G+ PIH A   GH  I  +L+      +    +G T++H AA  G  EVVK L++     D + KD   P+ I+   G  EI++ L+ +     CP  D    S    +HL  +
Sbjct:  318 LHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQH---GACP--DSTTTSGYTPLHLAAR 488          

HSP 3 Score: 94.3597 bits (233), Expect = 4.409e-19
Identity = 140/658 (21.28%), Postives = 255/658 (38.75%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIE-EKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKD------AEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYI-ENIPQFMLDSKETILPLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISV----------------VRRLVEFGSDINTLSVGGDSILALA 2083
            +HIA  K   + A  ++    N +  +K+G+ PLH     G++++  LLL++   ++ +  + + P+H A   G+  + K L+ +   +D +TK G T +H  A +GH +VV++L+++      + K+G  P+ +A    H+  V+LL++++     P  D V       +H+   C    G  + +K I     N +    + F    T + I  +K RI V+E   ++                  IQ V E          F+  E  + + + +         +SP T N    +  ++ L +A        +K ++Q   Y   V  ++K D      + +  + EI+ ++        S   +  + LH A  + + D+   +LD    A   +   +  T L  A         ++L Q     +   K   T LH A           L+D           G T LH A  K   ++   LL  GAD      + I    L S+E  +      + +TL +    TI  C    ++               +H+AA   Q  V   L+  G  VD   +K     + +     N  M   +L+    V                +  L++ G+  N L+V G++ L++A
Sbjct:  153 LHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHE----VPVDD-VTNDYLTALHVAAHC----GHYKVAKVIVDKKANPNAKALNGF----TPLHIACKKNRIKVMELLLKHGA---------------SIQAVTESGLTPIHVAAFMGHENIVTQLMNH--------GASPNTTN----VRGETALHMAARAGQTEVVKYLVQNGAY---VDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQG--ASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNV------DMVTLLMARDATINLCNKSGLTP--------------LHLAAQEDQVNVAEVLVNHGATVDP-ETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIA 744          

HSP 4 Score: 93.9745 bits (232), Expect = 5.451e-19
Identity = 49/173 (28.32%), Postives = 89/173 (51.45%), Query Frame = 2
Query:  158 DITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            DIT    P+H+A  +G   M + ++ +    +   K+G  PLH    +GH  +V++LL +   I  +T +G+ P+H A    H    + L+  +  +D  T    T++H AA  GH +V K++++KK N + +  +G  P+ IAC    I++++LL+ +          G+ P
Sbjct:  215 DIT----PLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTP 383          

HSP 5 Score: 93.9745 bits (232), Expect = 5.639e-19
Identity = 47/174 (27.01%), Postives = 89/174 (51.15%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHL 700
            P+H+A +    ++A  ++++  +   + KNG+ PLH       ++I   LL    + N  T  G+ P+H A   G+ ++   L+A+D  +++  K G T +H AA    + V ++L+      D + K G  P+ +AC YG++++V  L+ NQ  +   A+  V  +  G  H+
Sbjct:  548 PLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQ--AKVNAKTKVTAAQQGHTHI 719          

HSP 6 Score: 88.9669 bits (219), Expect = 1.987e-17
Identity = 44/177 (24.86%), Postives = 89/177 (50.28%), Query Frame = 2
Query:  146 NKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N  ++  +   P+HIA + G   +A  ++N+    ++  +N   PLH     G+ ++V+LLL +   I+ +T DG+ P+H    +GH ++ + L+ +   +  +TK G + +H A    H+  V+LL+  +   D    D    + +A   GH ++ K++++ +      A +G  P
Sbjct:  174 NADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTP 350          

HSP 7 Score: 88.9669 bits (219), Expect = 2.145e-17
Identity = 44/166 (26.51%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   ++N   +   +N  G   LH     G  ++V+ L+     ++ ++ D   P+H +   G  EI ++L+      D  T  G+T +H AA  GH +V  +L+++  +  I  K G  P+ +A  YG IE+  LL+  +       + G+ P
Sbjct:  383 PIHVAAFMGHENIVTQLMNHGASPNTTNVRGETALHMAARAGQTEVVKYLVQNGAYVDAKSKDDQTPLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTP 548          

HSP 8 Score: 85.5001 bits (210), Expect = 2.465e-16
Identity = 45/152 (29.61%), Postives = 77/152 (50.66%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+H     G  ++ E ++++        KNG  PLH      HL+ VQLLL  +  ++  TND +  +H A   GH+++AK ++ K    + +   G+T +H A     I+V++LL++   +     + G  PI +A   GH  IV  L+N+
Sbjct:  251 PLHCGARSGHEQVVEMLLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLHHEVPVDDVTNDYLTALHVAAHCGHYKVAKVIVDKKANPNAKALNGFTPLHIACKKNRIKVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVTQLMNH 402          

HSP 9 Score: 84.3445 bits (207), Expect = 5.851e-16
Identity = 46/193 (23.83%), Postives = 93/193 (48.19%), Query Frame = 2
Query:  125 LSNPNLINKIID--------ITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI-NNQNISFCPARDGVAP 676
            L  P +I +++          T+   P+H+A  +G  ++A  ++++  +   + K G+ PLH     G +++  LLL K    +     G+ P+H A    + ++A  L+ +        K G+T +H AA    +E+   L+E   +T+   + G  P+ +A   G++++V LL+  +  I+ C  + G+ P
Sbjct:  456 LGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLC-NKSGLTP 647          

HSP 10 Score: 82.4185 bits (202), Expect = 2.309e-15
Identity = 45/166 (27.11%), Postives = 76/166 (45.78%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HI+   G  E+ + ++      + +  +G+ PLH     GH D+  +LL +   +   T  G  P+H A   G  E+A  L+ K    D   K G T +H AA   + +V  LL+++  +     K+G  P+ IA     +EI   L+     +    R G++P
Sbjct:  449 PLHISSRLGKPEIIQQLLQHGACPDSTTTSGYTPLHLAAREGHKDVASILLDQGASLGITTKKGFTPLHVAAKYGKIEVANLLLQKRAPPDASGKSGLTPLHVAAHYDNQKVALLLLDQGASPHAAAKNGYTPLHIAAKKNQMEIATTLLEYGADTNAITRQGISP 614          

HSP 11 Score: 81.6481 bits (200), Expect = 3.498e-15
Identity = 37/125 (29.60%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N+NG   LH     GH+++V  L+     ++  T  G   +H A   G  ++ KEL+     ++ Q++ G+T ++ AA   H++VV+ L++   +  I  +DG  P+ +A   GH ++V LL+ N
Sbjct:   18 NQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLEN 142          

HSP 12 Score: 79.7221 bits (195), Expect = 1.215e-14
Identity = 57/225 (25.33%), Postives = 95/225 (42.22%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKD----------------------CLL-------DIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKN 769
            +HIA   G  ++ + +V    N    ++NG+ PL+      HLD+V+ LL      +  T DG  P+  A   GH ++   L+  D                       LL       D+++K G+T +H AA  G+I V  LL+ +    D + ++   P+ +A   G+  +VKLL+          +DG+ P   G     ++ +E L  +     I S  KN
Sbjct:   58 LHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITPLHVASKRGNSNMVKLLLERGARIDAKTKDGLTPLHCGARSGHEQVVEML--LDRGAPILSKTKN 280          

HSP 13 Score: 79.337 bits (194), Expect = 1.779e-14
Identity = 47/194 (24.23%), Postives = 81/194 (41.75%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A  +G  E+   ++      + + K G   LH     G  D+V+ L++    +N Q+ +G  P++ A    H ++ + L+       I T+ G+T +  A   GH +VV LL+E                                N D++ K G  P+ IA  YG+I +  LL+N        AR+ + P
Sbjct:   25 LHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRGAAVDFKARNDITP 218          

HSP 14 Score: 74.7146 bits (182), Expect = 5.268e-13
Identity = 35/116 (30.17%), Postives = 60/116 (51.72%), Query Frame = 2
Query:  329 LSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            L    +IN    +G+  +H A   GH E+  +LI     +D  TK+G T++H A+  G  +VVK L+    N + Q ++G  P+ +A    H+++V+ L++N +       DG  P
Sbjct:    8 LKSGVDINICNQNGLNALHLASKEGHVEVVTQLIKMGATVDAATKKGNTALHIASLAGQSDVVKELVTNGANVNAQSQNGFTPLYMAAQENHLDVVRYLLDNGSSQSIATEDGFTP 123          

HSP 15 Score: 72.7886 bits (177), Expect = 1.798e-12
Identity = 44/176 (25.00%), Postives = 74/176 (42.05%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIH---------------------------WAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+HIA  K   E+A  ++    +     + G  PLH     G++D+V LL+++D  IN     G+ P+H A       +A+ L+     +D +TK G+T +H                            AA  GH  ++ LL++     +    +G   + IA   G+I +V  L
Sbjct:  581 PLHIAAKKNQMEIATTLLEYGADTNAITRQGISPLHLASQEGNVDMVTLLMARDATINLCNKSGLTPLHLAAQEDQVNVAEVLVNHGATVDPETKMGYTPLHVACHYGNVKMVHFLLKNQAKVNAKTKVTAAQQGHTHIINLLLQHGAAPNELTVNGNTALSIARRLGYISVVDTL 756          
BLAST of SMED30023739 vs. Ensembl Cavefish
Match: ENSAMXT00000017800.2 (pep primary_assembly:Astyanax_mexicanus-2.0:16:21012912:21225385:-1 gene:ENSAMXG00000017269.2 transcript:ENSAMXT00000017800.2 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.0561 bits (240), Expect = 8.091e-20
Identity = 48/166 (28.92%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  +++K  +   + KNG+ PLH       ++I   LL  + E N  T  G+ P+H A   GH ++A  L+ K   +++ TK G T++H AA    + V ++L++   + D Q K G  P+++AC YG+ ++V  L+ +        ++G  P
Sbjct:  595 PLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVNAKTKNGYTP 760          

HSP 2 Score: 90.1225 bits (222), Expect = 9.393e-18
Identity = 46/152 (30.26%), Postives = 81/152 (53.29%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQD--KDGCRPILIACAYGHIEIVKLLI 628
            P+H+A  +G   M   ++++    +   ++G  PLH    +GH   V+LLL +   I  +T +G+ P+H A    H E  K L+     +D  T    T++H AA  GH  V KLL++K+ N + +   ++G  P+ IAC    +++++LL+
Sbjct:  263 PLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLV 414          

HSP 3 Score: 88.1965 bits (217), Expect = 3.728e-17
Identity = 47/154 (30.52%), Postives = 84/154 (54.55%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYS-NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            P+HIA + G   +A  ++N+    +++  +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH    + L+ +   +  +TK G + +H AA   H+E VK L++ K   D    D    + +A   GH  + KLL++ +
Sbjct:  229 PLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKR 382          

HSP 4 Score: 85.5001 bits (210), Expect = 2.354e-16
Identity = 54/191 (28.27%), Postives = 89/191 (46.60%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSN--KNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCLEFLGGIQHS 742
            +H+A + G + + + +++K+ N       +NG+ PLH  C    + +++LL+     I   T  G+ PIH A   GH  I   L+      D+   +G T++H AA  G +EVV+ L+      D + ++   P+ IA   G  EIV+LL+ +         +G  P    A E  LD   +    G  HS
Sbjct:  363 LHVAAHCGHYRVTKLLLDKRANPNARALLQNGFTPLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHS 553          

HSP 5 Score: 85.5001 bits (210), Expect = 2.718e-16
Identity = 41/126 (32.54%), Postives = 69/126 (54.76%), Query Frame = 2
Query:  257 SNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            SN+NG   LH     GH+D+VQ LL +   ++  T  G   +H A   G  E+ K L+ +   ++ Q++ G+T ++ A+   H++VV+ L+E   N     +DG  P+ IA   GH ++V +L+ N
Sbjct:   61 SNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN 186          

HSP 6 Score: 80.8777 bits (198), Expect = 6.360e-15
Identity = 46/182 (25.27%), Postives = 85/182 (46.70%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFL 724
            P+H+A   G  ++A+ ++ ++   + + KNG  PLH      +  +  LLL K    +    +G  P+H A      EIA  L+  +   +I TKQG T +H A+  GH ++  LL++K    ++  K G   + +A     + + ++L+ N        + G  P +    + + K + FL
Sbjct:  562 PLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGNAKMVNFL 743          

HSP 7 Score: 80.1073 bits (196), Expect = 1.102e-14
Identity = 44/169 (26.04%), Postives = 80/169 (47.34%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGV 670
            T    P+HI+  +G  ++A  ++    +   + K G+ PLH     G LD+ +LLL +    +    +G+ P+H A    + ++A  L+ K        K G+T +H AA    +E+   L++ +  T+I  K G  P+ +A   GH ++  LL+        P + G+
Sbjct:  524 TNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQVNVPTKSGL 692          

HSP 8 Score: 79.337 bits (194), Expect = 2.278e-14
Identity = 53/188 (28.19%), Postives = 84/188 (44.68%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCLEFLGGIQ 736
            P+HIA   G  E+ + ++    + + +  NG+ PLH     G LD+  +LL      +  T  G  P+H A   G  ++AK L+ +    D   K G T +H AA   + +V  LL++K  +     K+G  P+ IA     +EI   L+  +  +    + GV P    + E H D   L    G Q
Sbjct:  496 PLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTPLHIAAKKNQMEIATTLLQYEAETNILTKQGVTPLHLASQEGHSDMAALLLQKGAQ 683          

HSP 9 Score: 78.9518 bits (193), Expect = 2.376e-14
Identity = 52/222 (23.42%), Postives = 98/222 (44.14%), Query Frame = 2
Query:  107 LKGIMDL--SNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVAP 676
            LKG +D+  SN N +N +          H+A  +G  ++ + ++ +  + + + K G   LH     G  ++V++L+ +  +IN Q+ +G  P++ A    H ++ + L+         T+ G+T +  A   GH +VV +L+E                                N D+Q K G  P+ IA  YG++ +  LL+N    + F   ++G+ P
Sbjct:   52 LKGGVDIGTSNQNGLNAL----------HLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITP 263          

HSP 10 Score: 77.7962 bits (190), Expect = 5.869e-14
Identity = 42/166 (25.30%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   ++    + + SN  G   LH     G +++V+ LL     ++ +  +   P+H A   G  EI + L+      D  T  G+T +H +A  G ++V  +L+E   +  +  K G  P+ +A  YG +++ KLL+  +       ++G+ P
Sbjct:  430 PIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTP 595          

HSP 11 Score: 77.411 bits (189), Expect = 7.008e-14
Identity = 42/166 (25.30%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K   ++ E +V    + +   ++G  P+H     GHL+IV LLL      +     G   +H A   G  E+ + L+    ++D + ++  T +H A+  G  E+V+LL++   + D    +G  P+ I+   G +++  +L+          + G  P
Sbjct:  397 PLHIACKKNRVKVMELLVKYGASIQAITESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETALHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTP 562          

HSP 12 Score: 77.411 bits (189), Expect = 7.955e-14
Identity = 43/165 (26.06%), Postives = 79/165 (47.88%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A   G  E+   ++      +   +    PLH     G  +IVQLLL      +  T +G  P+H +   G  ++A  L+       + TK+G+T +H A+  G ++V KLL++++   D   K+G  P+ +A  Y + ++  LL++        A++G  P
Sbjct:  464 LHMAARAGQVEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLDVASVLLEAGASHSLATKKGFTPLHVASKYGSLDVAKLLLQRRAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHATAKNGYTP 628          

HSP 13 Score: 76.6406 bits (187), Expect = 1.524e-13
Identity = 36/125 (28.80%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G++D V   L    +I     +G+  +H A   GH ++ +EL+ +   +D  TK+G T++H A+  G  EVVK+L+++  + + Q ++G  P+ +A    H+++V+ L+ N         DG  P
Sbjct:   43 GNIDKVLEYLKGGVDIGTSNQNGLNALHLAAKEGHMDLVQELLERGSSVDSATKKGNTALHIASLAGQAEVVKILVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTP 167          

HSP 14 Score: 67.0106 bits (162), Expect = 1.051e-10
Identity = 36/149 (24.16%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +MA  ++ K        K+G   LH       + + ++L+     ++ QT  G  P+  AC  G+ ++   L+  +  ++ +TK G+T +H AA  G+  ++ +L++     +    +G   + IA   G+I +V  L
Sbjct:  661 PLHLASQEGHSDMAALLLQKGAQVNVPTKSGLTALHLAAQEDRVGVAEILVKNGASMDQQTKLGYTPLIVACHYGNAKMVNFLLKSNASVNAKTKNGYTPLHQAAQQGNTHIINVLLQYGAKPNAITVNGNTALAIARRLGYISVVDTL 809          

HSP 15 Score: 67.0106 bits (162), Expect = 1.266e-10
Identity = 45/213 (21.13%), Postives = 91/213 (42.72%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCE-----------------------------INCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQ-GWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            L+ +  DI   ++    P+++A  +   ++  +++    N   + ++G+ PL      GH  +V +LL  D +                              + Q+  G  P+H A   G+  +A  L+ +   +D   +Q G T +H A+  G+  +V+LL+++    D + +DG  P+  A   GH   V+LL+          ++G++P
Sbjct:  117 LVKQGADINAQSQNGFTPLYMASQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARQNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHDTAVELLLERGAPILARTKNGLSP 329          
BLAST of SMED30023739 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000093.1 (pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000093.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 4.455e-22
Identity = 53/173 (30.64%), Postives = 86/173 (49.71%), Query Frame = 2
Query:  167 TNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TN R   P+H+A   G  E+ + ++          +    PLH     G  +IVQLLL +  + N  T  G  P++FA   GH ++A  L+     +   TK+G+T +H A+  G +EV  LL+EK  + D + K+G  P+ +A  Y H ++  LL++        A++G  P
Sbjct:  439 TNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTP 611          

HSP 2 Score: 100.908 bits (250), Expect = 5.713e-22
Identity = 49/166 (29.52%), Postives = 89/166 (53.61%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA + G   +A  ++N     +++ +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH ++ + L+ +D  +  +TK G + +H A    H+  V+LL+ ++   D    D   P+ +A   GH  + KLL++        A +G  P
Sbjct:  215 PLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTP 380          

HSP 3 Score: 96.2857 bits (238), Expect = 1.627e-20
Identity = 46/166 (27.71%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  +++K  +   + KNG+ PLH       L++ ++LL    E N  T  G+ P+H A   GH ++   L+ +   + + TK G T++H AA    + V ++L + K + +   K    P+ +A  YG+I++V  L+ N+ +     R+G  P
Sbjct:  578 PLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTP 743          

HSP 4 Score: 95.9005 bits (237), Expect = 2.085e-20
Identity = 46/166 (27.71%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A + G + +A+ ++++         NG+ PLH  C    + +++LLL     I+  T  G+ PIH A   GH  + + L+      +    +G T +H A+  G +EVVK L++      ++ ++   P+ IA   G  EIV+LL+   +    P   G  P
Sbjct:  347 PLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTP 512          

HSP 5 Score: 95.9005 bits (237), Expect = 2.140e-20
Identity = 67/229 (29.26%), Postives = 107/229 (46.72%), Query Frame = 2
Query:   86 DFVLQNNLKGIMDL------SNPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLE 718
            DF  +N   GI  L       N N++  ++D    I T TR    P+H A   G  ++ E ++ +        KNG  PLH      HL  VQLLL +   ++  T D + P+H A   GH+ +AK L+ +    + +   G+T +H A     I+V++LL++   +     + G  PI +A   GH+ +V+LL+ N   S      G  P    S AG++ + K  L+
Sbjct:  239 DFTARN---GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQ 464          

HSP 6 Score: 95.9005 bits (237), Expect = 2.252e-20
Identity = 43/152 (28.29%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIAC K   ++ E ++    +   + ++G  P+H     GHL++VQLLL      N     G  P+H A   G  E+ K L+     + ++ ++  T +H A+  G  E+V+LL+++  + +     G  P+  A   GH ++  LL+ N
Sbjct:  380 PLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLEN 531          

HSP 7 Score: 88.1965 bits (217), Expect = 5.017e-18
Identity = 44/166 (26.51%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   + + ++    +   +N  G  PLH     G L++V+ LL     +  +  +   P+H A   G  EI + L+ +    +  T  G T +++A+  GH +V  LL+E   +     K G  P+ IA  YG +E+  LL+     +    ++G+ P
Sbjct:  413 PIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTP 578          

HSP 8 Score: 88.1965 bits (217), Expect = 5.801e-18
Identity = 54/181 (29.83%), Postives = 83/181 (45.86%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCL 715
            P+HIA   G  E+ + ++ +  +      +G  PL+     GH D+  LLL    +I+  T  G  P+H A   G  E+A  L+ K    D + K G T +H A    H +V  LL++K  +     K+G  P+ IA     +E+ K+L+     +    + GVAP    A E H D   L
Sbjct:  479 PLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVAL 659          

HSP 9 Score: 87.8113 bits (216), Expect = 6.373e-18
Identity = 52/194 (26.80%), Postives = 92/194 (47.42%), Query Frame = 2
Query:   50 ILIRMSESEIFKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            I  R+ ++EI +  +LQ         S+PN         + + P++ A  +G  ++A  ++    +     K G+ PLH     G L++  LLL K    + +  +G+ P+H A    H ++A  L+ K        K G+T +H AA    +EV K+L+E    T++  + G  P+ +A   GH ++V LL+ 
Sbjct:  482 IASRLGKAEIVQ-LLLQRG-------SDPN-----APTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLG 662          

HSP 10 Score: 86.2705 bits (212), Expect = 2.037e-17
Identity = 40/123 (32.52%), Postives = 68/123 (55.28%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            N+NG   LH     GH+D+V  LL ++ EI+  T  G   +H A   G  +I + L+     ++ Q++ G+T ++ AA   H+E+VK L++   N  +  +DG  P+ +A   GH ++V LL+
Sbjct:   40 NQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLL 162          

HSP 11 Score: 82.4185 bits (202), Expect = 2.805e-16
Identity = 40/129 (31.01%), Postives = 68/129 (52.71%), Query Frame = 2
Query:  290 CCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
               NG+L+ +   L    +IN    +G+  +H A   GH ++  EL+ ++  +D  TK G T++H AA  G  ++V++L+E   N + Q ++G  P+ +A    H+EIVK L++N         DG  P
Sbjct:   17 AARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTP 145          

HSP 12 Score: 79.7221 bits (195), Expect = 2.350e-15
Identity = 130/586 (22.18%), Postives = 218/586 (37.20%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDK--------DGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVAPSVAGEIHLDKKCLEFL--GGIQHSKQIFSCLKNIDCDKFSTFYRPITLM-----SIEEKTR--ISVLEFAT--EXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYR------------------CIKNR--HME-----GFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKD---AEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRI--GTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETILPLTTKENAL 1735
            L+ +  +I T T+     +HIA   G  ++   +V    N    ++NG+ PL+      HL+IV+ LL      +  T DG  P+  A   GH ++   L+  D     + K    ++H AA         LL++ + N D+  K         G  P+ IA  YG++ +  LL+N    + F  AR+G+ P        +   ++ L   G +   +    L  + C   S   + I ++      I  KT+  +S L  AT  E+     + +    PV DD     + PL+     G + + +  L R                  C KNR   ME     G  I ++ ++   P        + +A        ++ +LQ          R +     A +  Q+E++  +      +  + + + + LH A      ++V+ +L        D N P     T L FA    H     +L +   D +   K   T LH A   G       L++     D     G+T LH A     + +   LL KGA         P     +  T L +  K+N L
Sbjct:   62 LLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDT----KGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKMMLNQTTESGFTPLHIAAHYGNMNVATLLLNLGAAVDFT-ARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPV-DDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTP--------IHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQR----GSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKGKNGLTPLHVATHYDHQKVALLLLDKGAS--------PHSTAKNGYTPLHIAAKKNQL 621          

HSP 13 Score: 78.5666 bits (192), Expect = 5.151e-15
Identity = 40/153 (26.14%), Postives = 72/153 (47.06%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            P+HIA  K   E+ + ++          + G  PLH     GH D+V LLL +   I+  T  G+  +H A       +A+ L      ++  TK  +T +H A+  G+I++V  L+  +   + + ++G  P+  A   GH  +V  L+ ++
Sbjct:  611 PLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHE 763          

HSP 14 Score: 75.0998 bits (183), Expect = 5.199e-14
Identity = 35/149 (23.49%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   ++ +  +   + K G   +H       +++ ++L     ++N  T     P+H A   G+ ++   L+    L++ +T+ G+T +H AA  GH  VV  L++ + + +    +G   + IA   G+I +V  L
Sbjct:  644 PLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 792          
BLAST of SMED30023739 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000095.1 (pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 gene:ENSPMAG00000000080.1 transcript:ENSPMAT00000000095.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.908 bits (250), Expect = 5.482e-22
Identity = 51/175 (29.14%), Postives = 94/175 (53.71%), Query Frame = 2
Query:  158 DITTNT--RPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            D+T+ +   P+HIA + G   +A  ++N     +++ +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH ++ + L+ +D  +  +TK G + +H A    H+  V+LL+ ++   D    D   P+ +A   GH  + KLL++        A +G  P
Sbjct:  199 DVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTP 373          

HSP 2 Score: 96.6709 bits (239), Expect = 1.247e-20
Identity = 46/166 (27.71%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  +++K  +   + KNG+ PLH       L++ ++LL    E N  T  G+ P+H A   GH ++   L+ +   + + TK G T++H AA    + V ++L + K + +   K    P+ +A  YG+I++V  L+ N+ +     R+G  P
Sbjct:  573 PLHVATHYDHQKVALLLLDKGASPHSTAKNGYTPLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTP 738          

HSP 3 Score: 95.9005 bits (237), Expect = 2.032e-20
Identity = 52/175 (29.71%), Postives = 86/175 (49.14%), Query Frame = 2
Query:  167 TNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTD--IQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TN R   P+H+A   G  E+ + ++          +    PLH     G  +IVQLLL +  + N  T  G  P++FA   GH ++A  L+     +   TK+G+T +H A+  G +EV  LL+EK  + D  +  ++G  P+ +A  Y H ++  LL++        A++G  P
Sbjct:  432 TNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLLEKYASADPKVAGQNGLTPLHVATHYDHQKVALLLLDKGASPHSTAKNGYTP 606          

HSP 4 Score: 95.5153 bits (236), Expect = 3.041e-20
Identity = 43/152 (28.29%), Postives = 76/152 (50.00%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIAC K   ++ E ++    +   + ++G  P+H     GHL++VQLLL      N     G  P+H A   G  E+ K L+     + ++ ++  T +H A+  G  E+V+LL+++  + +     G  P+  A   GH ++  LL+ N
Sbjct:  373 PLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLEN 524          

HSP 5 Score: 95.1301 bits (235), Expect = 3.257e-20
Identity = 67/229 (29.26%), Postives = 107/229 (46.72%), Query Frame = 2
Query:   86 DFVLQNNLKGIMDL------SNPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLE 718
            DF  +N   GI  L       N N++  ++D    I T TR    P+H A   G  ++ E ++ +        KNG  PLH      HL  VQLLL +   ++  T D + P+H A   GH+ +AK L+ +    + +   G+T +H A     I+V++LL++   +     + G  PI +A   GH+ +V+LL+ N   S      G  P    S AG++ + K  L+
Sbjct:  232 DFTARN---GITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQAPVDDVTLDYLTPLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQ 457          

HSP 6 Score: 95.1301 bits (235), Expect = 3.673e-20
Identity = 46/166 (27.71%), Postives = 81/166 (48.80%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A + G + +A+ ++++         NG+ PLH  C    + +++LLL     I+  T  G+ PIH A   GH  + + L+      +    +G T +H A+  G +EVVK L++      ++ ++   P+ IA   G  EIV+LL+   +    P   G  P
Sbjct:  340 PLHVAAHCGHYRVAKLLLDRGGEPNARALNGFTPLHIACKKNRIKVMELLLKHGASIHTTTESGLTPIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTP 505          

HSP 7 Score: 88.5817 bits (218), Expect = 3.564e-18
Identity = 43/152 (28.29%), Postives = 84/152 (55.26%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA  K     A  ++  + N + ++K+G+ PLH     G++++  LLL+    ++    +G+ P+H A   G+  + K L+ +   +D +T+ G T +H AA +GH +V+++L+E+      + K+G  P+ +A    H+  V+LL+  Q
Sbjct:  176 LHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGEHLACVQLLLGRQ 327          

HSP 8 Score: 86.6557 bits (213), Expect = 1.664e-17
Identity = 60/226 (26.55%), Postives = 99/226 (43.81%), Query Frame = 2
Query:   95 LQNNLKGIMDLS--NPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDKDGCRPILIACAYGHIEIVKLLIN-NQNISFCPARDGVAP 676
            L ++LKG MD++  N N +N +          H+A  +G  ++   ++ ++   + + K G   LH     G  DIV++L+     IN Q+ +G  P++ A    H EI K L+       + T+ G+T +  A   GH +VV LL+E                                N D+  K G  P+ IA  YG++ +  LL+N    + F  AR+G+ P
Sbjct:   27 LMDHLKGGMDINTCNQNGLNAL----------HLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFT-ARNGITP 241          

HSP 9 Score: 85.1149 bits (209), Expect = 4.338e-17
Identity = 42/150 (28.00%), Postives = 71/150 (47.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            PIH+A   G   + + ++    +   +N  G  PLH     G L++V+ LL     +  +  +   P+H A   G  EI + L+ +    +  T  G T +++A+  GH +V  LL+E   +     K G  P+ IA  YG +E+  LL+
Sbjct:  406 PIHVASFMGHLNVVQLLLQNGASSNATNVRGETPLHMASRAGQLEVVKTLLQSGARVGVKAREDQTPLHIASRLGKAEIVQLLLQRGSDPNAPTASGSTPLYFASREGHGDVASLLLENGADISPVTKKGFTPLHIASKYGRLEVATLLL 555          

HSP 10 Score: 82.4185 bits (202), Expect = 3.437e-16
Identity = 40/129 (31.01%), Postives = 68/129 (52.71%), Query Frame = 2
Query:  290 CCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
               NG+L+ +   L    +IN    +G+  +H A   GH ++  EL+ ++  +D  TK G T++H AA  G  ++V++L+E   N + Q ++G  P+ +A    H+EIVK L++N         DG  P
Sbjct:   18 AARNGNLERLMDHLKGGMDINTCNQNGLNALHLASKEGHVDVVTELLKREAEIDTATKVGNTALHIAALAGQTDIVRVLVEFGANINAQSQNGFTPLYMAAQENHLEIVKFLLDNGANQSVATEDGFTP 146          

HSP 11 Score: 81.2629 bits (199), Expect = 7.677e-16
Identity = 51/218 (23.39%), Postives = 96/218 (44.04%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCE-----------------------------INCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP---SVAGEIHLDKKCLEFLGGIQ 736
            P+++A  +   E+ +F+++   N   + ++G+ PL      GH  +V LLL  D +                              +  +  G  P+H A   G+  +A  L+     +D   + G T +H AA  G+  +VKLL+++    D + +DG  P+  A   GH +++++L+          ++G++P   +  GE HL   C++ L G Q
Sbjct:  113 PLYMAAQENHLEIVKFLLDNGANQSVATEDGFTPLAVALQQGHEQVVGLLLESDTKGKVRLPALHIAARKDDTNAAALLLQHEHNADVTSKSGFTPLHIAAHYGNMNVATLLLNLGAAVDFTARNGITPLHVAAKRGNNNMVKLLLDRGAKIDTKTRDGLTPLHCAARSGHEKVIEMLLERDAPILAKTKNGLSPLHMATQGE-HL--ACVQLLLGRQ 327          

HSP 12 Score: 78.9518 bits (193), Expect = 3.927e-15
Identity = 40/153 (26.14%), Postives = 72/153 (47.06%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            P+HIA  K   E+ + ++          + G  PLH     GH D+V LLL +   I+  T  G+  +H A       +A+ L      ++  TK  +T +H A+  G+I++V  L+  +   + + ++G  P+  A   GH  +V  L+ ++
Sbjct:  606 PLHIAAKKNQLEVGKVLLELGAETNMLTQQGVAPLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHE 758          

HSP 13 Score: 75.485 bits (184), Expect = 4.481e-14
Identity = 35/149 (23.49%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +M   ++ +  +   + K G   +H       +++ ++L     ++N  T     P+H A   G+ ++   L+    L++ +T+ G+T +H AA  GH  VV  L++ + + +    +G   + IA   G+I +V  L
Sbjct:  639 PLHLAAQEGHADMVALLLGRHASISLATKGGLTAMHLAAQEDKVNVAEILTKHKADVNTTTKLCYTPLHVASHYGNIKMVNFLLRNRALVNAKTRNGYTPLHQAAQQGHTHVVNALLQHEASPNELTANGNTALAIARRLGYISVVDTL 787          
BLAST of SMED30023739 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002048.1 (pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 gene:ENSPMAG00000001850.1 transcript:ENSPMAT00000002048.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 93.5893 bits (231), Expect = 1.528e-19
Identity = 45/149 (30.20%), Postives = 82/149 (55.03%), Query Frame = 2
Query:  188 IACNKGFFEMAEFMVNKKCNFEYSNKNG-WRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPIL-IACAYGHIEIVKLLI 628
            +AC+ G++E+A+ ++    N E     G   PL    + G +DIV+LLL+   ++N Q++ G   + +ACA G+ ++ + L+     L+   + G T +  AA  GH+EV +LL+E+    +    +     L +AC  GH+E+V+ L+
Sbjct:  139 LACSAGYYELAQVLLAMHANVEDRGVKGDITPLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLL 287          

HSP 2 Score: 92.8189 bits (229), Expect = 2.419e-19
Identity = 47/168 (27.98%), Postives = 88/168 (52.38%), Query Frame = 2
Query:  143 INKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMR--PIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQN 640
            IN  I+   NT  + +AC +G  E+   +V +K N E+  K G  PL    + G+ ++ ++LL +  ++N       R   +  A   GH++  + +I++   +D++ K+G T +  AA  GH++VV+LL+    + D  D     P++ A   GH+++V+ L+   N
Sbjct: 1094 INAQIETNRNTA-LTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNSGADVDAADNRKITPLMAAFRKGHVKVVRYLVKEVN 1260          

HSP 3 Score: 85.5001 bits (210), Expect = 4.895e-17
Identity = 42/156 (26.92%), Postives = 78/156 (50.00%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTND-GMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +T    +  AC  G+ ++   ++    N E  N++G  PL    + GH+++ +LLL +   IN  +N+     +  AC  GH E+ + L+      + +T +  T++  A  +GH+EV +LL+E     ++       P+ +A   GH+E+  LLI
Sbjct:  198 STGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLI 353          

HSP 4 Score: 85.1149 bits (209), Expect = 5.704e-17
Identity = 46/155 (29.68%), Postives = 80/155 (51.61%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPIL-IACAYGHIEIVKLLI 628
            T    + +AC  GF E+A+F++    + E        PL      GHL++V+ LL+    ++  T  G   + +AC NGH ++A  L+     L+ +++ G T +  AA  GH+  V+ LI K  + +    +    +L +ACA GH+ +V+LL+
Sbjct:  399 TQETALTLACCGGFLEVADFLIKAGADLELGCST---PLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLL 550          

HSP 5 Score: 83.1889 bits (204), Expect = 2.277e-16
Identity = 44/153 (28.76%), Postives = 79/153 (51.63%), Query Frame = 2
Query:  188 IACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQ---TNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC--NTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            +AC  G  ++   ++ +  N E+ +K G+ PL      GH+++V+LLL    +I  Q   T D   P+  AC+ G  E+ + LIA+    + +    +T +  AA  G++ ++K+L+      N+    K G  P+++A   GH   VKLL++
Sbjct:  939 LACAGGHEDLVTVLIARGANIEHRDKKGFTPLILAATAGHVNVVELLLDNGADIEAQSERTKD--TPLSLACSGGRQEVVELLIARGANKEHRNVSDYTPLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLD 1089          

HSP 6 Score: 82.4185 bits (202), Expect = 3.757e-16
Identity = 44/148 (29.73%), Postives = 73/148 (49.32%), Query Frame = 2
Query:  188 IACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPIL-IACAYGHIEIVKLLI 628
            +AC KG  EM  F++    + E+        L   C +GH+++ +LLL    ++N   +    P+  A   GH E+A  LI +   L+    +G+T +  AA  GH E+V LL+ +  N + Q ++     L +AC  G +E+   LI
Sbjct:  273 LACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPADSFESPLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLI 420          

HSP 7 Score: 82.0333 bits (201), Expect = 5.144e-16
Identity = 47/182 (25.82%), Postives = 78/182 (42.86%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMR-------------------------------PIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            P+ +A   G  E+A  ++ +  N E  N  G+ PL      GH ++V LLL++   IN QT +                                  P+  A   GH E+ K L+A    +   T  G T++ +A  NGH +V  LL++   + + + + G  P++ A   GH+  V+ LI+
Sbjct:  336 PLTLAACGGHVELAALLIERGANLEEVNDEGYTPLMEAAREGHEEMVALLLAQGANINAQTEETQETALTLACCGGFLEVADFLIKAGADLELGCSTPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLIS 517          

HSP 8 Score: 78.5666 bits (192), Expect = 6.082e-15
Identity = 42/168 (25.00%), Postives = 82/168 (48.81%), Query Frame = 2
Query:  158 DITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAAC-NGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPA 658
            DIT    P+  A + GF ++   ++    +    +  G   L + CA G++D+V++LL     +      G  P+  A + GH E+A+ L+ +   ++  + +   S    AC  GH+E+V+ L+E   + + +  +    ++ AC  GH+E+ +LL+ +      PA
Sbjct:  167 DIT----PLMAAASGGFVDIVRLLLAHGADVNAQSSTGNTALTYACAGGYVDVVRVLLEAGANLEDHNESGHTPLMEAASGGHVEVARLLLERGAGINTHSNEFKESALTLACYKGHLEMVRFLLEAGADQEHKTDEMHTALMEACMDGHVEVARLLLESGAQVNMPA 330          

HSP 9 Score: 72.0182 bits (175), Expect = 5.888e-13
Identity = 41/154 (26.62%), Postives = 73/154 (47.40%), Query Frame = 2
Query:  173 TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAAC-NGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            + P+  A  +G  E+ ++++    N   +   G   L + C NGH D+  LLL    ++  ++  G  P+  A   GH    + LI+K   ++  T     ++   AC  GH+ VV+LL+    + + + KDG   ++ A   GH  +V  LI+
Sbjct:  431 STPLMEAAQEGHLELVKYLLAAGANVHATTATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLID 584          

HSP 10 Score: 68.9366 bits (167), Expect = 5.862e-12
Identity = 47/191 (24.61%), Postives = 83/191 (43.46%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKC--NFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQ--TNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNT-----------------------------------DIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+ +A + G+  + + ++N     N    +K G  PL     NGH   V+LLL    +IN Q  TN     +  AC  G  E+   L+ +   ++ + K G T +  AA  G+ EV ++L+E+  +                                    D+++K G  P+ +A   GH+++V+LL+N+
Sbjct: 1036 PLSLAASGGYVNIIKILLNAGAEINSRTGSKLGISPLMLAAMNGHTAAVKLLLDMGSDINAQIETNRNTA-LTLACFQGRHEVVSLLVERKANVEHRAKTGLTPLMEAASGGYAEVGRVLLERGADVNAAPVPSSRDTALTIAADKGHYKFCELVISRGAHIDVRNKKGNTPLWLAANGGHLDVVQLLVNS 1225          

HSP 11 Score: 64.3142 bits (155), Expect = 1.199e-10
Identity = 38/128 (29.69%), Postives = 61/128 (47.66%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQT-NDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCN 544
             T    +  AC  G  ++A+ ++    + E+ ++ G  PL      GH+  VQ L+SK  ++N  T N+    +  ACA GH  + + L+A     + + K G T +  AA  GH  VV  LI+   N
Sbjct:  461 ATGDTALTYACENGHTDVADLLLQAGADLEHESEGGRTPLMKAARAGHVCTVQFLISKGADVNRATANNDHTVLSLACAGGHLSVVELLLAHGADPNHRLKDGSTMLIEAAKGGHTSVVCYLIDYPHN 588          
BLAST of SMED30023739 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007446.1 (pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 3.612e-19
Identity = 45/166 (27.11%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  ++++  +   + KNG+ PLH       L+I   LL    E N  T  G+ P+H     GH ++A  L+A+   ++  TK G + +H AA    + V ++L++   + +   K G  P+++AC YG+I++V  L+ +        ++G  P
Sbjct:  306 PLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTP 471          

HSP 2 Score: 89.7373 bits (221), Expect = 1.977e-18
Identity = 49/174 (28.16%), Postives = 84/174 (48.28%), Query Frame = 2
Query:  164 TTNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
             TN R    +H+A   G  E+   ++      +   +    PLH     G L+IVQLLL      +  T++G  P+H A   GH ++   L+     L + TK+G+T +H A+  G +EV  LL+++  + D   K+G  P+ +A  Y + ++  LL++        A++G  P
Sbjct:  166 ATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTP 339          

HSP 3 Score: 88.1965 bits (217), Expect = 7.507e-18
Identity = 52/181 (28.73%), Postives = 81/181 (44.75%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAG--EIHLDKKCL 715
            P+HIA   G  E+ + ++    + + +  NG+ PLH     GH D+  +LL     +   T  G  P+H A   G  E+A  L+ +    D   K G T +H A+   + +V  LL+++  +     K+G  P+ IA     +EI   L+     +    R GVAP   G  E H D   L
Sbjct:  207 PLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASL 387          

HSP 4 Score: 85.1149 bits (209), Expect = 5.164e-17
Identity = 43/166 (25.90%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + E ++    + E   ++G  P+H     G+L+IV +LL      N     G   +H A   G  E+ + L+     +D + ++  T +H AA  G +E+V+LL++   + D    +G  P+ +A   GH ++  +L+ +        + G  P
Sbjct:  108 PLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTP 273          

HSP 5 Score: 85.1149 bits (209), Expect = 5.669e-17
Identity = 44/150 (29.33%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+HIA  K   E+A  ++          + G  PLH     GH D+  LLL++  ++N  T  G+ P+H A       +A+ L+     ++  TK G+T +  A   G+I++V  L++   + + + K+G  P+  A   GH  IV LL+
Sbjct:  339 PLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 488          

HSP 6 Score: 84.7297 bits (208), Expect = 7.632e-17
Identity = 45/165 (27.27%), Postives = 78/165 (47.27%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A + G +  A+ +++K  N      NG+ PLH  C    + +++LLL     I   T  G+ P+H +   G+  I   L+      +    +G T++H AA  G  EVV+ L+      D + ++   P+ IA   G +EIV+LL+ +         +G  P
Sbjct:   76 LHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTP 240          

HSP 7 Score: 81.6481 bits (200), Expect = 6.061e-16
Identity = 41/166 (24.70%), Postives = 75/166 (45.18%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H++   G   +   ++    +   +N  G   LH     G  ++V+ LL    +++ +  +   P+H A   G  EI + L+      D  T  G+T +H AA  GH +V  +L+E   +  +  K G  P+ +A  YG +E+  LL+          ++G+ P
Sbjct:  141 PMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTP 306          

HSP 8 Score: 76.2554 bits (186), Expect = 3.165e-14
Identity = 40/151 (26.49%), Postives = 75/151 (49.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQD--KDGCRPILIACAYGHIEIVKLL 625
            P+H+   +G  ++A  ++ +  +  ++ K+G  PLH       +++ ++L+     +N  T  G  P+  AC  G+ ++   L+     ++ +TK G+T +H AA  GH  +V LL+  KC     D   +G   + IA   G+I +V  L
Sbjct:  372 PLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGARPNDVTVNGNTALAIARRLGYISVVDTL 520          

HSP 9 Score: 75.0998 bits (183), Expect = 7.209e-14
Identity = 38/122 (31.15%), Postives = 66/122 (54.10%), Query Frame = 2
Query:  263 KNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            ++G  PLH    +GH  +V++LL +   I  +T +G+ P+H A    H E  + L+     +D  T    T++H AA  GH    K+L++K  N +++  +G  P+ IAC    I +++LL+
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLL 125          

HSP 10 Score: 73.9442 bits (180), Expect = 1.684e-13
Identity = 39/152 (25.66%), Postives = 74/152 (48.68%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+H A   G  ++ E ++ +        KNG  PLH      H++ VQ+L+     ++  T D +  +H A   GH+  AK L+ K    +++   G+T +H A     I V++LL++   + +   + G  P+ ++   G++ IV +L+  
Sbjct:    9 PLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQG 160          

HSP 11 Score: 50.447 bits (119), Expect = 2.051e-6
Identity = 27/105 (25.71%), Postives = 51/105 (48.57%), Query Frame = 2
Query:  362 NDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
             DG+ P+H A  +GH ++ + L+ +   +  +TK G + +H A    H+E V++L++ +   D    D    + +A   GH    K+L++        A +G  P
Sbjct:    4 QDGLTPLHCAARSGHEQVVEILLEQGAPILAKTKNGLSPLHMATQGDHVECVQVLMQYRAPVDDITLDYLTALHVAAHCGHYRTAKVLLDKGANPNVRALNGFTP 108          
BLAST of SMED30023739 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007449.1 (pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1 gene:ENSPMAG00000006704.1 transcript:ENSPMAT00000007449.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.0485 bits (227), Expect = 3.750e-19
Identity = 45/166 (27.11%), Postives = 85/166 (51.20%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  ++++  +   + KNG+ PLH       L+I   LL    E N  T  G+ P+H     GH ++A  L+A+   ++  TK G + +H AA    + V ++L++   + +   K G  P+++AC YG+I++V  L+ +        ++G  P
Sbjct:  216 PLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTP 381          

HSP 2 Score: 89.3521 bits (220), Expect = 2.266e-18
Identity = 49/173 (28.32%), Postives = 84/173 (48.55%), Query Frame = 2
Query:  167 TNTR---PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            TN R    +H+A   G  E+   ++      +   +    PLH     G L+IVQLLL      +  T++G  P+H A   GH ++   L+     L + TK+G+T +H A+  G +EV  LL+++  + D   K+G  P+ +A  Y + ++  LL++        A++G  P
Sbjct:   77 TNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTP 249          

HSP 3 Score: 87.8113 bits (216), Expect = 7.536e-18
Identity = 52/181 (28.73%), Postives = 81/181 (44.75%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAG--EIHLDKKCL 715
            P+HIA   G  E+ + ++    + + +  NG+ PLH     GH D+  +LL     +   T  G  P+H A   G  E+A  L+ +    D   K G T +H A+   + +V  LL+++  +     K+G  P+ IA     +EI   L+     +    R GVAP   G  E H D   L
Sbjct:  117 PLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTPLHVASHYDNQKVALLLLDQGASPHATAKNGYTPLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASL 297          

HSP 4 Score: 85.1149 bits (209), Expect = 5.581e-17
Identity = 44/150 (29.33%), Postives = 74/150 (49.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+HIA  K   E+A  ++          + G  PLH     GH D+  LLL++  ++N  T  G+ P+H A       +A+ L+     ++  TK G+T +  A   G+I++V  L++   + + + K+G  P+  A   GH  IV LL+
Sbjct:  249 PLHIAAKKDQLEIATTLLEYGAETNAITRQGVAPLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL 398          

HSP 5 Score: 85.1149 bits (209), Expect = 5.677e-17
Identity = 43/166 (25.90%), Postives = 78/166 (46.99%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + E ++    + E   ++G  P+H     G+L+IV +LL      N     G   +H A   G  E+ + L+     +D + ++  T +H AA  G +E+V+LL++   + D    +G  P+ +A   GH ++  +L+ +        + G  P
Sbjct:   18 PLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTP 183          

HSP 6 Score: 81.6481 bits (200), Expect = 6.376e-16
Identity = 41/166 (24.70%), Postives = 75/166 (45.18%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H++   G   +   ++    +   +N  G   LH     G  ++V+ LL    +++ +  +   P+H A   G  EI + L+      D  T  G+T +H AA  GH +V  +L+E   +  +  K G  P+ +A  YG +E+  LL+          ++G+ P
Sbjct:   51 PMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTPLHVAAREGHEDVTAILLEHGASLAVTTKKGFTPLHVASKYGKMEVASLLLQRFASPDAAGKNGLTP 216          

HSP 7 Score: 75.8702 bits (185), Expect = 3.171e-14
Identity = 40/151 (26.49%), Postives = 75/151 (49.67%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQD--KDGCRPILIACAYGHIEIVKLL 625
            P+H+   +G  ++A  ++ +  +  ++ K+G  PLH       +++ ++L+     +N  T  G  P+  AC  G+ ++   L+     ++ +TK G+T +H AA  GH  +V LL+  KC     D   +G   + IA   G+I +V  L
Sbjct:  282 PLHLGAQEGHADVASLLLARYADVNHATKSGLSPLHLAAQEDKVNVAEILVKHGAHVNATTKLGYTPLIVACHYGNIKMVNFLLQHGADVNSKTKNGYTPLHQAAQQGHTHIVNLLL--KCGARPNDVTVNGNTALAIARRLGYISVVDTL 430          

HSP 8 Score: 74.3294 bits (181), Expect = 1.175e-13
Identity = 41/150 (27.33%), Postives = 69/150 (46.00%), Query Frame = 2
Query:  227 MVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +++K  N      NG+ PLH  C    + +++LLL     I   T  G+ P+H +   G+  I   L+      +    +G T++H AA  G  EVV+ L+      D + ++   P+ IA   G +EIV+LL+ +         +G  P
Sbjct:    1 LLDKGANPNVRALNGFTPLHIACKKNRIRVMELLLKYGASIEAVTESGLTPMHVSAFMGNLNIVLILLQGGASPNATNVRGETALHMAARAGQTEVVRSLLRNGAQVDAKAREEQTPLHIAARLGKLEIVQLLLQHMASPDAATSNGYTP 150          
BLAST of SMED30023739 vs. Ensembl Yeast
Match: NAS6 (Evolutionarily conserved 19S regulatory particle assembly-chaperone; proteasome-interacting protein involved in the assembly of the base subcomplex of the 19S proteasomal regulatory particle (RP); ortholog of human oncoprotein gankyrin, also known as p28, which interacts with the Rb tumor suppressor and CDK4/6 [Source:SGD;Acc:S000003464])

HSP 1 Score: 74.3294 bits (181), Expect = 3.373e-15
Identity = 46/163 (28.22%), Postives = 82/163 (50.31%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNF---EYSNKNGWRPLHHCCANGHLDIVQLLLSKDC--EINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIE-KKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISF 649
            P+H + +    E+  F+++K  N    +Y + +GW P H  C+ G+L++V+ L  +    ++N  TN G+  +H A     FE+++ LI     + I+ K     +H AA  G +++++LL    K   + QDK G  P+  A A GH +   LL+      +
Sbjct:   39 PLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELLCGLGKSAVNWQDKQGWTPLFHALAEGHGDAAVLLVEKYGAEY 201          

HSP 2 Score: 67.781 bits (164), Expect = 4.733e-13
Identity = 47/155 (30.32%), Postives = 76/155 (49.03%), Query Frame = 2
Query:  179 PIHIACNKG-FFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQ---TNDGMRPIHFACANGHFEIAKELIAKDCLLDIQ--TKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H AC +  FF++ E + +K       +++G  PLH   +    +I   LLSK   +N      + G  P H AC+ G+ E+ K L  +    D+   T QG T +H A      EV + LIE   +  I+DK    P+  A + G +++++LL
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIENGASVRIKDKFNQIPLHRAASVGSLKLIELL 159          

HSP 3 Score: 47.7506 bits (112), Expect = 2.630e-6
Identity = 37/125 (29.60%), Postives = 56/125 (44.80%), Query Frame = 2
Query:  278 PLHHCCA-NGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKD---CLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQD--KDGCRPILIACAYGHIEIVKLLINN 634
            PLH  C  N    + +LL SK   +  +  DG  P+H++ +    EI   L++K     L D     GWT  H A   G++EVVK L ++    D+      G   + +A      E+ + LI N
Sbjct:    5 PLHQACMENEFFKVQELLHSKPSLLLQKDQDGRIPLHWSVSFQAHEITSFLLSKMENVNLDDYPDDSGWTPFHIACSVGNLEVVKSLYDRPLKPDLNKITNQGVTCLHLAVGKKWFEVSQFLIEN 129          
BLAST of SMED30023739 vs. Ensembl Yeast
Match: GDE1 (Glycerophosphocholine (GroPCho) phosphodiesterase; hydrolyzes GroPCho to choline and glycerolphosphate, for use as a phosphate source and as a precursor for phosphocholine synthesis; may interact with ribosomes [Source:SGD;Acc:S000006031])

HSP 1 Score: 66.6254 bits (161), Expect = 1.650e-11
Identity = 52/195 (26.67%), Postives = 79/195 (40.51%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVN--KKCNF----------EYSNKNGWRPLHHCCANGHLDIVQLLL--------------------------------SKDCEINCQTND-GMRPIHFACANGHFEIAKELIAKDCLLDIQTKQ-GWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H +C  G  E+ + ++   K+ N            + +     PLH C    H    ++LL                                SK  +IN Q N+    P++ AC    FE A  L+     L+I+ K  GWT+I  AA  G  ++VKLLI    N DI+D+ G  P+  A   GH+ I  ++
Sbjct:  431 PLHYSCQYGLSEVTKLIIKLMKEWNIWNEIPIDDVSAFGDAESLTPLHLCVLGAHPKTTEVLLQSLDPNVKLKSSSLLHLATEWNNYPLLHVLLSSKRFDINYQDNELHETPLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMV 625          

HSP 2 Score: 51.9878 bits (123), Expect = 5.436e-7
Identity = 27/91 (29.67%), Postives = 44/91 (48.35%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNK-NGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLL 448
            P+++AC   FFE A  ++    + E   K  GW  +    A G  DIV+LL++ +   + +   G  P+  A   GH  IA  +  +D L+
Sbjct:  542 PLYLACRLNFFEAAVCLLYNGADLEIREKLFGWTAIFVAAAEGFTDIVKLLIANNANFDIEDEGGWTPMEHAVLRGHLHIADMVQIRDELV 632          
BLAST of SMED30023739 vs. Ensembl Yeast
Match: HOS4 (Subunit of the Set3 complex; complex is a meiotic-specific repressor of sporulation specific genes that contains deacetylase activity; potential Cdc28p substrate [Source:SGD;Acc:S000001374])

HSP 1 Score: 63.929 bits (154), Expect = 1.210e-10
Identity = 32/92 (34.78%), Postives = 55/92 (59.78%), Query Frame = 2
Query:  368 GMRPIHFACANGHFEIAKELIAKDCL-LDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKD--GCRPILIACAYGHIEIVKLLINN 634
            G   +  AC  G +++ K++I +    ++ Q   G T++H AA  GHIE+V+LLIE   + +I+  +  G  P++ A A GH+++VK L+ N
Sbjct:  330 GRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKN 421          

HSP 2 Score: 54.299 bits (129), Expect = 8.407e-8
Identity = 33/109 (30.28%), Postives = 56/109 (51.38%), Query Frame = 2
Query:  254 YSNKNGWRPLHHCCANGHLDIVQLLLSKDC-EINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQ--GWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGC 571
            Y +  G   L   C  G  D+V+ ++ +   +IN Q N G   +H A   GH EI + LI     ++I++ +  G T +  A+ NGH++VVK L++   +  I++  G 
Sbjct:  325 YRDSGGRTRLQIACDKGKYDVVKKMIEEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGL 433          

HSP 3 Score: 54.299 bits (129), Expect = 1.013e-7
Identity = 38/146 (26.03%), Postives = 73/146 (50.00%), Query Frame = 2
Query:   98 QNNLKGIMDLSNPNLINKIIDITTNTRP---------------IHIACNKGFFEMAEFMVNKKCNFEYSNKN--GWRPLHHCCANGHLDIVQLLLSKDCEINCQTND--GMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTS 478
            QN  +G +  SN +  NK   I  + RP               + IAC+KG +++ + M+ ++  ++ ++++  G   LH     GH++IV+LL+    ++N ++ +  G  P+  A ANGH ++ K L+       I+  +G T+
Sbjct:  293 QNPKRGSVSRSNDS--NKSSHIAVSKRPKQKKGIYRDSGGRTRLQIACDKGKYDVVKKMI-EEGGYDINDQDNAGNTALHEAALQGHIEIVELLIENGADVNIKSIEMFGDTPLIDASANGHLDVVKYLLKNGADPTIRNAKGLTA 435          
BLAST of SMED30023739 vs. Ensembl Yeast
Match: AVO2 (Component of a complex containing the Tor2p kinase and other proteins; complex may have a role in regulation of cell growth [Source:SGD;Acc:S000004672])

HSP 1 Score: 48.521 bits (114), Expect = 3.472e-6
Identity = 35/133 (26.32%), Postives = 60/133 (45.11%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLL--LSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAK-DCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISF 649
            ++NGW  LH+   +G   I   L  L  D     +T  G   +H A   GH +    L+ +    ++ + + G   IH A  N + + + LLI    +  + D +G  P+ +   YG I  +K+L+N   +S 
Sbjct:   37 SENGWSSLHYASYHGRYLICVYLIQLGHDKHELIKTFKGNTCVHLALMKGHEQTLHLLLQQFPRFINHRGENGRAPIHIACMNDYYQCLSLLIGVGADLWVMDTNGDTPLHVCLEYGSISCMKMLLNEGEVSL 169          
BLAST of SMED30023739 vs. Ensembl Yeast
Match: YAR1 (Ankyrin-repeat containing, nucleocytoplasmic shuttling chaperone; prevents aggregation of Rps3p in the cytoplasm, associates with nascent Rps3p during its translation in the cytoplasm and delivers it to the 90S in the nucleus; required for 40S ribosomal subunit export, biogenesis and adaptation to osmotic and oxidative stress; expression repressed by heat shock [Source:SGD;Acc:S000006160])

HSP 1 Score: 46.2098 bits (108), Expect = 6.210e-6
Identity = 35/113 (30.97%), Postives = 57/113 (50.44%), Query Frame = 2
Query:  311 DIVQLLLSKDCEINCQTNDG-MRPIHFACANGHFEIAKELI--------AKD--CLLDIQTKQGWTSIHWAACNGHIEVVKLL-IEKKCNTDIQDKDGCRPILIACAYGHIEI 613
            DI   L+S +    C+ ++     +H A ANGH E  + ++        A+D    ++   K G T++HWA+ NG ++VVKLL  E + +  I++K G   I  A   G  E+
Sbjct:   30 DIFTTLVSPELLSTCKESESDSTALHMAAANGHIETVRYILETVSRANSAEDLKAFVNEVNKTGNTALHWASLNGKLDVVKLLCDEYEADPFIRNKFGHDAIFEAENSGKEEV 142          
BLAST of SMED30023739 vs. Ensembl Nematostella
Match: EDO43690 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXV8])

HSP 1 Score: 77.7962 bits (190), Expect = 1.675e-15
Identity = 41/124 (33.06%), Postives = 69/124 (55.65%), Query Frame = 2
Query:  290 CCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPAR 661
              ++G +D V+ LL+K  +IN Q  DG+  +H AC + +F++ K L+ K   +D++  +GWTS+H AA  G +E+ K LIE   +    + +G  P+ +A      +++   I NQ I    AR
Sbjct:   56 AVSSGDVDEVKKLLAKGADINYQNVDGLTALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDAR 179          

HSP 2 Score: 57.7658 bits (138), Expect = 6.277e-9
Identity = 36/178 (20.22%), Postives = 78/178 (43.82%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFA------------CANGHFEI--------------AKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
             +H AC    F++ + +V+K  + +  +  GW  LH   + G ++I + L+    ++    N+G  P+  A              N   ++              A+  + K+C+ + + K   +++H A+  G+++V+ LL++     + +D D   P+  A  +G  +  +LL  N
Sbjct:   85 ALHQACIDENFDLVKVLVDKGASMDVRDNEGWTSLHAAASCGSVEIAKYLIENGADVAAVNNEGELPLDLAEEEDMEDLLTDEIENQGIDVDDARAVEEKIMLNDAQSWLNKNCINESKDKTEASALHVASSKGYLKVIGLLLQLGVEINAKDADNWTPLHAAAHWGQKDACELLSEN 262          
BLAST of SMED30023739 vs. Ensembl Nematostella
Match: EDO28178 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T774])

HSP 1 Score: 74.3294 bits (181), Expect = 7.018e-15
Identity = 41/118 (34.75%), Postives = 65/118 (55.08%), Query Frame = 2
Query:  257 SNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQG----WTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAY 598
            S+ N   PL   C  GH D+V+LLL++   I  +T +G  P+ FA   GH ++A +L+ +   ++I +        TS  W    GH +VVKLL++   N + + KDGC P+++A  Y
Sbjct:   83 SDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACW---KGHHDVVKLLLKYTSNIEHRTKDGCTPLMLAARY 197          

HSP 2 Score: 68.9366 bits (167), Expect = 5.480e-13
Identity = 39/127 (30.71%), Postives = 69/127 (54.33%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGM-RPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDI-QDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            GH+ +  +LL    EIN +++     P+ FAC  GH ++ + L+A+   ++ +TK+G+T + +AA  GH +V   L+E+    +I    +   P+  AC  GH ++VKLL+   +      +DG  P
Sbjct:   64 GHVKVATMLLDHGAEINVESDSNKDSPLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTP 190          

HSP 3 Score: 56.6102 bits (135), Expect = 7.736e-9
Identity = 31/106 (29.25%), Postives = 52/106 (49.06%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMR-PIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAA 493
            P+  AC KG  ++ E ++ +  N E+  K G+ PL      GH D+   LL +  ++N  +      P+  AC  GH ++ K L+     ++ +TK G T +  AA
Sbjct:   90 PLTFACWKGHCDVVELLLARSANIEHRTKEGFTPLMFAALGGHTDVAAKLLEQGAKVNIPSGSNNDIPLTSACWKGHHDVVKLLLKYTSNIEHRTKDGCTPLMLAA 195          
BLAST of SMED30023739 vs. Ensembl Nematostella
Match: EDO46099 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RR35])

HSP 1 Score: 71.2478 bits (173), Expect = 1.715e-14
Identity = 42/154 (27.27%), Postives = 72/154 (46.75%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMR---PIHFACANGHFEIA-KELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCR---PILIACAYGHIEIVKL 622
            +H A   G  +  E ++          + GWRP+H    NGH + V++LL      N +T   +R   P+H+A   GH + A + L+ +   L+   + GW  IH A+ NG ++V+  L++     DI+ K   R    + +A   G + +  L
Sbjct:    1 LHYAARYGNEKCIELLLKSGAKLNVPQRYGWRPIHEAAMNGHTECVRMLLRYGSHANAKTGKTIRNMTPLHYAARMGHLDCAVRMLMERGIDLEAVYRDGWRLIHVASDNGRVKVLVTLLD--AGVDIESKTYERRLTAVHVAARQGQVTMTTL 152          
BLAST of SMED30023739 vs. Ensembl Nematostella
Match: EDO34823 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SNB2])

HSP 1 Score: 75.8702 bits (185), Expect = 4.468e-14
Identity = 47/153 (30.72%), Postives = 77/153 (50.33%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFM--VNKKCNFEYSNKNGWRPLHHCCANGHLD-IVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDG--CRPILIACAYGHI 607
            T  T P+++A   G F+  +F+  V  KCN   ++++G  P+H    NGHLD +  L +     +  +   G  P H+A   GH  + K L  + C + I+   G T +H AA  G +  ++ L+E   + D++ KD     PI +A  YGH+
Sbjct:   30 TDGTTPLYLAAQDGNFDCLKFLHGVGAKCNI--TSRDGMHPIHAAAQNGHLDCLGYLAIHGRVSMTERDRTGATPAHYAAGQGHLSVLKWLNVR-CDVKIKDSLGGTPLHDAAEKGQLHCLRFLVE-VVHLDVRSKDSSNTSPIDLAERYGHV 178          

HSP 2 Score: 67.0106 bits (162), Expect = 3.069e-11
Identity = 43/152 (28.29%), Postives = 71/152 (46.71%), Query Frame = 2
Query:  182 IHIACNKGFFEM--AEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKEL-IAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +H AC +  ++   A   V    +   S  +G  PL+    +G+ D ++ L     + N  + DGM PIH A  NGH +    L I     +  + + G T  H+AA  GH+ V+K L   +C+  I+D  G  P+  A   G +  ++ L+
Sbjct:    1 MHPACYRNRYQAKPAVKAVIVASSVNESATDGTTPLYLAAQDGNFDCLKFLHGVGAKCNITSRDGMHPIHAAAQNGHLDCLGYLAIHGRVSMTERDRTGATPAHYAAGQGHLSVLKWL-NVRCDVKIKDSLGGTPLHDAAEKGQLHCLRFLV 151          

HSP 3 Score: 54.6842 bits (130), Expect = 1.743e-7
Identity = 36/135 (26.67%), Postives = 62/135 (45.93%), Query Frame = 2
Query:  347 INCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLL-IEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVA---PSVAGEIHLDKKCLEFLGGIQH 739
            +N    DG  P++ A  +G+F+  K L       +I ++ G   IH AA NGH++ +  L I  + +   +D+ G  P   A   GH+ ++K L    ++    +  G      +  G++H    CL FL  + H
Sbjct:   25 VNESATDGTTPLYLAAQDGNFDCLKFLHGVGAKCNITSRDGMHPIHAAAQNGHLDCLGYLAIHGRVSMTERDRTGATPAHYAAGQGHLSVLKWLNVRCDVKIKDSLGGTPLHDAAEKGQLH----CLRFLVEVVH 155          
BLAST of SMED30023739 vs. Ensembl Nematostella
Match: EDO43381 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RYU3])

HSP 1 Score: 73.9442 bits (180), Expect = 2.647e-13
Identity = 46/146 (31.51%), Postives = 69/146 (47.26%), Query Frame = 2
Query:  182 IHIACNKG-FFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIV 616
            IH A  KG    + E +          ++ G   LH   +NGHLD V+ L     ++  +T  G   IH A   GH      L A   +++ +T    T +H AA +GH+E VK L+  +  T+ +D +G   + IA  YGH +IV
Sbjct:  905 IHDAAKKGDLARIKELIGVAPAMKSVPDEKGMTALHIASSNGHLDCVKWLAVSGVDLGQETPTGYTAIHLAAMGGHVNCMMILSAMGSVVNCKTVDDQTPLHLAAMSGHLECVKWLLANRSRTEAEDSNGRTALDIAEEYGHEDIV 1050          

HSP 2 Score: 57.3806 bits (137), Expect = 2.986e-8
Identity = 34/121 (28.10%), Postives = 58/121 (47.93%), Query Frame = 2
Query:  281 LHHCCANGHLDIVQLLLSKDCEINCQTND-GMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQN 640
            +H     G L  ++ L+     +    ++ GM  +H A +NGH +  K L      L  +T  G+T+IH AA  GH+  + +L       + +  D   P+ +A   GH+E VK L+ N++
Sbjct:  905 IHDAAKKGDLARIKELIGVAPAMKSVPDEKGMTALHIASSNGHLDCVKWLAVSGVDLGQETPTGYTAIHLAAMGGHVNCMMILSAMGSVVNCKTVDDQTPLHLAAMSGHLECVKWLLANRS 1025          
BLAST of SMED30023739 vs. Ensembl Medaka
Match: ENSORLT00000031565.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 103.219 bits (256), Expect = 8.586e-22
Identity = 51/166 (30.72%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  +++K  +   + KNG+ PLH       +DI  +LL    E N  T  G+ P+H A   GH ++A  L++K   +++ TK G T++H AA    + V ++L+    N D Q K G  P+++AC YG+ ++V  L+ N        ++G  P
Sbjct:  607 PLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTP 772          

HSP 2 Score: 96.6709 bits (239), Expect = 1.037e-19
Identity = 52/166 (31.33%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA + G   +A  ++N+    +++ +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH    + L+ K   L  +TK G + +H AA   H+E VK L++ K   D    D    + +A   GH  + KLL++ +      A +G  P
Sbjct:  244 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 409          

HSP 3 Score: 92.0485 bits (227), Expect = 2.176e-18
Identity = 45/150 (30.00%), Postives = 80/150 (53.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H+A  +G   M   ++++    +   ++G  PLH    +GH   V++LL K   +  +T +G+ P+H A    H E  K L+     +D  T    T++H AA  GH  V KLL++K+ N + +  +G  P+ IAC    +++++LL+
Sbjct:  277 PLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLV 426          

HSP 4 Score: 88.1965 bits (217), Expect = 3.984e-17
Identity = 54/189 (28.57%), Postives = 87/189 (46.03%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCLEFLGGIQHS 742
            +H+A + G + + + +++K+ N      NG+ PLH  C    + +++LL+     I   T  G+ PIH A   GH  I   L+      D+   +G TS+H AA  G  EVV+ L+      D + ++   P+ IA   G  EIV+LL+ +         +G  P    A E  L+   +    G  HS
Sbjct:  377 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHS 565          

HSP 5 Score: 85.5001 bits (210), Expect = 2.726e-16
Identity = 40/125 (32.00%), Postives = 68/125 (54.40%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N+NG   LH     GH+D+VQ LL +   ++  T  G   +H +   G  E+ K L+ +   ++ Q++ G+T ++ AA   H++VV+ L+E   N     +DG  P+ IA   GH ++V +L+ N
Sbjct:   77 NQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN 201          

HSP 6 Score: 82.0333 bits (201), Expect = 2.897e-15
Identity = 43/152 (28.29%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA  K   + A  ++    N +  +K+G+ PLH     G++++  LLL++   ++    +G+ P+H A   G+  + + L+ +   +D +T+ G T +H AA +GH   V++L+EK      + K+G  P+ +A    H+E VK L+ ++
Sbjct:  212 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK 363          

HSP 7 Score: 80.8777 bits (198), Expect = 6.368e-15
Identity = 52/219 (23.74%), Postives = 93/219 (42.47%), Query Frame = 2
Query:  107 LKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            LKG +D+S  N              +H+A  +G  ++ + ++++    + S K G   LH     G  ++V+ L+ +  +IN Q+ +G  P++ A    H ++ + L+         T+ G+T +  A   GH +VV +L+E                                N D+Q K G  P+ IA  YG++ +  LL+N        AR+G+ P
Sbjct:   67 LKGGVDISTCN--------QNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITP 277          

HSP 8 Score: 79.337 bits (194), Expect = 1.964e-14
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIA  K   ++A  ++          K G  PLH     GH D+  LL+SK  +IN  T  G+  +H A       +A+ L+     LD QTK G+T +  A   G+ ++V  L++   + + + K+G  P+  A   G+  I+ +L+ +
Sbjct:  640 PLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQH 791          

HSP 9 Score: 78.1814 bits (191), Expect = 3.966e-14
Identity = 43/169 (25.44%), Postives = 79/169 (46.75%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGV 670
            T    P+HI+  +G  E A  ++    +   + K G+ PLH     G LD+ +LLL +    +    +G+ P+H A    + ++A  L+ K        K G+T +H AA    +++  +L++    T+   K G  P+ +A   GH ++  LL++       P + G+
Sbjct:  536 TNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGL 704          

HSP 10 Score: 77.411 bits (189), Expect = 6.480e-14
Identity = 43/166 (25.90%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K   ++ E +V    + +   ++G  P+H     GHL+IV LLL      +     G   +H A   G  E+ + L+    ++D + ++  T +H A+  G  E+V+LL++   + D    +G  P+ I+   G +E   +L+          + G  P
Sbjct:  409 PLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTP 574          

HSP 11 Score: 77.0258 bits (188), Expect = 1.041e-13
Identity = 42/166 (25.30%), Postives = 75/166 (45.18%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   ++    + + SN  G   LH     G  ++V+ LL     ++ +  +   P+H A   G  EI + L+      D  T  G+T +H +A  G +E   +L+E   +  +  K G  P+ +   YG +++ KLL+  Q       ++G+ P
Sbjct:  442 PIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTP 607          

HSP 12 Score: 74.7146 bits (182), Expect = 4.737e-13
Identity = 43/165 (26.06%), Postives = 77/165 (46.67%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A   G  E+   ++      +   +    PLH     G  +IVQLLL      +  T +G  P+H +   G  E A  L+       + TK+G+T +H  +  G ++V KLL++++   D   K+G  P+ +A  Y + ++  LL++        A++G  P
Sbjct:  476 LHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTP 640          

HSP 13 Score: 73.9442 bits (180), Expect = 7.482e-13
Identity = 60/241 (24.90%), Postives = 96/241 (39.83%), Query Frame = 2
Query:   86 DFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLH--------------------------------HCCAN-GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            DF  +N +  +   S   N N++  ++D    I   TR    P+H A   G     E ++ K        KNG  PLH                                H  A+ GH  + +LLL K    N +  +G  P+H AC     ++ + L+     +   T+ G T IH AA  GH+ +V LL++   + D+ +  G   + +A   G  E+V+ L+ N  +    AR+   P
Sbjct:  268 DFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTP 508          

HSP 14 Score: 73.9442 bits (180), Expect = 7.546e-13
Identity = 35/125 (28.00%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G++D V   L    +I+    +G+  +H A   GH ++ +EL+ +   +D  TK+G T++H ++  G  EVVK L+++  + + Q ++G  P+ +A    H+++V+ L+ N         DG  P
Sbjct:   58 GNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTP 182          

HSP 15 Score: 73.559 bits (179), Expect = 1.095e-12
Identity = 50/188 (26.60%), Postives = 82/188 (43.62%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCLEFLGGIQ 736
            P+HIA   G  E+ + ++    + + +  NG+ PLH     G L+   +LL      +  T  G  P+H     G  ++AK L+ +    D   K G T +H AA   + +V  LL++K  +     K+G  P+ IA     ++I  +L+     +    + GV P    + E H D   L    G Q
Sbjct:  508 PLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQ 695          

HSP 16 Score: 68.5514 bits (166), Expect = 3.892e-11
Identity = 43/212 (20.28%), Postives = 90/212 (42.45%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCE-----------------------------INCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            L+ +  DI   ++    P+++A  +   ++  +++    N   + ++G+ PL      GH  +V +LL  D +                              + Q+  G  P+H A   G+  +A  L+ +   +D   + G T +H A+  G+  +V+LL+++    D + +DG  P+  A   GH   V++L+          ++G++P
Sbjct:  132 LVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSP 343          

HSP 17 Score: 66.2402 bits (160), Expect = 1.893e-10
Identity = 36/149 (24.16%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +MA  +++K        K+G   LH       + + ++L+     ++ QT  G  P+  AC  G+ ++   L+     ++ +TK G+T +H AA  G+  ++ +L++     +    +G   + IA   G+I +V  L
Sbjct:  673 PLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 821          
BLAST of SMED30023739 vs. Ensembl Medaka
Match: ENSORLT00000039458.1 (ankyrin 2 [Source:NCBI gene;Acc:101161458])

HSP 1 Score: 103.219 bits (256), Expect = 8.638e-22
Identity = 51/166 (30.72%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A +    ++A  +++K  +   + KNG+ PLH       +DI  +LL    E N  T  G+ P+H A   GH ++A  L++K   +++ TK G T++H AA    + V ++L+    N D Q K G  P+++AC YG+ ++V  L+ N        ++G  P
Sbjct:  592 PLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTP 757          

HSP 2 Score: 96.6709 bits (239), Expect = 1.035e-19
Identity = 52/166 (31.33%), Postives = 88/166 (53.01%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIA + G   +A  ++N+    +++ +NG  PLH     G+ ++V+LLL +  +I+ +T DG+ P+H A  +GH    + L+ K   L  +TK G + +H AA   H+E VK L++ K   D    D    + +A   GH  + KLL++ +      A +G  P
Sbjct:  229 PLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTP 394          

HSP 3 Score: 92.0485 bits (227), Expect = 2.190e-18
Identity = 45/150 (30.00%), Postives = 80/150 (53.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H+A  +G   M   ++++    +   ++G  PLH    +GH   V++LL K   +  +T +G+ P+H A    H E  K L+     +D  T    T++H AA  GH  V KLL++K+ N + +  +G  P+ IAC    +++++LL+
Sbjct:  262 PLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLV 411          

HSP 4 Score: 88.1965 bits (217), Expect = 4.010e-17
Identity = 54/189 (28.57%), Postives = 87/189 (46.03%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCLEFLGGIQHS 742
            +H+A + G + + + +++K+ N      NG+ PLH  C    + +++LL+     I   T  G+ PIH A   GH  I   L+      D+   +G TS+H AA  G  EVV+ L+      D + ++   P+ IA   G  EIV+LL+ +         +G  P    A E  L+   +    G  HS
Sbjct:  362 LHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHS 550          

HSP 5 Score: 85.5001 bits (210), Expect = 2.698e-16
Identity = 40/125 (32.00%), Postives = 68/125 (54.40%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N+NG   LH     GH+D+VQ LL +   ++  T  G   +H +   G  E+ K L+ +   ++ Q++ G+T ++ AA   H++VV+ L+E   N     +DG  P+ IA   GH ++V +L+ N
Sbjct:   62 NQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLEN 186          

HSP 6 Score: 82.0333 bits (201), Expect = 2.966e-15
Identity = 43/152 (28.29%), Postives = 83/152 (54.61%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +HIA  K   + A  ++    N +  +K+G+ PLH     G++++  LLL++   ++    +G+ P+H A   G+  + + L+ +   +D +T+ G T +H AA +GH   V++L+EK      + K+G  P+ +A    H+E VK L+ ++
Sbjct:  197 LHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHK 348          

HSP 7 Score: 80.8777 bits (198), Expect = 6.357e-15
Identity = 52/219 (23.74%), Postives = 93/219 (42.47%), Query Frame = 2
Query:  107 LKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            LKG +D+S  N              +H+A  +G  ++ + ++++    + S K G   LH     G  ++V+ L+ +  +IN Q+ +G  P++ A    H ++ + L+         T+ G+T +  A   GH +VV +L+E                                N D+Q K G  P+ IA  YG++ +  LL+N        AR+G+ P
Sbjct:   52 LKGGVDISTCN--------QNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITP 262          

HSP 8 Score: 79.337 bits (194), Expect = 1.977e-14
Identity = 44/152 (28.95%), Postives = 74/152 (48.68%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            P+HIA  K   ++A  ++          K G  PLH     GH D+  LL+SK  +IN  T  G+  +H A       +A+ L+     LD QTK G+T +  A   G+ ++V  L++   + + + K+G  P+  A   G+  I+ +L+ +
Sbjct:  625 PLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQH 776          

HSP 9 Score: 78.1814 bits (191), Expect = 3.993e-14
Identity = 43/169 (25.44%), Postives = 79/169 (46.75%), Query Frame = 2
Query:  164 TTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGV 670
            T    P+HI+  +G  E A  ++    +   + K G+ PLH     G LD+ +LLL +    +    +G+ P+H A    + ++A  L+ K        K G+T +H AA    +++  +L++    T+   K G  P+ +A   GH ++  LL++       P + G+
Sbjct:  521 TNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQINVPTKSGL 689          

HSP 10 Score: 77.411 bits (189), Expect = 6.580e-14
Identity = 43/166 (25.90%), Postives = 77/166 (46.39%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K   ++ E +V    + +   ++G  P+H     GHL+IV LLL      +     G   +H A   G  E+ + L+    ++D + ++  T +H A+  G  E+V+LL++   + D    +G  P+ I+   G +E   +L+          + G  P
Sbjct:  394 PLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTP 559          

HSP 11 Score: 77.0258 bits (188), Expect = 1.039e-13
Identity = 42/166 (25.30%), Postives = 75/166 (45.18%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            PIH+A   G   +   ++    + + SN  G   LH     G  ++V+ LL     ++ +  +   P+H A   G  EI + L+      D  T  G+T +H +A  G +E   +L+E   +  +  K G  P+ +   YG +++ KLL+  Q       ++G+ P
Sbjct:  427 PIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTP 592          

HSP 12 Score: 74.7146 bits (182), Expect = 4.690e-13
Identity = 43/165 (26.06%), Postives = 77/165 (46.67%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A   G  E+   ++      +   +    PLH     G  +IVQLLL      +  T +G  P+H +   G  E A  L+       + TK+G+T +H  +  G ++V KLL++++   D   K+G  P+ +A  Y + ++  LL++        A++G  P
Sbjct:  461 LHMAARAGQAEVVRCLLRNGAMVDARAREDQTPLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTP 625          

HSP 13 Score: 73.9442 bits (180), Expect = 7.471e-13
Identity = 60/241 (24.90%), Postives = 96/241 (39.83%), Query Frame = 2
Query:   86 DFVLQNNLKGIMDLS---NPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLH--------------------------------HCCAN-GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            DF  +N +  +   S   N N++  ++D    I   TR    P+H A   G     E ++ K        KNG  PLH                                H  A+ GH  + +LLL K    N +  +G  P+H AC     ++ + L+     +   T+ G T IH AA  GH+ +V LL++   + D+ +  G   + +A   G  E+V+ L+ N  +    AR+   P
Sbjct:  253 DFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSPLHMAAQGDHVECVKHLLQHKAPVDDVTLDYLTALHVAAHCGHYRVTKLLLDKRANPNARALNGFTPLHIACKKNRVKVMELLVKYGASIQAVTESGLTPIHVAAFMGHLNIVLLLLQNGASPDVSNIRGETSLHMAARAGQAEVVRCLLRNGAMVDARAREDQTP 493          

HSP 14 Score: 73.9442 bits (180), Expect = 7.534e-13
Identity = 35/125 (28.00%), Postives = 67/125 (53.60%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G++D V   L    +I+    +G+  +H A   GH ++ +EL+ +   +D  TK+G T++H ++  G  EVVK L+++  + + Q ++G  P+ +A    H+++V+ L+ N         DG  P
Sbjct:   43 GNIDKVLEYLKGGVDISTCNQNGLNALHLAAKEGHMDLVQELLDRGAPVDSSTKKGNTALHISSLAGQAEVVKTLVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTP 167          

HSP 15 Score: 73.559 bits (179), Expect = 1.103e-12
Identity = 50/188 (26.60%), Postives = 82/188 (43.62%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHLDKKCLEFLGGIQ 736
            P+HIA   G  E+ + ++    + + +  NG+ PLH     G L+   +LL      +  T  G  P+H     G  ++AK L+ +    D   K G T +H AA   + +V  LL++K  +     K+G  P+ IA     ++I  +L+     +    + GV P    + E H D   L    G Q
Sbjct:  493 PLHIASRLGKTEIVQLLLQHMAHPDAATTNGYTPLHISAREGQLETASVLLEAGASHSLATKKGFTPLHVVSKYGSLDVAKLLLQRQAPPDSAGKNGLTPLHVAAHYDNQKVALLLLDKGASPHTTAKNGYTPLHIAAKKNQMDIATVLLQYGAETNALTKQGVTPLHLASQEGHADMAALLMSKGAQ 680          

HSP 16 Score: 68.5514 bits (166), Expect = 3.887e-11
Identity = 43/212 (20.28%), Postives = 90/212 (42.45%), Query Frame = 2
Query:  140 LINKIIDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCE-----------------------------INCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            L+ +  DI   ++    P+++A  +   ++  +++    N   + ++G+ PL      GH  +V +LL  D +                              + Q+  G  P+H A   G+  +A  L+ +   +D   + G T +H A+  G+  +V+LL+++    D + +DG  P+  A   GH   V++L+          ++G++P
Sbjct:  117 LVKRGADINAQSQNGFTPLYMAAQENHLDVVRYLLENGGNQSTATEDGFTPLAIALQQGHNQVVSILLENDTKGKVRLPALHIAARKDDTKSAALLLQNDHNADVQSKSGFTPLHIAAHYGNVNVATLLLNRGAAVDFTARNGITPLHVASKRGNTNMVRLLLDRGSQIDAKTRDGLTPLHCAARSGHEASVEVLLEKGAPLLARTKNGLSP 328          

HSP 17 Score: 66.2402 bits (160), Expect = 1.891e-10
Identity = 36/149 (24.16%), Postives = 72/149 (48.32%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLL 625
            P+H+A  +G  +MA  +++K        K+G   LH       + + ++L+     ++ QT  G  P+  AC  G+ ++   L+     ++ +TK G+T +H AA  G+  ++ +L++     +    +G   + IA   G+I +V  L
Sbjct:  658 PLHLASQEGHADMAALLMSKGAQINVPTKSGLTALHLAAQEDRVAVAEILVRNGANLDHQTKLGYTPLIVACHYGNAKMVSFLLQNGASVNAKTKNGYTPLHQAAQQGNTHIINVLLQHGAKPNAVTVNGNTALGIARRLGYISVVDTL 806          
BLAST of SMED30023739 vs. Ensembl Medaka
Match: ank1a (ankyrin-1 [Source:NCBI gene;Acc:101174837])

HSP 1 Score: 103.219 bits (256), Expect = 8.647e-22
Identity = 55/166 (33.13%), Postives = 86/166 (51.81%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+HIAC K    + + ++    + E   ++G  PLH     GHL+IV++LL K    +        P+H A  +GHFE+A+ L+     +D + K   T +H AA  GH E+VKLL+E K N +     G  P+ IA   GH++ V+LL++ +       + G  P
Sbjct:  312 PLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTP 477          

HSP 2 Score: 99.7525 bits (247), Expect = 1.123e-20
Identity = 50/163 (30.67%), Postives = 86/163 (52.76%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDG 667
            P+H+A   G FE+AEF++      +   K+   PLH     GH ++V+LLL      N  T  G  P+H A   GH +  + L+  +      TK+G+T +H A+  G ++V +LL+E+  N +   K+G  P+ +A  + ++++V LL++        AR+G
Sbjct:  378 PLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNG 540          

HSP 3 Score: 95.1301 bits (235), Expect = 2.897e-19
Identity = 54/164 (32.93%), Postives = 82/164 (50.00%), Query Frame = 2
Query:  149 KIIDITTN-TRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQ 637
            +I DIT +   P+H+A + G   MA+ +++K         NG+ PLH  C   HL ++ LLL     I   T  G+ P+H A   GH  I K L+ K         +  T +H A+ +GH EV + L++     D + KD   P+  A   GH E+VKLL+ ++
Sbjct:  268 EIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHK 431          

HSP 4 Score: 93.9745 bits (232), Expect = 6.377e-19
Identity = 48/166 (28.92%), Postives = 82/166 (49.40%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H+A   G  ++AE ++ +  N   + KNG  PLH    + +LD+V LL+SK    +    +G   +H A      E+A  L+      + ++ QG T +H A+  G  ++V LLI K+ N ++ +K G  P+ +    GH+ I  +L+      +   R G  P
Sbjct:  477 PLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTP 642          

HSP 5 Score: 89.7373 bits (221), Expect = 1.075e-17
Identity = 46/150 (30.67%), Postives = 77/150 (51.33%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            P+H A   G F + E +++     +   KNG  P+H      H+D V+ LL  + EI+  T D + P+H A   GH  +AK L+ K    + +   G+T +H A    H+ V+ LL++   + +   + G  P+ +A   GH+ IVK+L+
Sbjct:  213 PLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILL 362          

HSP 6 Score: 88.5817 bits (218), Expect = 2.873e-17
Identity = 53/188 (28.19%), Postives = 91/188 (48.40%), Query Frame = 2
Query:  167 TNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP----SVAGEIHLDKKCLE 718
            T   P+HIA +     +A+ ++N+  N E +      PLH    NGH  I+++LL     I  +T +G+ PIH A    H +  K+L+  +  +D  T    T +H AA  GH  + K+L++K    + +  +G  P+ IAC   H+ ++ LL+ +          G+ P    S  G +++ K  L+
Sbjct:  182 TGFTPLHIAAHYENLNVAQLLLNRGANDELT------PLHCAARNGHFRIIEILLDNGAPIQAKTKNGLSPIHMAAQGDHMDCVKQLLQYNAEIDDITLDHLTPLHVAAHCGHHRMAKVLLDKGAKPNSRALNGFTPLHIACKKNHLRVMDLLLKHSASIEAVTESGLTPLHVASFMGHLNIVKILLQ 363          

HSP 7 Score: 85.1149 bits (209), Expect = 2.739e-16
Identity = 49/191 (25.65%), Postives = 87/191 (45.55%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFL---GGIQHS 742
            P+H+A   G   + + ++ K  +   SN     PLH    +GH ++ + LL     ++ +  D   P+H A   GH E+ K L+      +  T  G + +H AA  GH++ V+LL++ +       K G  P+ +A  YG +++ +LL+          ++G+ P      H +   +  L   GG  HS
Sbjct:  345 PLHVASFMGHLNIVKILLQKGASPSASNVKVETPLHMASRSGHFEVAEFLLQNAAPVDAKAKDDQTPLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHS 535          

HSP 8 Score: 81.6481 bits (200), Expect = 3.119e-15
Identity = 55/216 (25.46%), Postives = 98/216 (45.37%), Query Frame = 2
Query:   59 RMSESEIFKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP--SVAGEIHL 700
            RM   E+ K  +L++        +NPN        T    P+HIA  +G  +    +++ +       K G+ PLH     G +D+ +LLL +    N    +G+ P+H A  + + ++   L++K        + G+T++H AA    +EV   L++   + + +   G  P+ +A   G  +IV LLI+ Q       + G+ P   VA E H+
Sbjct:  417 RMGHKELVK-LLLEHK-------ANPNSTT-----TAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHV 619          

HSP 9 Score: 78.1814 bits (191), Expect = 4.167e-14
Identity = 44/147 (29.93%), Postives = 71/147 (48.30%), Query Frame = 2
Query:  191 ACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLIN 631
            A   G  + A   +    +   +N+NG   LH     GH+ +V  LL     +   T  G   +H A   G  ++  EL+     ++ Q+++G+T ++ AA   H+EVVK L+E   N  I  +DG  P+ +A   GH  +V LLI+
Sbjct:   14 AARSGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLIS 160          

HSP 10 Score: 75.0998 bits (183), Expect = 3.347e-13
Identity = 39/126 (30.95%), Postives = 63/126 (50.00%), Query Frame = 2
Query:  299 NGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +G+LD     +    +IN    +G+  +H A   GH ++  EL+    +L+  TK+G T++H AA  G  +VV  L+    N + Q + G  P+ +A    H+E+VK L+ N      P  DG  P
Sbjct:   17 SGNLDKALEHIKNGIDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTP 142          

HSP 11 Score: 73.1738 bits (178), Expect = 1.376e-12
Identity = 43/166 (25.90%), Postives = 76/166 (45.78%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            P+H A   G  E+ + ++  K N   +   G  PLH     GH+  V+LLL  + +    T  G  P+H A   G  ++A+ L+ +    +   K G T +H A  + +++VV LL+ K  +     ++G   + IA     +E+   L+ +   +   +  GV P
Sbjct:  411 PLHCAARMGHKELVKLLLEHKANPNSTTTAGHSPLHIAAREGHVQTVRLLLDMEAQQTKMTKKGFTPLHVASKYGKVDVAELLLERGANPNAAGKNGLTPLHVAVHHNNLDVVNLLVSKGGSPHSAARNGYTALHIAAKQNQVEVANSLLQHGASANAESLQGVTP 576          

HSP 12 Score: 71.633 bits (174), Expect = 3.707e-12
Identity = 37/123 (30.08%), Postives = 62/123 (50.41%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTD 550
            +HIA  +   E+A  ++    +    +  G  PLH     G  DIV LL+SK   +N     G+ P+H     GH  IA  L+ +   +   T+ G+T +H A   G+I++VK L++++ N +
Sbjct:  544 LHIAAKQNQVEVANSLLQHGASANAESLQGVTPLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVN 666          

HSP 13 Score: 64.6994 bits (156), Expect = 5.151e-10
Identity = 50/191 (26.18%), Postives = 82/191 (42.93%), Query Frame = 2
Query:  155 IDITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQ-----------DKDGCRPILIACAYGHIEIVKLLIN---NQNIS--FCPARDG 667
            IDI T  +     +H+A  +G  +M   +++     E + K G   LH     G   +V  L++    +N Q+  G  P++ A    H E+ K L+       I T+ G+T +  A   GH  VV LLI       ++              G  P+ IA  Y ++ + +LL+N   N  ++   C AR+G
Sbjct:   31 IDINTANQNGLNALHLASKEGHVKMVLELLHNGIVLETTTKKGNTALHIAALAGQEQVVTELVNYGTNVNAQSQKGFTPLYMAAQENHLEVVKFLLENGANQSIPTEDGFTPLAVALQQGHENVVALLISYGTKGKVRLPALTDFCFFLSVTGFTPLHIAAHYENLNVAQLLLNRGANDELTPLHCAARNG 221          

HSP 14 Score: 62.3882 bits (150), Expect = 2.549e-9
Identity = 27/103 (26.21%), Postives = 54/103 (52.43%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHW 487
            P+H+A  +G  ++   +++K+ N    NK+G  PLH     GH+ I  +L+ +   +   T  G  P+H AC  G+ ++ K L+ +   ++ +T+  +   H+
Sbjct:  576 PLHLASQEGRPDIVSLLISKQANVNLGNKSGLTPLHLVAQEGHVGIADILVKQGASVYAATRMGYTPLHVACHYGNIKMVKFLLQQQANVNSKTRVEYIQCHY 678          
BLAST of SMED30023739 vs. Ensembl Medaka
Match: psmd10 (proteasome 26S subunit, non-ATPase 10 [Source:NCBI gene;Acc:101166639])

HSP 1 Score: 95.5153 bits (236), Expect = 1.397e-21
Identity = 46/149 (30.87%), Postives = 80/149 (53.69%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +H AC+ G   + EF+++        +   W PLH   + G  DIV+ L+SK  ++N    +G  P+H+A +   +EIA  L+      +   K  WT +H A+  G+  +++LL+++  +T+IQD  G  P+ +AC    +E  KLL+
Sbjct:   44 LHWACSAGHTNIVEFLLDLGVEVNLQDDASWTPLHIAASAGREDIVKALISKGAQLNSVNQNGCTPLHYAASKDRYEIALMLLENGADPNATDKLEWTPLHRASAKGNYRLIQLLLKQSASTNIQDCQGNTPLHLACEEERVEAAKLLV 192          

HSP 2 Score: 70.8626 bits (172), Expect = 3.977e-13
Identity = 39/137 (28.47%), Postives = 69/137 (50.36%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIA 589
            P+HIA + G  ++ + +++K       N+NG  PLH+  +    +I  +LL    + N        P+H A A G++ + + L+ +    +IQ  QG T +H A     +E  KLL+E   +  I++K+   P+ IA
Sbjct:   76 PLHIAASAGREDIVKALISKGAQLNSVNQNGCTPLHYAASKDRYEIALMLLENGADPNATDKLEWTPLHRASAKGNYRLIQLLLKQSASTNIQDCQGNTPLHLACEEERVEAAKLLVEHGASIYIENKEEKTPLQIA 212          

HSP 3 Score: 60.077 bits (144), Expect = 1.373e-9
Identity = 36/132 (27.27%), Postives = 63/132 (47.73%), Query Frame = 2
Query:  242 CNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMR-PIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            CN+ Y+              G  D ++  +  D  + C+T+   R  +H+AC+ GH  I + L+     +++Q    WT +H AA  G  ++VK LI K    +  +++GC P+  A +    EI  +L+ N
Sbjct:   11 CNYAYT--------------GQFDKLKQCILSDKTLACKTDQDRRTALHWACSAGHTNIVEFLLDLGVEVNLQDDASWTPLHIAASAGREDIVKALISKGAQLNSVNQNGCTPLHYAASKDRYEIALMLLEN 128          
BLAST of SMED30023739 vs. Ensembl Medaka
Match: ENSORLT00000039903.1 (pep primary_assembly:ASM223467v1:15:18469388:18484014:-1 gene:ENSORLG00000030042.1 transcript:ENSORLT00000039903.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 97.8265 bits (242), Expect = 7.230e-21
Identity = 51/173 (29.48%), Postives = 89/173 (51.45%), Query Frame = 2
Query:  158 DITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            DIT    P+H+A  +G   M + ++++    E   K+G  PLH    +GH  +V++LL +   I  +T +G+ P+H A    H    + L+  D  +D  T    T++H AA  GH +V KL+++KK N + +  +G  P+ IAC    + +++LL+ +          G+ P
Sbjct:  244 DIT----PLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTP 412          

HSP 2 Score: 88.5817 bits (218), Expect = 6.343e-18
Identity = 58/211 (27.49%), Postives = 100/211 (47.39%), Query Frame = 2
Query:   35 NYCNLILIRMSESEIFKDFVLQNNLKGI---MDLSNPNLINKIID----ITTNTR----PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N   L+L R +      DF+ +N++  +       N N++  ++D    I   T+    P+H     G  ++ E ++++        KNG  PLH      HL+ VQLLL  D  ++  TND +  +H A   GH+++AK ++ K    + +   G+T +H A     + V++LL++   +     + G  PI +A   GH  IV  LIN+
Sbjct:  225 NVATLLLNRAAAV----DFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTPLHIACKKNRVRVMELLLKHGASIQAVTESGLTPIHVAAFMGHENIVSALINH 431          

HSP 3 Score: 88.1965 bits (217), Expect = 9.733e-18
Identity = 45/177 (25.42%), Postives = 88/177 (49.72%), Query Frame = 2
Query:  146 NKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            N  ++  +   P+HIA + G   +A  ++N+    ++  +N   PLH     G+ ++V+LLL +   I  +T DG+ P+H    +GH ++ + L+ +   +  +TK G + +H A    H+  V+LL++     D    D    + +A   GH ++ KL+++ +      A +G  P
Sbjct:  203 NADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLLQHDVPVDDVTNDYLTALHVAAHCGHYKVAKLIVDKKANPNAKALNGFTP 379          

HSP 4 Score: 85.5001 bits (210), Expect = 7.344e-17
Identity = 39/125 (31.20%), Postives = 66/125 (52.80%), Query Frame = 2
Query:  260 NKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINN 634
            N+NG   LH     GH+++V  LL     ++  T  G   +H +   G  E+  EL+     ++ Q++ G+T ++ AA   H+EVV+ L+E   +  I  +DG  P+ +A   GH ++V LL+ N
Sbjct:   47 NQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLEN 171          

HSP 5 Score: 79.7221 bits (195), Expect = 4.904e-15
Identity = 40/149 (26.85%), Postives = 81/149 (54.36%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLI 628
            +HIA  K   + A  ++    N +  +K+G+ PLH     G++++  LLL++   ++    + + P+H A   G+  + K L+ +   ++ +TK G T +H  A +GH +VV++L+++      + K+G  P+ +A    H+  V+LL+
Sbjct:  182 LHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGDHLNCVQLLL 330          

HSP 6 Score: 78.5666 bits (192), Expect = 9.940e-15
Identity = 56/225 (24.89%), Postives = 94/225 (41.78%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKD----------------------CLL-------DIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKN 769
            +HI+   G  E+   +V    N    ++NG+ PL+      HL++V+ LL      +  T DG  P+  A   GH ++   L+  D                       LL       D+++K G+T +H AA  G+I V  LL+ +    D   ++   P+ +A   G+  +VKLL++         +DG+ P   G     ++ +E L  +     I S  KN
Sbjct:   87 LHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEIL--LDRGAPILSKTKN 309          

HSP 7 Score: 78.5666 bits (192), Expect = 1.186e-14
Identity = 47/194 (24.23%), Postives = 81/194 (41.75%), Query Frame = 2
Query:  182 IHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKC-----------------------------NTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            +H+A  +G  E+   ++    + + + K G   LH     G  ++V  L++    +N Q+ +G  P++ A    H E+ + L+       I T+ G+T +  A   GH +VV LL+E                                N D++ K G  P+ IA  YG+I +  LL+N        AR+ + P
Sbjct:   54 LHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITP 247          

HSP 8 Score: 78.1814 bits (191), Expect = 1.505e-14
Identity = 39/125 (31.20%), Postives = 62/125 (49.60%), Query Frame = 2
Query:  302 GHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP 676
            G+L+ V   L    EIN    +G+  +H A   GH E+  EL+     +D  TK+G T++H ++  G  EVV  L+    N + Q ++G  P+ +A    H+E+V+ L+ N         DG  P
Sbjct:   28 GNLEKVLDYLKSGVEINICNQNGLNALHLASKEGHVEVVAELLKLGASVDAATKKGNTALHISSLAGQAEVVTELVTNGANVNAQSQNGFTPLYMAAQENHLEVVRFLLENSASQSIATEDGFTP 152          

HSP 9 Score: 73.1738 bits (178), Expect = 5.703e-13
Identity = 48/219 (21.92%), Postives = 97/219 (44.29%), Query Frame = 2
Query:  179 PIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCE-----------------------------INCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAP---SVAGEIHLDKKCLEFLGGIQH 739
            P+++A  +   E+  F++    +   + ++G+ PL      GH  +V LLL  D +                              + ++  G  P+H A   G+  +A  L+ +   +D   +   T +H AA  G+  +VKLL+++    + + KDG  P+      GH ++V++L++         ++G++P   +  G+ HL+  C++ L  +QH
Sbjct:  119 PLYMAAQENHLEVVRFLLENSASQSIATEDGFTPLAVALQQGHDQVVSLLLENDTKGKVRLPALHIAARKDDTKAAALLLQNDHNADVESKSGFTPLHIAAHYGNINVATLLLNRAAAVDFMARNDITPLHVAAKRGNSNMVKLLLDRGARIEAKTKDGLTPLHCGARSGHEQVVEILLDRGAPILSKTKNGLSPLHMATQGD-HLN--CVQLL--LQH 332          
BLAST of SMED30023739 vs. Planmine SMEST
Match: SMESG000057519.1 (SMESG000057519.1)

HSP 1 Score: 1716.05 bits (4443), Expect = 0.000e+0
Identity = 878/928 (94.61%), Postives = 878/928 (94.61%), Query Frame = 2
Query:  119 MDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETILPLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETIFLFPFKEKWFDFADKLVNLLCKDFLLQNISKEIIQSCLEHDKISLVKSLFDKASDDVQQSVLEGIIYHAAGTANKEFFLYMIDKDLKCPKXXXXXXXXXXXXXXXRKFEFCKEILSSKNGYKHVRSKNNKSQYPMHVAIDVGDIQMIDELIQESHEFNEEDDNGRTPLTQLFEKLSTADEVLINYVQKDIYSIIQTSTKIKLVLSIKTTIRCGSNIHKVMRSGGTAIDTCTQVEYRNDIIRFYDQKK 2902
            MDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATENNLNNIIQIIMNKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQ                                   RIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETILPLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETIFLFPFKEKWFDFADKLVNLLCKDFLLQNISKEIIQSCLEHDKISLVKSLFDKASDDVQQSVLEGIIYHAAGTANKEFFLYMIDKDLKCPKLFENGETLLTNLLLERKFEFCKEILSSKNGYKHVRSKNNKSQYPMHVAIDVGDIQMIDELIQESHEFNEEDDNGRTPLTQLFEKLSTADE               TSTKIKLVLSIKTTIRCGSNIHKVMRSGGTAIDTCTQVEYRNDIIRFYDQKK
Sbjct:    1 MDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATENNLNNIIQIIMNKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQ-----------------------------------RIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETILPLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETIFLFPFKEKWFDFADKLVNLLCKDFLLQNISKEIIQSCLEHDKISLVKSLFDKASDDVQQSVLEGIIYHAAGTANKEFFLYMIDKDLKCPKLFENGETLLTNLLLERKFEFCKEILSSKNGYKHVRSKNNKSQYPMHVAIDVGDIQMIDELIQESHEFNEEDDNGRTPLTQLFEKLSTADE---------------TSTKIKLVLSIKTTIRCGSNIHKVMRSGGTAIDTCTQVEYRNDIIRFYDQKK 878          
BLAST of SMED30023739 vs. Planmine SMEST
Match: SMESG000057514.1 (SMESG000057514.1)

HSP 1 Score: 652.514 bits (1682), Expect = 0.000e+0
Identity = 396/850 (46.59%), Postives = 523/850 (61.53%), Query Frame = 2
Query:  374 RPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRG-RFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETIL------PLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENIL----ERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETIFLFPFKEKWFDFADKLVNLLCKDFLLQNISKEIIQSCLEHDKISLVKSLFDKASDDVQQSVLEGIIYHAAGTANKEFFLYMIDKDLKCPKXXXXXXXXXXXXXXXRKFEFCKEILSSKNGYKHVRSKNNKSQYPMHVAIDVGDIQMIDELIQESHEFNEEDDNGRTPLTQLFEKLSTADEVLINYVQKDIYSIIQTSTKIKLVLSIKTTIRCGSNIHKVMRSGGTAIDTCTQVEYRNDIIRFY 2890
            RPIH AC  G +EI + L+   C ++ QT  GWT++H+AA  GH++VV++L++  CN + +DK G RPI +A    H+ ++ LLIN         + G           ++ C++FL      KQ+            S     ++L   +     + ++ A +N            P+ + E+   ++ +  + ++  + L+ EC LYR I++++ EGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQ                 V +I    DL                                     T  +LLETSLHEAIASGMHMKCQYLIDNSV+IDRVN +GVTALHFAVIKGFE LCEKLLRKGADCTRYIE   + ++ S  TI+      PLT  ENALTLCIKIH TIYSCFL+N+ +E + N  D   N L+H+A   L P +C  L+++G  +DK+N + N+ LMELL      N+ E IL    E ++ +++ LV+ G+++   +  G +I  +A     E LM  L+S +       E  F+  F EKWFD+A+ LV  L   FLL+NISKEII+ CLEH++ SLVKSLFDKA  +VQQSVLE IIY  A    +E FLYM+DK+L CP+LFENGETLLTNLLL +KFEFC+++  S N  KH+++KN K+Q P+ VAIDVGDI MI +L+ ES  FN EDD+G+TPLT+LFEKLS  D+   N ++K++YSII+            + IR G  ++   ++G   ID C+    + +I  ++
Sbjct:   43 RPIHVACDKGFYEIVQFLVHNQCDMEQQTDDGWTALHFAASKGHLDVVRILVDHNCNLECEDKRGWRPIHLAGFSNHLNVLTLLINRGCDILSKTKSGKTALDYARFKQNEICVKFLEMSSLDKQV------------SDTGSKLSLKETQNPNMKTEIDNAIKNIG---------NPIDNKELLQYLDIIKEIENQEEKNLMRECCLYRSIRHQNAEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQ-----------------VTFIFVGSDLW------------------------------------TTFQLLETSLHEAIASGMHMKCQYLIDNSVDIDRVNIMGVTALHFAVIKGFEGLCEKLLRKGADCTRYIETTDRSLMLS--TIIEDPLDQPLTKAENALTLCIKIHRTIYSCFLENL-DERIANSSDGELNTLLHLAVKSLLPSICTSLIKAGAEIDKMNERSNSPLMELLC-----NIDETILQEDFEEVMKILKILVDAGANVMKTTSSGRTIFYIARKLQKEKLMCILISSNFPPKYFDEDDFVEAFLEKWFDYAENLVKNLSDQFLLRNISKEIIRLCLEHNQTSLVKSLFDKADKNVQQSVLEDIIYRFAEIDEEEPFLYMVDKELICPRLFENGETLLTNLLLNKKFEFCRKVFRSVNCIKHLKAKNIKNQCPLQVAIDVGDINMIYDLVNESDMFNHEDDDGQTPLTKLFEKLSLCDD---NLIEKELYSIIE------------SIIRKGGKLYITTKTGKRVIDACSNSSIKTEIENYF 795          

HSP 2 Score: 118.627 bits (296), Expect = 7.195e-27
Identity = 84/317 (26.50%), Postives = 146/317 (46.06%), Query Frame = 2
Query:   80 FKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKL-LINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQ-----------IFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEI----------QTVMEPLNNLTDR 964
            FK  +   N  G++   + + +NKI D   N RPIH+AC+KGF+E+ +F+V+ +C+ E    +GW  LH   + GHLD+V++L+  +C + C+   G RPIH A  + H  +   LI + C +  +TK G T++ +A    +   VK L     +  + D                   KL L   QN +     D    ++   I  +K+ L++L  I+  +            ++  +++ + + F  F  P T+    +  + S LE A E +    I+ I+ K + D E+             ME L+ ++DR
Sbjct:   11 FKADLNNGNTSGVVKYFDKSFLNKIFDEKKNNRPIHVACDKGFYEIVQFLVHNQCDMEQQTDDGWTALHFAASKGHLDVVRILVDHNCNLECEDKRGWRPIHLAGFSNHLNVLTLLINRGCDILSKTKSGKTALDYARFKQNEICVKFLEMSSLDKQVSDTGS----------------KLSLKETQNPNMKTEIDNAIKNIGNPID-NKELLQYLDIIKEIENQEEKNLMRECCLYRSIRHQNAEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDR 310          
BLAST of SMED30023739 vs. Planmine SMEST
Match: SMESG000057514.1 (SMESG000057514.1)

HSP 1 Score: 650.203 bits (1676), Expect = 0.000e+0
Identity = 399/863 (46.23%), Postives = 522/863 (60.49%), Query Frame = 2
Query:  374 RPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFL--------------IEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETIL------PLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENIL----ERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETIFLFPFKEKWFDFADKLVNLLCKDFLLQNISKEIIQSCLEHDKISLVKSLFDKASDDVQQSVLEGIIYHAAGTANKEFFLYMIDKDLKCPKXXXXXXXXXXXXXXXRKFEFCKEILSSKNGYKHVRSKNNKSQYPMHVAIDVGDIQMIDELIQESHEFNEEDDNGRTPLTQLFEKLSTADEVLINYVQKDIYSIIQTSTKIKLVLSIKTTIRCGSNIHKVMRSGGTAIDTCTQVEYRNDIIRFY 2890
            RPIH AC  G +EI + L+   C ++ QT  GWT++H+AA  GH++VV++L++  CN + +DK G RPI +A    H+ ++ LLIN         + G           ++ C++FL      KQ+         D  S        +S++E    ++                  K   D+ I+ +  P++N  +  ++L              + EC LYR I++++ EGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQ                 V +I    DL                                     T  +LLETSLHEAIASGMHMKCQYLIDNSV+IDRVN +GVTALHFAVIKGFE LCEKLLRKGADCTRYIE   + ++ S  TI+      PLT  ENALTLCIKIH TIYSCFL+N+ +E + N  D   N L+H+A   L P +C  L+++G  +DK+N + N+ LMELL      N+ E IL    E ++ +++ LV+ G+++   +  G +I  +A     E LM  L+S +       E  F+  F EKWFD+A+ LV  L   FLL+NISKEII+ CLEH++ SLVKSLFDKA  +VQQSVLE IIY  A    +E FLYM+DK+L CP+LFENGETLLTNLLL +KFEFC+++  S N  KH+++KN K+Q P+ VAIDVGDI MI +L+ ES  FN EDD+G+TPLT+LFEKLS  D+   N ++K++YSII+            + IR G  ++   ++G   ID C+    + +I  ++
Sbjct:   43 RPIHVACDKGFYEIVQFLVHNQCDMEQQTDDGWTALHFAASKGHLDVVRILVDHNCNLECEDKRGWRPIHLAGFSNHLNVLTLLINRGCDILSKTKSGKTALDYARFKQNEICVKFLEMSSLDKQV--------SDTGSK-------LSLKETQNPNM------------------KTEIDNAIKNIGNPIDNKQELLQYLDIIKEIENQEEKNLMRECCLYRSIRHQNAEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQ-----------------VTFIFVGSDLW------------------------------------TTFQLLETSLHEAIASGMHMKCQYLIDNSVDIDRVNIMGVTALHFAVIKGFEGLCEKLLRKGADCTRYIETTDRSLMLS--TIIEDPLDQPLTKAENALTLCIKIHRTIYSCFLENL-DERIANSSDGELNTLLHLAVKSLLPSICTSLIKAGAEIDKMNERSNSPLMELLC-----NIDETILQEDFEEVMKILKILVDAGANVMKTTSSGRTIFYIARKLQKEKLMCILISSNFPPKYFDEDDFVEAFLEKWFDYAENLVKNLSDQFLLRNISKEIIRLCLEHNQTSLVKSLFDKADKNVQQSVLEDIIYRFAEIDEEEPFLYMVDKELICPRLFENGETLLTNLLLNKKFEFCRKVFRSVNCIKHLKAKNIKNQCPLQVAIDVGDINMIYDLVNESDMFNHEDDDGQTPLTKLFEKLSLCDD---NLIEKELYSIIE------------SIIRKGGKLYITTKTGKRVIDACSNSSIKTEIENYF 796          

HSP 2 Score: 119.398 bits (298), Expect = 3.311e-27
Identity = 83/317 (26.18%), Postives = 145/317 (45.74%), Query Frame = 2
Query:   80 FKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKL-LINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQ-----------IFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEI----------QTVMEPLNNLTDR 964
            FK  +   N  G++   + + +NKI D   N RPIH+AC+KGF+E+ +F+V+ +C+ E    +GW  LH   + GHLD+V++L+  +C + C+   G RPIH A  + H  +   LI + C +  +TK G T++ +A    +   VK L     +  + D                   KL L   QN +     D    ++   I   ++ L++L  I+  +            ++  +++ + + F  F  P T+    +  + S LE A E +    I+ I+ K + D E+             ME L+ ++DR
Sbjct:   11 FKADLNNGNTSGVVKYFDKSFLNKIFDEKKNNRPIHVACDKGFYEIVQFLVHNQCDMEQQTDDGWTALHFAASKGHLDVVRILVDHNCNLECEDKRGWRPIHLAGFSNHLNVLTLLINRGCDILSKTKSGKTALDYARFKQNEICVKFLEMSSLDKQVSDTGS----------------KLSLKETQNPNMKTEIDNAIKNIGNPIDNKQELLQYLDIIKEIENQEEKNLMRECCLYRSIRHQNAEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDR 311          
BLAST of SMED30023739 vs. Planmine SMEST
Match: SMESG000019959.1 (SMESG000019959.1)

HSP 1 Score: 593.193 bits (1528), Expect = 0.000e+0
Identity = 351/950 (36.95%), Postives = 555/950 (58.42%), Query Frame = 2
Query:   62 MSESEIFKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIP------QFMLDSKETILPLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETIFLFPFKEKWFDFADKLVNLLCKDFLLQNISKEIIQSCLEHDKISLVKSLFDKASDDVQQSVLEGIIYHAAGTANKEFFLYMIDKDLKCPKXXXXXXXXXXXXXXXRKFEFCKEILSSKNGYKHVRSKNNKSQYPMHVAIDVGDIQMIDELIQESHEFNEEDDNGRTPLTQLFEKLSTADEVLINYVQKDIYSIIQTSTKIKLVLSIKTTIRCGSNIHKVMRSGG-TAIDTCTQVEYRNDIIRFY 2890
            M + + FK  +++ N + + +  +   ++KI+D      PIHIAC  GF E+A+ ++++ CN     K+G RP+H+    GH +IV+LLL ++C   C+   G RPIH+A   GH EI K L+ ++C  + +TK G   IH+A+ NGH E+VKLL+++ CNT+ +++ G RPI  A   GH EIVKL +  +    C  +DG +P    + +    C++ L  ++   ++F+ ++  D  +    +     +     T ++VLE A  +N + II+ I++K + + EI  V++ L         L++E  LY CI   HM GFK F S + IN  R+ V  +FLE+AVE      I  IL+KTIYDK +W +A   A++N  +EI  EI +R  ++ SR+++N +I HTA+ DN+ DM++Y+LD+P++ D + NN   GTAL+ A+ LH + CI +L+QY +D NT+NK  ET LH AIASGM   C YLI  S+ ID+   +G+T LH AVI+G  ++C +L+ +GADC R + N+P      +  +   ++ + LT  EN+LTL +K H TI+ CFL+ +   +  N  D + N L+H+A  CLQP++C  LL +G  VD +N+  N+ L+EL   +    + ++ L ++I + + L+  G+D+N  S  G S+   AS   SE LM+ LVS   +L N +   F   F  +WF +A+ L+ LL  DFL   IS +  QSC E    +L+KSLF+K+S ++QQSV+E ++Y A  + + E F + I  ++  PK   NGE L T +L ERK EF  ++L S N  K V+ +N  +Q P  +AI++ ++ +++ LI E+ + + ED+ G   LTQL EK+S ++ V               + K KL+LSIK+ I  G +I+K+   G    ID CT    + +I R++
Sbjct:    1 MGDFQSFKKHLMKGNAERVRNNLSGGFVDKIVDDKYGYFPIHIACRDGFVEVAKLLLDRNCNTICETKSGDRPIHYASWQGHSEIVKLLLDRNCNTECENESGNRPIHYASWQGHSEIVKLLLDRNCNTECETKSGMRPIHYASWNGHSEIVKLLLDRNCNTECENESGNRPIHYASREGHSEIVKLFLQRKCRIDCKNKDGKSPLDFAKEYNRVDCMKLLTNME---KLFAIIERDDPIEIEKLFISCEFIRENIYTGLNVLEMAMTSNADKIIKWILDKSIDNKEIDEVIKELTAKDKENANLLKERLLYLCITRHHMRGFKRFHSAEVINGQRRTVGPTFLELAVENGCDLLIDLILRKTIYDKSIWIKAIGKAKENGFIEIQKEIEERMTLMESRQKSNFTIFHTAISDNDVDMLQYLLDHPNIVDLNSNNETFGTALSLAYSLHQRNCIAVLQQYQLDVNTRNKYSETPLHVAIASGMDADCGYLIGRSINIDQTGYMGLTGLHCAVIRGLINVCTQLVNRGADCMRSV-NLPCQHSVGEISIPFAQSFISLTVIENSLTLSLKFHRTIFPCFLEELDLPS-SNAHDGDNNSLLHLAVKCLQPDICRSLLNAGAQVDSVNNFGNSPLLELFANREIP-VDDDTLNKLIGITKILIAKGADVNFKSSNGISVFQSASNIESEKLMVALVSNHPRLINFSSNDFQTAFLNQWFIYAELLIELLPDDFLSLAISIDTFQSC-ESAGTNLIKSLFNKSSAELQQSVIENLLYKAVNSNDVELFDHFIQTEISAPKSLGNGENLFTFILQERKIEFAWKLLDSVNRGKFVKLRNINNQIPFQIAIEIEEMDLVNALIIETKDCHSEDEGGTCALTQLLEKISISNNV---------------NFKRKLILSIKSIISLGGDIYKMTSRGQHRIIDACTDSVAKEEIERYH 928          
BLAST of SMED30023739 vs. Planmine SMEST
Match: SMESG000010579.1 (SMESG000010579.1)

HSP 1 Score: 587.8 bits (1514), Expect = 0.000e+0
Identity = 351/952 (36.87%), Postives = 546/952 (57.35%), Query Frame = 2
Query:   62 MSESEIFKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFFEMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQTNDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIEVVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPARDGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPITLMSIEEKTRISVLEFATEXXXXXXXXXXXXKPVTDDEIQTVMEPLNNLTDRGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEFSSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRKQANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHHKLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRVNSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQF-------MLDSKETILPLTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCLQPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVVRRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETIFLFPFKEKWFDFADKLVNLLCKDFLLQNISKEIIQSCLEHDKISLVKSLFDKASDDVQQSVLEGIIYHAAGTANKEFFLYMIDKDLKCPKXXXXXXXXXXXXXXXRKFEFCKEILSSKNGYKHVRSKNNKSQYPMHVAIDVGDIQMIDELIQESHEFNEEDDNGRTPLTQLFEKLSTADEVLINYVQKDIYSIIQTSTKIKLVLSIKTTIRCGSNIHKVMRSGGTAIDTCTQVEYRNDIIRFYDQ 2896
            M + + FK  +++ N +G+ +      ++KI+D      PIH+AC  GF  +A+ ++++ CN E   K+GWRP+H    NGH +IV+LLL ++C   C+   G RPIH+A   GH EI K L+ ++C ++ +TK G   IH+A+  GH E+              DK G RPI  A   GH EIVKLL+  +       +DG  P    +    K C E L   Q     F+ ++  D   F+  +    L+     T + +++ A ++N   II+ I++  + D E++ V++ L     +   LI EC LY CI +R+MEGFK+  S + IN  R++V+  FL++A       FI  I++KTIYDK +W +A   A++   +EI  E+ +R  ++ SRK+ N +ILHTA+ DN+ DMV+YIL++P++ D + NN   GTALA A+ LH + CI +L+QY +D NT+NK  ET LHEAIAS +  KC YLID S++ID+   +G+T LH AVI+G  ++C +L+ +GADC R +E I Q+        +   ++I+ LT  ENALTL +K HGT++ CF+D +   +  N+ D N N L+H+A  CL+ ++C  LL +G  V+ LN+  N+ L+E+L   +    +EN L + I + + L+  G+DIN     G +   LA+   SE LM+TLVS + +L N     F  PF+ +WF +A+ L+ LL  +FL  NI+K I   C    K  L++ LFDK+S ++QQS+LE ++Y A      E F ++I K +  P+  E+GETLLT ++ E K  F   +L S N  K V  KN  +Q  + +AI+     +ID +I ES   + ED +G++ L QL EKLS     ++N  Q   Y         KL+ ++K+ +R G +I+K+  +G   +D CT ++ + +I  F+ +
Sbjct:    1 MGDYQSFKKHLMRGNAEGVRNNLRGEFVDKIVDDYYGDFPIHVACRSGFVAVAKLLLDRNCNIECETKSGWRPIHCASRNGHSEIVKLLLDRNCNTECENKSGERPIHWASRKGHSEIVKLLLDRNCNIECKTKSGMRPIHYASLQGHSEI--------------DKSGKRPIHWASWGGHSEIVKLLLERKCRIDSKTKDGETPLDIAKARNRKDCEELLIRAQQ----FAAIERDDVIAFNDLFESPKLIWQNLFTGLDLMDKAIDSNAYQIIKWILDAMIDDKEVKEVIKELTGKRFKNPNLINECILYLCIAHRNMEGFKLSISAEVINGQRRIVELPFLQLAAAQGCDLFIGLIIRKTIYDKSLWIKAIDAAKEKGFVEIQEEMQERMLLMESRKKVNFTILHTAISDNDADMVQYILNHPNIFDLNTNNETFGTALALAYSLHQRKCIRVLQQYQLDVNTRNKYSETPLHEAIASELEDKCGYLIDRSIDIDQTGFMGLTGLHCAVIRGMVNVCAQLVNRGADCMRSVEIINQYSGKENAPSIPFAQSIISLTCTENALTLSMKFHGTLFPCFVDRLDLRS-SNVHDGNNNSLLHLAVKCLKQDICSSLLNAGAHVNTLNNFGNSPLLEML-NDAQLVANENNLNKSIEITKILIGNGADINAQLSNGITAFQLAANIGSEELMLTLVSNNPKLINFISIDFKLPFQNQWFSYAEALIKLLPDNFLSSNITKNIFHLCRNEHK--LIQLLFDKSSPELQQSILESLLYDAVNADENELFKHLIKKQILMPRTLEDGETLLTFMIKENKIVFATNLLKSVNKMKFVNLKNRTNQSAVQLAIEADQFDLIDLMIHESEGLDCEDSDGKSALAQLMEKLS-----ILNNDQN--YG--------KLISTVKSAMRSGGDIYKITTNGRRIVDLCTNMDAKAEIEEFHGR 915          
The following BLAST results are available for this feature:
BLAST of SMED30023739 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK25.549e-2228.57ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK25.652e-2228.57ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK26.890e-2228.31ankyrin 2 [Source:HGNC Symbol;Acc:HGNC:493][more]
ANK13.121e-2130.60ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
ANK13.121e-2130.60ankyrin 1 [Source:HGNC Symbol;Acc:HGNC:492][more]
back to top
BLAST of SMED30023739 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
trp-43.203e-1928.57TRP (Transient receptor potential) channel family ... [more]
mask-14.413e-1829.59Ankyrin repeat and KH domain-containing protein ma... [more]
mask-14.490e-1829.59Ankyrin repeat and KH domain-containing protein ma... [more]
mask-14.527e-1829.59Ankyrin repeat and KH domain-containing protein ma... [more]
mask-14.565e-1829.59Ankyrin repeat and KH domain-containing protein ma... [more]
back to top
BLAST of SMED30023739 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank22.399e-2128.99gene:FBgn0261788 transcript:FBtr0334062[more]
Ank22.461e-2130.12gene:FBgn0261788 transcript:FBtr0303119[more]
Ank2.600e-2131.93gene:FBgn0011747 transcript:FBtr0089172[more]
Ank2.600e-2131.93gene:FBgn0011747 transcript:FBtr0300497[more]
Ank2.600e-2131.93gene:FBgn0011747 transcript:FBtr0089171[more]
back to top
BLAST of SMED30023739 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1b2.350e-2222.51ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
BX640476.12.714e-2229.52ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.12.811e-2229.52ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.13.132e-2229.52ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
BX640476.13.518e-2229.52ankyrin 1, erythrocytic b [Source:NCBI gene;Acc:79... [more]
back to top
BLAST of SMED30023739 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ANK14.544e-2330.72ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK14.754e-2330.72ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK15.082e-2330.72ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK15.616e-2330.72ankyrin 1 [Source:NCBI gene;Acc:613080][more]
ANK11.193e-2230.72ankyrin 1 [Source:NCBI gene;Acc:613080][more]
back to top
BLAST of SMED30023739 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ank36.180e-2332.76ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank19.463e-2328.80ankyrin 1, erythroid [Source:MGI Symbol;Acc:MGI:88... [more]
Ank31.436e-2232.76ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.518e-2232.76ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
Ank31.539e-2232.76ankyrin 3, epithelial [Source:MGI Symbol;Acc:MGI:8... [more]
back to top
BLAST of SMED30023739 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P16157|ANK1_HUMAN1.499e-2030.60Ankyrin-1 OS=Homo sapiens OX=9606 GN=ANK1 PE=1 SV=... [more]
sp|O75832|PSD10_HUMAN5.347e-2031.3326S proteasome non-ATPase regulatory subunit 10 OS... [more]
sp|P57078|RIPK4_HUMAN1.025e-1930.52Receptor-interacting serine/threonine-protein kina... [more]
sp|Q8C8R3|ANK2_MOUSE1.808e-1928.57Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV... [more]
sp|Q01484|ANK2_HUMAN1.842e-1928.57Ankyrin-2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=... [more]
back to top
BLAST of SMED30023739 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
B3EU242.309e-3622.58Uncharacterized protein OS=Amoebophilus asiaticus ... [more]
Q16FJ05.294e-3536.36AAEL014741-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
Q16FI91.244e-3339.16AAEL014742-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
W4XM803.540e-3324.42ANK_REP_REGION domain-containing protein OS=Strong... [more]
J9HSB73.643e-3330.08AAEL017480-PA (Fragment) OS=Aedes aegypti OX=7159 ... [more]
back to top
BLAST of SMED30023739 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ank1a1.158e-2230.12ankyrin 1, erythrocytic a [Source:ZFIN;Acc:ZDB-GEN... [more]
ENSAMXT00000037173.11.685e-2130.12pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
ank1b5.779e-2128.42ankyrin 1, erythrocytic b [Source:ZFIN;Acc:ZDB-GEN... [more]
ank3b3.428e-2031.03ankyrin 3b [Source:ZFIN;Acc:ZDB-GENE-060621-2][more]
ENSAMXT00000017800.28.091e-2028.92pep primary_assembly:Astyanax_mexicanus-2.0:16:210... [more]
back to top
BLAST of SMED30023739 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000000093.14.455e-2230.64pep scaffold:Pmarinus_7.0:GL477582:20502:66045:1 g... [more]
ENSPMAT00000000095.15.482e-2229.14pep scaffold:Pmarinus_7.0:GL477582:20897:60453:1 g... [more]
ENSPMAT00000002048.11.528e-1930.20pep scaffold:Pmarinus_7.0:GL477431:30859:73495:1 g... [more]
ENSPMAT00000007446.13.612e-1927.11pep scaffold:Pmarinus_7.0:GL478728:200023:240674:1... [more]
ENSPMAT00000007449.13.750e-1927.11pep scaffold:Pmarinus_7.0:GL478728:201453:233342:1... [more]
back to top
BLAST of SMED30023739 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
NAS63.373e-1528.22Evolutionarily conserved 19S regulatory particle a... [more]
GDE11.650e-1126.67Glycerophosphocholine (GroPCho) phosphodiesterase;... [more]
HOS41.210e-1034.78Subunit of the Set3 complex; complex is a meiotic-... [more]
AVO23.472e-626.32Component of a complex containing the Tor2p kinase... [more]
YAR16.210e-630.97Ankyrin-repeat containing, nucleocytoplasmic shutt... [more]
back to top
BLAST of SMED30023739 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO436901.675e-1533.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281787.018e-1534.75Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO460991.715e-1427.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO348234.468e-1430.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO433812.647e-1331.51Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of SMED30023739 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000031565.18.586e-2230.72ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ENSORLT00000039458.18.638e-2230.72ankyrin 2 [Source:NCBI gene;Acc:101161458][more]
ank1a8.647e-2233.13ankyrin-1 [Source:NCBI gene;Acc:101174837][more]
psmd101.397e-2130.87proteasome 26S subunit, non-ATPase 10 [Source:NCBI... [more]
ENSORLT00000039903.17.230e-2129.48pep primary_assembly:ASM223467v1:15:18469388:18484... [more]
back to top
BLAST of SMED30023739 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057519.10.000e+094.61SMESG000057519.1[more]
SMESG000057514.17.195e-2746.59SMESG000057514.1[more]
SMESG000057514.13.311e-2746.23SMESG000057514.1[more]
SMESG000019959.10.000e+036.95SMESG000019959.1[more]
SMESG000010579.10.000e+036.87SMESG000010579.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023739 ID=SMED30023739|Name=SMED30023739|organism=Schmidtea mediterranea sexual|type=transcript|length=3057bp
TTTAATTGTTTCGATTTAATTAATTTTCTTACCTAATTACTGTAATCTAA
TTTTAATAAGAATGAGTGAATCTGAAATATTTAAAGACTTTGTGTTACAA
AACAATTTAAAGGGAATTATGGACTTATCAAATCCCAATTTGATTAACAA
AATTATTGATATCACGACAAACACTAGACCAATCCATATTGCTTGCAATA
AAGGTTTTTTTGAAATGGCTGAATTCATGGTAAATAAAAAGTGTAACTTT
GAATATTCAAACAAAAATGGATGGAGACCATTGCATCACTGCTGTGCCAA
TGGCCATTTGGATATTGTTCAATTATTATTGTCTAAGGATTGCGAGATTA
ATTGTCAGACAAACGATGGAATGAGACCGATTCATTTCGCTTGTGCAAAT
GGACATTTTGAAATTGCTAAAGAGCTAATCGCAAAAGATTGCTTATTAGA
CATTCAAACAAAACAAGGCTGGACCTCGATTCATTGGGCAGCTTGCAATG
GACATATTGAGGTCGTGAAATTGCTGATTGAAAAAAAATGTAATACCGAT
ATCCAAGACAAAGATGGCTGCCGACCGATTCTCATTGCTTGTGCATATGG
CCATATTGAAATTGTCAAATTGCTCATCAATAATCAGAATATCAGTTTTT
GTCCAGCTAGGGACGGAGTGGCTCCCTCGGTGGCTGGTGAAATCCATTTA
GACAAGAAATGTTTGGAATTTCTAGGTGGAATCCAACATTCAAAACAAAT
TTTTTCCTGCTTAAAGAACATCGACTGTGACAAATTCAGTACATTTTACA
GACCTATAACTCTCATGTCAATTGAGGAAAAGACCCGAATTTCTGTTCTG
GAATTCGCAACGGAAAACAATTTGAATAACATTATCCAAATTATAATGAA
TAAACCAGTTACCGATGATGAGATCCAAACTGTCATGGAACCTTTGAATA
ATCTCACGGATAGAGGCAGGTTTTTGATAGAAGAGTGTTTCCTTTATCGT
TGTATCAAAAATCGTCATATGGAAGGGTTCAAAATCTTCAGCTCCCCGCA
AACCATCAATCGACCTCGTAAACTGGTTCAGAAATCATTCTTGGAGATTG
CCGTTGAATTCTCAAGCCGAGGATTTATCAAAGACATTTTACAGAAAACT
ATTTACGATAAAGAAGTCTGGGATAGAGCCAAAAAGGATGCAGAACAAAA
TAATCAGATGGAGATTCTCTCTGAAATATCAGATAGAGAATTCGTTCTTT
CATCACGAAAACAAGCAAATTTATCGATTTTACACACGGCAGTATGTGAT
AATAACCCGGACATGGTTAAGTATATTCTGGACAATCCTGATCTCGCCGA
TAAGGACATGAATAATCCGAGAATCGGCACAGCACTCGCGTTCGCTCACA
TGTTGCACCATAAACTGTGCATAGACATCCTTGAACAATATAACGTTGAT
GCCAACACACAAAATAAATTGCTGGAAACATCTTTACATGAGGCAATAGC
CAGTGGAATGCACATGAAATGTCAATATTTGATAGATAATTCTGTGGAGA
TCGATAGAGTCAATAGCATCGGAGTGACGGCTTTGCATTTTGCGGTCATT
AAAGGGTTTGAAGACTTATGTGAGAAATTATTGAGAAAAGGTGCTGATTG
CACACGATATATCGAGAACATACCACAATTTATGTTGGACAGTAAAGAAA
CCATTTTACCTCTCACGACAAAAGAGAATGCTTTGACTTTGTGTATCAAA
ATCCACGGAACCATTTATTCGTGTTTCCTGGACAATGTTAGCAATGAGGC
ATTGGGAAATATCCGAGATGCCAATGAAAATTTCCTGATCCACATGGCTG
CATTATGCCTCCAGCCAGAGGTTTGTTTAAAATTGCTAGAATCAGGACTG
GTGGTTGACAAACTGAATAGCAAATTTAATACAGCTTTGATGGAATTGTT
GGTAACGAAATCGAATCAGAATATGTCTGAAAATATTTTGGAAAGAATGA
TATCAGTTGTGAGAAGGTTGGTGGAATTCGGGTCCGATATTAACACATTA
TCCGTTGGGGGCGATTCCATTTTGGCATTGGCATCTCCATTTCTCAGTGA
ATGCCTAATGATCACTCTGGTGTCGAAATCTCATCAATTAAATAATGTCA
CTGAAACCATTTTTCTTTTCCCATTTAAAGAAAAGTGGTTTGATTTTGCG
GATAAGCTAGTCAACCTTTTATGCAAGGATTTTCTGTTGCAAAATATTTC
AAAGGAAATCATCCAATCGTGCTTGGAACATGATAAAATAAGTTTAGTTA
AATCGCTCTTTGATAAAGCAAGCGATGATGTCCAACAATCGGTCTTGGAA
GGCATCATTTACCATGCGGCTGGGACCGCCAATAAGGAATTCTTTCTTTA
TATGATTGACAAAGACTTAAAATGTCCGAAATTGTTTGAAAACGGAGAGA
CATTACTCACGAATTTATTGCTGGAGAGGAAATTTGAATTCTGTAAAGAG
ATTTTATCTTCTAAAAATGGGTATAAACATGTGCGATCAAAAAACAATAA
GAGTCAGTATCCAATGCATGTCGCAATTGATGTTGGAGATATTCAGATGA
TTGATGAGTTGATCCAAGAATCTCATGAATTCAACGAGGAAGATGATAAT
GGCCGGACTCCACTTACGCAATTATTTGAGAAACTGTCAACAGCAGATGA
AGTATTGATTAATTATGTTCAGAAAGATATTTATTCTATAATACAGACAT
CAACAAAAATAAAATTAGTGTTATCGATTAAAACAACGATTAGATGTGGT
AGTAATATTCACAAAGTAATGAGAAGCGGGGGGACAGCCATCGATACATG
TACTCAAGTTGAGTATAGAAATGATATCATCCGATTCTATGACCAAAAGA
AAAATAATTCCAGTTTGCTTAATAATTCTGTTTGAAAATGCTAATTCATT
TTGACATATTAAAATAAGATTATTTTTATCTTTTACTAAATAGATTTTTG
TTTTAATGTATTTCTTAAGTTCTTGATCACTGGGAATTGATTAATATTGA
ACGCGAT
back to top

protein sequence of SMED30023739-orf-1

>SMED30023739-orf-1 ID=SMED30023739-orf-1|Name=SMED30023739-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=958bp
MSESEIFKDFVLQNNLKGIMDLSNPNLINKIIDITTNTRPIHIACNKGFF
EMAEFMVNKKCNFEYSNKNGWRPLHHCCANGHLDIVQLLLSKDCEINCQT
NDGMRPIHFACANGHFEIAKELIAKDCLLDIQTKQGWTSIHWAACNGHIE
VVKLLIEKKCNTDIQDKDGCRPILIACAYGHIEIVKLLINNQNISFCPAR
DGVAPSVAGEIHLDKKCLEFLGGIQHSKQIFSCLKNIDCDKFSTFYRPIT
LMSIEEKTRISVLEFATENNLNNIIQIIMNKPVTDDEIQTVMEPLNNLTD
RGRFLIEECFLYRCIKNRHMEGFKIFSSPQTINRPRKLVQKSFLEIAVEF
SSRGFIKDILQKTIYDKEVWDRAKKDAEQNNQMEILSEISDREFVLSSRK
QANLSILHTAVCDNNPDMVKYILDNPDLADKDMNNPRIGTALAFAHMLHH
KLCIDILEQYNVDANTQNKLLETSLHEAIASGMHMKCQYLIDNSVEIDRV
NSIGVTALHFAVIKGFEDLCEKLLRKGADCTRYIENIPQFMLDSKETILP
LTTKENALTLCIKIHGTIYSCFLDNVSNEALGNIRDANENFLIHMAALCL
QPEVCLKLLESGLVVDKLNSKFNTALMELLVTKSNQNMSENILERMISVV
RRLVEFGSDINTLSVGGDSILALASPFLSECLMITLVSKSHQLNNVTETI
FLFPFKEKWFDFADKLVNLLCKDFLLQNISKEIIQSCLEHDKISLVKSLF
DKASDDVQQSVLEGIIYHAAGTANKEFFLYMIDKDLKCPKLFENGETLLT
NLLLERKFEFCKEILSSKNGYKHVRSKNNKSQYPMHVAIDVGDIQMIDEL
IQESHEFNEEDDNGRTPLTQLFEKLSTADEVLINYVQKDIYSIIQTSTKI
KLVLSIKTTIRCGSNIHKVMRSGGTAIDTCTQVEYRNDIIRFYDQKKNNS
SLLNNSV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000043dorsal ventral margin of the whole animal
PLANA:0000070intestinal phagocyte
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002056medial muscle cell
PLANA:0003001lateral region of the whole animal
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036770Ankyrin_rpt-contain_sf
IPR002110Ankyrin_rpt
IPR020683Ankyrin_rpt-contain_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0003824catalytic activity
GO:0004190aspartic-type endopeptidase activity
Vocabulary: biological process
TermDefinition
GO:0006508proteolysis
GO:0009116nucleoside metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002110Ankyrin repeatPRINTSPR01415ANKYRINcoord: 136..151
score: 39.03
coord: 649..663
score: 32.09
IPR002110Ankyrin repeatSMARTSM00248ANK_2acoord: 168..196
e-value: 0.17
score: 20.9
coord: 621..662
e-value: 1200.0
score: 4.4
coord: 69..98
e-value: 8.5E-6
score: 35.3
coord: 830..859
e-value: 8.0
score: 15.4
coord: 503..532
e-value: 0.0074
score: 25.5
coord: 470..499
e-value: 150.0
score: 11.2
coord: 36..65
e-value: 87.0
score: 12.0
coord: 135..164
e-value: 1.5E-6
score: 37.8
coord: 588..617
e-value: 1200.0
score: 4.5
coord: 402..433
e-value: 3.1
score: 16.8
coord: 102..131
e-value: 0.081
score: 22.0
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 503..529
score: 9.885
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 102..134
score: 9.671
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 830..862
score: 8.897
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 135..167
score: 12.369
IPR002110Ankyrin repeatPROSITEPS50088ANK_REPEATcoord: 69..101
score: 10.873
IPR020683Ankyrin repeat-containing domainPFAMPF12796Ank_2coord: 96..166
e-value: 1.2E-14
score: 54.6
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 36..191
score: 42.495
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 830..868
score: 11.798
IPR020683Ankyrin repeat-containing domainPROSITEPS50297ANK_REP_REGIONcoord: 402..698
score: 21.906
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 728..953
e-value: 9.6E-10
score: 40.1
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 556..683
e-value: 2.0E-6
score: 29.3
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 252..555
e-value: 5.9E-23
score: 83.1
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 22..135
e-value: 4.2E-29
score: 103.2
IPR036770Ankyrin repeat-containing domain superfamilyGENE3DG3DSA:1.25.40.20coord: 136..208
e-value: 1.9E-19
score: 71.5
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 577..870
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 311..531
IPR036770Ankyrin repeat-containing domain superfamilySUPERFAMILYSSF48403Ankyrin repeatcoord: 37..191
NoneNo IPR availablePFAMPF13637Ank_4coord: 38..90
e-value: 4.1E-10
score: 40.0
coord: 473..524
e-value: 2.6E-8
score: 34.2
NoneNo IPR availablePANTHERPTHR24126FAMILY NOT NAMEDcoord: 97..304
coord: 448..869
coord: 399..529
coord: 38..121