sine oculis-1/2

Overview
Namesine oculis-1/2 (AFC87779.1)
Smed IDSMED30023736
Length (bp)1537
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of sine oculis-1/2 (SMED30023736) t-SNE clustered cells

Violin plots show distribution of expression levels for sine oculis-1/2 (SMED30023736) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of sine oculis-1/2 (SMED30023736) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for sine oculis-1/2 (SMED30023736) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023736

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30023736SMESG000001687.1 dd_Smed_v4_15436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023736SMESG000001687.1 dd_Smed_v4_15436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023736SMESG000001687.1 dd_Smed_v4_15436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30023736SMESG000001687.1 dd_Smed_v4_15436_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023736SMESG000001687.1 Contig13603newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023736SMESG000001687.1 Contig13603uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
optic cupSMED30023736SMESG000001687.1 JN983827.1smed_ncbi_20200123PMID:21852957
Lapan et al., 2011
whole organism asexual adult fluorescence in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of sine oculis-1/2 vs. Ensembl Human
Match: SIX1 (SIX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:10887])

HSP 1 Score: 320.087 bits (819), Expect = 2.611e-106
Identity = 140/182 (76.92%), Postives = 159/182 (87.36%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. Ensembl Human
Match: SIX2 (SIX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:10888])

HSP 1 Score: 319.316 bits (817), Expect = 6.546e-106
Identity = 141/179 (78.77%), Postives = 158/179 (88.27%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENK 839
             GFTQEQVACVCEVL+ GGNI+RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPR+IWDGEETSYCFKEKSR+VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of sine oculis-1/2 vs. Ensembl Human
Match: SIX4 (SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890])

HSP 1 Score: 244.973 bits (624), Expect = 2.040e-74
Identity = 109/174 (62.64%), Postives = 133/174 (76.44%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDR 824
            + F+ + VACVCE L+ GGN+DRLA F+WSLP    L+ NES+L A+A VAFH+  + ELY ILES++F   NH  LQ LW +A Y E E+ +GR LGAV KYR+RRK+PLPRTIWDGEET YCFKEKSR  L++ Y  N YPSP EK+ LA++T L+ TQVSNWFKNRRQRDR
Sbjct:   98 LAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDR 271          
BLAST of sine oculis-1/2 vs. Ensembl Human
Match: SIX4 (SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890])

HSP 1 Score: 247.669 bits (631), Expect = 7.439e-73
Identity = 109/174 (62.64%), Postives = 133/174 (76.44%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDR 824
            + F+ + VACVCE L+ GGN+DRLA F+WSLP    L+ NES+L A+A VAFH+  + ELY ILES++F   NH  LQ LW +A Y E E+ +GR LGAV KYR+RRK+PLPRTIWDGEET YCFKEKSR  L++ Y  N YPSP EK+ LA++T L+ TQVSNWFKNRRQRDR
Sbjct:  106 LAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDR 279          
BLAST of sine oculis-1/2 vs. Ensembl Human
Match: SIX6 (SIX homeobox 6 [Source:HGNC Symbol;Acc:HGNC:10892])

HSP 1 Score: 229.565 bits (584), Expect = 1.248e-71
Identity = 101/173 (58.38%), Postives = 135/173 (78.03%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLP----PCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNR 809
            + F+ +QVA VCE LE  G+++RL  F+WSLP     C+ L  NESVL A+A VAFH  N++ELY ILE++ F+  +H KLQALWL+AHY E EK++GR LG V KYR+R+K+PLPRTIWDGE+ ++CFKE++R +LR+WYL +PYP+P +K++LA+ T LT TQV NWFKNR
Sbjct:    7 LNFSPQQVAGVCETLEESGDVERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHGGNYRELYHILENHKFTKESHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNR 179          
BLAST of sine oculis-1/2 vs. Ensembl Celegans
Match: ceh-33 (Homeobox protein ceh-33 [Source:UniProtKB/Swiss-Prot;Acc:Q94166])

HSP 1 Score: 242.276 bits (617), Expect = 9.325e-77
Identity = 109/174 (62.64%), Postives = 135/174 (77.59%), Query Frame = 3
Query:  309 FTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAA 830
            +++EQVAC+CE L N     +L+ F+W++    +++ N+ +L A+A +AFH  NFKELYRI+ES+ F+  +H  LQ  WL AHY E EKI+GR LGAV KYRIRRKYPLPRTIWDGEETSYCF++KSR +LR WY  N YPSPREK++LAE T LT TQVSNWFKNRRQRDRA 
Sbjct:   20 YSEEQVACICEALSNDAR--KLSQFVWTVLERDEMRNNQYILKAQAFLAFHSNNFKELYRIIESHHFASEHHLPLQEWWLNAHYHEAEKIRGRQLGAVGKYRIRRKYPLPRTIWDGEETSYCFRDKSRVLLRDWYCRNSYPSPREKRELAEKTHLTVTQVSNWFKNRRQRDRAG 191          
BLAST of sine oculis-1/2 vs. Ensembl Celegans
Match: ceh-34 (Homeobox protein ceh-34 [Source:UniProtKB/Swiss-Prot;Acc:Q94165])

HSP 1 Score: 202.601 bits (514), Expect = 1.506e-61
Identity = 101/188 (53.72%), Postives = 127/188 (67.55%), Query Frame = 3
Query:  294 SGAMGFTQEQVACVCEVLEN----GGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            +    ++++++ C+CE L N     G  ++LA FI++LP C Q+   ESVL A+A V F  QN+K LY++LE   FSPHNH  LQ LWL AHY E  K K R LGAV KYRIR+K P P TIWDGEET+YCFK KSR VLR  Y    YPS  +K+ LA+ T L+  QVSNWFKN+RQR+RAA   D+
Sbjct:   12 TATTSYSEQEIVCICESLFNEGLQTGRTEQLANFIYNLPQCYQVM--ESVLKAQALVYFTTQNWKMLYKLLECSKFSPHNHTVLQNLWLDAHYKEAAKTKDRELGAVCKYRIRKKNPFPNTIWDGEETNYCFKSKSRNVLRDAYKKCQYPSVEDKRRLAQQTELSIIQVSNWFKNKRQRERAAGQLDR 197          
BLAST of sine oculis-1/2 vs. Ensembl Celegans
Match: ceh-32 (Homeobox protein ceh-32 [Source:UniProtKB/Swiss-Prot;Acc:Q23175])

HSP 1 Score: 205.682 bits (522), Expect = 1.696e-60
Identity = 100/182 (54.95%), Postives = 135/182 (74.18%), Query Frame = 3
Query:  309 FTQEQVACVCEVLENGGNIDRLALFIWSLPP--CQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKH 848
             T +Q+   CE LE  G++D L  F+ ++PP   Q++  NE+ L A+A V FH  +F+ELY ILE+  FSP  H KLQ +W +AHY E+EK +G+SL AV KYR+R+KYP+PRTIWDGE+ ++CFKE++R++LR+WYL +PYP+P +KK+LA  T LT  QV NWFKNRRQRDRAA  K+K 
Sbjct:   68 LTADQIVKTCEQLETDGDVDGLFRFMCTIPPQKTQEVAGNEAFLRARALVCFHASHFRELYAILENNKFSPKYHPKLQEMWHEAHYREQEKNRGKSLCAVDKYRVRKKYPMPRTIWDGEQKTHCFKERTRSLLREWYLKDPYPNPPKKKELANATGLTQMQVGNWFKNRRQRDRAAAAKNKQ 249          
BLAST of sine oculis-1/2 vs. Ensembl Celegans
Match: unc-39 (Homeobox protein unc-39 [Source:UniProtKB/Swiss-Prot;Acc:O17894])

HSP 1 Score: 134.806 bits (338), Expect = 3.098e-35
Identity = 84/255 (32.94%), Postives = 130/255 (50.98%), Query Frame = 3
Query:   96 NICDQFSNSGDYKSLDGPVVSSPSESDSNVNYASFHQFGMVSYEQSCLAAPALDYQTNQDSVISPDSGAMG-----FTQEQVACVCEVLENGGNIDRLALFIWSL-----PPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLH-NPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRA 827
            +I DQFS+SG      GP    P E  S++   S           S +  P+    +   S+ SP   A G     ++ EQ+  +   L    + DRL  F   L     P       +E+++ A     +H   F+ L+ +L +  F   ++  LQ +W  A Y E +  +G+ L  V KYR+RRK+P P+TIWDGEE  Y FK+ SR  L+Q++ + + YP+  +K++++  T L   Q+SNWFKNRRQRD++
Sbjct:   44 HISDQFSSSG------GP----PYELSSHILTPS-----------SVIPTPSPSVASA--SISSPTIPAFGCTMSEYSMEQMEAISTSLFQARDGDRLVAFFKQLESLYGPNAVDHLRSEAIIVAYTYALYHSNEFETLFHLLSNRHFQQRHYNDLQDIWHHARYKESQLKRGKELNPVEKYRLRRKFPAPKTIWDGEEIVYSFKDSSRKFLKQFFRNVSEYPTQEQKREISRATGLKIVQISNWFKNRRQRDKS 275          
BLAST of sine oculis-1/2 vs. Ensembl Celegans
Match: unc-62 (Homeobox protein unc-62 [Source:UniProtKB/Swiss-Prot;Acc:Q9N5D6])

HSP 1 Score: 51.6026 bits (122), Expect = 9.867e-7
Identity = 25/51 (49.02%), Postives = 32/51 (62.75%), Query Frame = 3
Query:  675 FKEKSRAVLRQWYLHN---PYPSPREKKDLAEMTSLTTTQVSNWFKNRRQR 818
            F +++   LRQW   N   PYPS  +KK LA+ T LT  QV+NWF N R+R
Sbjct:  358 FPKQATNRLRQWLFQNLTHPYPSEEQKKQLAKETGLTILQVNNWFINARRR 408          
BLAST of sine oculis-1/2 vs. Ensembl Fly
Match: so (gene:FBgn0003460 transcript:FBtr0088970)

HSP 1 Score: 316.235 bits (809), Expect = 3.164e-103
Identity = 140/181 (77.35%), Postives = 157/181 (86.74%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKD 842
            + GFTQEQVACVCEVL+  GNI+RL  F+WSLP C +LQ NESVL AKA VAFHR  +KELYR+LE + FS  NH KLQALWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR+VLR WY HNPYPSPREK+DLAE T LTTTQVSNWFKNRRQRDRAAE+KD
Sbjct:  100 SFGFTQEQVACVCEVLQQAGNIERLGRFLWSLPQCDKLQLNESVLKAKAVVAFHRGQYKELYRLLEHHHFSAQNHAKLQALWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYSHNPYPSPREKRDLAEATGLTTTQVSNWFKNRRQRDRAAEHKD 280          
BLAST of sine oculis-1/2 vs. Ensembl Fly
Match: Six4 (gene:FBgn0027364 transcript:FBtr0078274)

HSP 1 Score: 232.646 bits (592), Expect = 2.999e-71
Identity = 105/183 (57.38%), Postives = 135/183 (73.77%), Query Frame = 3
Query:  291 DSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENK 839
            D+  + F+ +Q+ C+CE L+  G+I++L  F+ SLPP +  +TNESVL A+A VA++   F ELY +LE++ FS   H  LQ LW +AHY E EK++GR LGAV KYR+R+KYPLP+TIWDGEET YCFKEKSR  L+  YL N YP+P EKK LA+ T LT TQVSNWFKNRRQRDR  + +
Sbjct:  175 DAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQR 357          
BLAST of sine oculis-1/2 vs. Ensembl Fly
Match: Six4 (gene:FBgn0027364 transcript:FBtr0078275)

HSP 1 Score: 232.646 bits (592), Expect = 2.999e-71
Identity = 105/183 (57.38%), Postives = 135/183 (73.77%), Query Frame = 3
Query:  291 DSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENK 839
            D+  + F+ +Q+ C+CE L+  G+I++L  F+ SLPP +  +TNESVL A+A VA++   F ELY +LE++ FS   H  LQ LW +AHY E EK++GR LGAV KYR+R+KYPLP+TIWDGEET YCFKEKSR  L+  YL N YP+P EKK LA+ T LT TQVSNWFKNRRQRDR  + +
Sbjct:  175 DAKMLQFSTDQIQCMCEALQQKGDIEKLTTFLCSLPPSEFFKTNESVLRARAMVAYNLGQFHELYNLLETHCFSIKYHVDLQNLWFKAHYKEAEKVRGRPLGAVDKYRLRKKYPLPKTIWDGEETVYCFKEKSRNALKDCYLTNRYPTPDEKKTLAKKTGLTLTQVSNWFKNRRQRDRTPQQR 357          
BLAST of sine oculis-1/2 vs. Ensembl Fly
Match: Optix (gene:FBgn0025360 transcript:FBtr0088865)

HSP 1 Score: 217.238 bits (552), Expect = 2.836e-64
Identity = 105/208 (50.48%), Postives = 151/208 (72.60%), Query Frame = 3
Query:  246 PALDYQTNQDSVISPDS----GAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPC----QQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            P+  +      +I+P        + F+  QV  VC+ LE+ G+I+RLA F+WSLP       ++   E+VL A+A VA+H  NF+ELY I+E++ F+  ++ KLQA+WL+AHYIE EK++GRSLG V KYR+R+K+PLP TIWDGE+ ++CFKE++R++LR+WYL +PYP+P +K++LA+ T L  TQV NWFKNRRQRDRAA  K++
Sbjct:   12 PSESFSPTHHQIIAPSPILAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNR 219          
BLAST of sine oculis-1/2 vs. Ensembl Fly
Match: Optix (gene:FBgn0025360 transcript:FBtr0329885)

HSP 1 Score: 217.238 bits (552), Expect = 3.185e-64
Identity = 105/208 (50.48%), Postives = 151/208 (72.60%), Query Frame = 3
Query:  246 PALDYQTNQDSVISPDS----GAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPC----QQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            P+  +      +I+P        + F+  QV  VC+ LE+ G+I+RLA F+WSLP       ++   E+VL A+A VA+H  NF+ELY I+E++ F+  ++ KLQA+WL+AHYIE EK++GRSLG V KYR+R+K+PLP TIWDGE+ ++CFKE++R++LR+WYL +PYP+P +K++LA+ T L  TQV NWFKNRRQRDRAA  K++
Sbjct:   12 PSESFSPTHHQIIAPSPILAVPTLAFSAAQVEIVCKTLEDSGDIERLARFLWSLPVALPNMHEILNCEAVLRARAVVAYHVGNFRELYAIIENHKFTKASYGKLQAMWLEAHYIEAEKLRGRSLGPVDKYRVRKKFPLPPTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAKATGLNPTQVGNWFKNRRQRDRAAAAKNR 219          
BLAST of sine oculis-1/2 vs. Ensembl Zebrafish
Match: six1b (SIX homeobox 1b [Source:NCBI gene;Acc:404627])

HSP 1 Score: 322.013 bits (824), Expect = 3.566e-107
Identity = 157/252 (62.30%), Postives = 182/252 (72.22%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHXXXXXXXXXXXXXXXIKETNHENAIKKIQSYPIGVGNPSLMFPG---FNESVSPFSTTAASIQGGYCSP 1046
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++ +                E N+  A K+ Q  P+  G  SLM      F+   SP   +   +QG    P
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENS---------------ENNNTGANKQNQLSPLD-GGKSLMSSSEDEFSPPQSPDQNSVLLLQGNMSHP 241          
BLAST of sine oculis-1/2 vs. Ensembl Zebrafish
Match: six2a (SIX homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-010412-1])

HSP 1 Score: 322.013 bits (824), Expect = 4.551e-107
Identity = 141/181 (77.90%), Postives = 160/181 (88.40%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
             GFTQEQVACVCEVL+ GGNI+RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPR+IWDGEETSYCFKEKSR+VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. Ensembl Zebrafish
Match: six2a (SIX homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-010412-1])

HSP 1 Score: 322.013 bits (824), Expect = 4.551e-107
Identity = 141/181 (77.90%), Postives = 160/181 (88.40%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
             GFTQEQVACVCEVL+ GGNI+RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPR+IWDGEETSYCFKEKSR+VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. Ensembl Zebrafish
Match: six1a (SIX homeobox 1a [Source:NCBI gene;Acc:494168])

HSP 1 Score: 317.005 bits (811), Expect = 2.772e-105
Identity = 139/182 (76.37%), Postives = 159/182 (87.36%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILESY FS HNH K+Q LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR+VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESYQFSTHNHPKMQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. Ensembl Zebrafish
Match: six2b (SIX homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-080723-23])

HSP 1 Score: 317.005 bits (811), Expect = 2.871e-105
Identity = 138/181 (76.24%), Postives = 159/181 (87.85%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
             GFTQEQVACVCEVL+ GG+I+RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY++LES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPR+IWDGEETSYCFKEKSR VL++WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    7 FGFTQEQVACVCEVLQQGGSIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKVLESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRCVLKEWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. Ensembl Xenopus
Match: six1 (SIX homeobox 1 [Source:NCBI gene;Acc:100101702])

HSP 1 Score: 320.087 bits (819), Expect = 3.103e-106
Identity = 140/182 (76.92%), Postives = 159/182 (87.36%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. Ensembl Xenopus
Match: six2 (SIX homeobox 2 [Source:NCBI gene;Acc:100101784])

HSP 1 Score: 318.931 bits (816), Expect = 7.491e-106
Identity = 140/179 (78.21%), Postives = 157/179 (87.71%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENK 839
             GFTQEQVACVCEVL+ GGNI+RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY+ILE + FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPR+IWDGEETSYCFKEKSR+VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILEGHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of sine oculis-1/2 vs. Ensembl Xenopus
Match: SIX4 (SIX homeobox 4 [Source:NCBI gene;Acc:100498150])

HSP 1 Score: 248.44 bits (633), Expect = 6.339e-73
Identity = 110/182 (60.44%), Postives = 137/182 (75.27%), Query Frame = 3
Query:  288 PDSGA---MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDR 824
            P  GA   + F+ E VACVCE L+ GG++DRL+ F+ SLP  + L+ NES+L A+A V FH+  + EL+ +LES+ F P NH  LQ LW +A YIE EK +GR LGAV KYR+RRK+PLPRTIWDGEET YCFKEKSR  L++ Y HN YPSP  K++LA++T L+ TQVSNWFKNRRQRDR
Sbjct:  140 PGGGAPYTLAFSPEHVACVCEALQQGGDLDRLSRFLCSLPHSELLRGNESILKARALVTFHQGRYSELFLLLESHNFHPSNHAALQELWYKARYIEAEKARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKHNRYPSPAAKRNLAKVTGLSLTQVSNWFKNRRQRDR 321          
BLAST of sine oculis-1/2 vs. Ensembl Xenopus
Match: six6 (SIX homeobox 6 [Source:NCBI gene;Acc:100101705])

HSP 1 Score: 230.335 bits (586), Expect = 6.629e-72
Identity = 103/173 (59.54%), Postives = 135/173 (78.03%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLP----PCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNR 809
            + F+ +QVA VCE LE  G+I+RL  F+WSLP     C+ L  NESVL A+A VAFH  NF+ELY ILE++ F+  +H KLQALWL+AHY E EK++GR LG V KYR+R+K+PLPRTIWDGE+ ++CFKE++R +LR+WYL +PYP+P +K++LA+ T LT TQV NWFKNR
Sbjct:    7 LNFSPQQVAGVCETLEESGDIERLGRFLWSLPVAPAACEALNKNESVLRARAIVAFHTGNFRELYHILENHKFTKDSHTKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRHLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNR 179          
BLAST of sine oculis-1/2 vs. Ensembl Xenopus
Match: tmem136 (transmembrane protein 136 [Source:Xenbase;Acc:XB-GENE-966251])

HSP 1 Score: 230.335 bits (586), Expect = 2.604e-71
Identity = 99/174 (56.90%), Postives = 137/174 (78.74%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLP----PCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNR 809
            ++ F+ EQVA VCE LE  G+I+RL  F+WSLP     C+ +  +ES+L A+A VAFH  NF++LY ILE++ F+  +H KLQA+WL+AHY E EK++GR LG V KYR+R+K+PLPRTIWDGE+ ++CFKE++R++LR+WYL +PYP+P +K++LA+ T LT TQV NWFKNR
Sbjct:   46 SLNFSPEQVASVCETLEETGDIERLGRFLWSLPVAPGACEAINKHESILRARAVVAFHTGNFRDLYHILENHKFTKESHGKLQAMWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNR 219          
BLAST of sine oculis-1/2 vs. Ensembl Mouse
Match: Six1 (sine oculis-related homeobox 1 [Source:MGI Symbol;Acc:MGI:102780])

HSP 1 Score: 320.472 bits (820), Expect = 1.557e-106
Identity = 140/182 (76.92%), Postives = 159/182 (87.36%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. Ensembl Mouse
Match: Six2 (sine oculis-related homeobox 2 [Source:MGI Symbol;Acc:MGI:102778])

HSP 1 Score: 320.087 bits (819), Expect = 3.413e-106
Identity = 141/179 (78.77%), Postives = 158/179 (88.27%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENK 839
             GFTQEQVACVCEVL+ GGNI+RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPR+IWDGEETSYCFKEKSR+VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of sine oculis-1/2 vs. Ensembl Mouse
Match: Six2 (sine oculis-related homeobox 2 [Source:MGI Symbol;Acc:MGI:102778])

HSP 1 Score: 320.087 bits (819), Expect = 3.413e-106
Identity = 141/179 (78.77%), Postives = 158/179 (88.27%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENK 839
             GFTQEQVACVCEVL+ GGNI+RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPR+IWDGEETSYCFKEKSR+VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHAKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of sine oculis-1/2 vs. Ensembl Mouse
Match: Six4 (sine oculis-related homeobox 4 [Source:MGI Symbol;Acc:MGI:106034])

HSP 1 Score: 244.202 bits (622), Expect = 5.925e-74
Identity = 109/174 (62.64%), Postives = 133/174 (76.44%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDR 824
            + F+ + VACVCE L+ GGN+DRLA F+WSLP    L+ NES+L A+A VAFH+  + ELY ILES++F   NH  LQ LW +A Y E E+ +GR LGAV KYR+RRK+PLPRTIWDGEET YCFKEKSR  L++ Y  N YPSP EK+ LA++T L+ TQVSNWFKNRRQRDR
Sbjct:   91 LAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDR 264          
BLAST of sine oculis-1/2 vs. Ensembl Mouse
Match: Six4 (sine oculis-related homeobox 4 [Source:MGI Symbol;Acc:MGI:106034])

HSP 1 Score: 246.899 bits (629), Expect = 9.243e-73
Identity = 109/174 (62.64%), Postives = 133/174 (76.44%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDR 824
            + F+ + VACVCE L+ GGN+DRLA F+WSLP    L+ NES+L A+A VAFH+  + ELY ILES++F   NH  LQ LW +A Y E E+ +GR LGAV KYR+RRK+PLPRTIWDGEET YCFKEKSR  L++ Y  N YPSP EK+ LA++T L+ TQVSNWFKNRRQRDR
Sbjct:   99 LAFSPDHVACVCEALQQGGNLDRLARFLWSLPQSDLLRGNESLLKARALVAFHQGIYPELYSILESHSFESANHPLLQQLWYKARYTEAERARGRPLGAVDKYRLRRKFPLPRTIWDGEETVYCFKEKSRNALKELYKQNRYPSPAEKRHLAKITGLSLTQVSNWFKNRRQRDR 272          
BLAST of sine oculis-1/2 vs. UniProt/SwissProt
Match: sp|Q6NZ04|SIX1B_DANRE (Homeobox protein six1b OS=Danio rerio OX=7955 GN=six1b PE=1 SV=1)

HSP 1 Score: 322.013 bits (824), Expect = 2.692e-106
Identity = 157/252 (62.30%), Postives = 182/252 (72.22%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHXXXXXXXXXXXXXXXIKETNHENAIKKIQSYPIGVGNPSLMFPG---FNESVSPFSTTAASIQGGYCSP 1046
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++ +                E N+  A K+ Q  P+  G  SLM      F+   SP   +   +QG    P
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENS---------------ENNNTGANKQNQLSPLD-GGKSLMSSSEDEFSPPQSPDQNSVLLLQGNMSHP 241          
BLAST of sine oculis-1/2 vs. UniProt/SwissProt
Match: sp|A2D5H2|SIX1_LAGLA (Homeobox protein SIX1 OS=Lagothrix lagotricha OX=9519 GN=SIX1 PE=3 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.077e-105
Identity = 140/182 (76.92%), Postives = 159/182 (87.36%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. UniProt/SwissProt
Match: sp|Q62231|SIX1_MOUSE (Homeobox protein SIX1 OS=Mus musculus OX=10090 GN=Six1 PE=1 SV=2)

HSP 1 Score: 320.472 bits (820), Expect = 1.089e-105
Identity = 140/182 (76.92%), Postives = 159/182 (87.36%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. UniProt/SwissProt
Match: sp|Q9I8H0|SIX1_XENLA (Homeobox protein six1 OS=Xenopus laevis OX=8355 GN=six1 PE=2 SV=1)

HSP 1 Score: 320.472 bits (820), Expect = 1.227e-105
Identity = 140/182 (76.92%), Postives = 159/182 (87.36%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. UniProt/SwissProt
Match: sp|Q15475|SIX1_HUMAN (Homeobox protein SIX1 OS=Homo sapiens OX=9606 GN=SIX1 PE=1 SV=1)

HSP 1 Score: 320.087 bits (819), Expect = 1.254e-105
Identity = 140/182 (76.92%), Postives = 159/182 (87.36%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYAHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. TrEMBL
Match: H9B8J4 (Sine oculis-1/2 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 944.88 bits (2441), Expect = 0.000e+0
Identity = 481/482 (99.79%), Postives = 482/482 (100.00%), Query Frame = 3
Query:   54 MRSISTSQATDIQQNICDQFSNSGDYKSLDGPVVSSPSESDSNVNYASFHQFGMVSYEQSCLAAPALDYQTNQDSVISPDSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHXXXXXXXXXXXXXXXIKETNHENAIKKIQSYPIGVGNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRESMANTDTSYMNPAKSELSSKALKLNQVSECEDIEPADQTTNLLNQQSYETSNSDYHSMSSTNSSYLNYEKIFNTNITENPLSRXXXXXXXXXXXYNPYFSQNTYGNFHNPDYDTPI 1499
            MRSISTSQATDIQQNICDQFSNSGDYKSLDGPVVSSPSESDSNVNYASFHQFGMVSYEQSCLAAPALDYQTNQDSVISPDSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSASEADSESLKDIKETNHENAIKKIQSYPIGVGNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRESMANTDTSYMNPAKSE+SSKALKLNQVSECEDIEPADQTTNLLNQQSYETSNSDYHSMSSTNSSYLNYEKIFNTNITENPLSRTNTNSSTNSSSYNPYFSQNTYGNFHNPDYDTPI
Sbjct:    1 MRSISTSQATDIQQNICDQFSNSGDYKSLDGPVVSSPSESDSNVNYASFHQFGMVSYEQSCLAAPALDYQTNQDSVISPDSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSASEADSESLKDIKETNHENAIKKIQSYPIGVGNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRESMANTDTSYMNPAKSEISSKALKLNQVSECEDIEPADQTTNLLNQQSYETSNSDYHSMSSTNSSYLNYEKIFNTNITENPLSRTNTNSSTNSSSYNPYFSQNTYGNFHNPDYDTPI 482          
BLAST of sine oculis-1/2 vs. TrEMBL
Match: Q86FY7 (Six1-2 protein OS=Dugesia japonica OX=6161 GN=six1-2 PE=4 SV=1)

HSP 1 Score: 760.37 bits (1962), Expect = 0.000e+0
Identity = 388/431 (90.02%), Postives = 408/431 (94.66%), Query Frame = 3
Query:  213 MVSYEQSCLAAPALDYQTNQDSVISPDSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHXXXXXXXXXXXXXXXIKETNHEN--AIKKIQSYPIGVGNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRESMANTDTSYMNPAKSELSSKALKLNQVSECEDIEPADQTTNLLNQQSYETSNSDYHSMSSTNSSYLNYEKIFNTNITENPLSRXXXXXXXXXXXYNPYFSQNTYGNFHNPDYDTPI 1499
            MV YEQ+CL APALDY + QDSVIS DSG MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSAS+ADSESLKDIKE NH++   +KK+Q+YPIGVGNPSLMFPGFNE+VSPFST+A +IQGGYC+PYIYNSNP ANYISYFSSGLHNLPISGQYPNILSRESM NTDTSYMN +KSE  +K +KLNQVSEC+DI+  DQT NLLN  +YETSNSDYHSMSSTNS+YLNYEKIFNT ITENPLSRTNTNSSTNSSSYNPYFSQN+YGNFHNPDYDTPI
Sbjct:    1 MVPYEQTCLTAPALDYTSTQDSVISSDSGTMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSASDADSESLKDIKEGNHDSNGTMKKLQNYPIGVGNPSLMFPGFNETVSPFSTSATNIQGGYCTPYIYNSNPTANYISYFSSGLHNLPISGQYPNILSRESMVNTDTSYMNSSKSEHPTKVIKLNQVSECDDIDTTDQTPNLLNPPTYETSNSDYHSMSSTNSTYLNYEKIFNTTITENPLSRTNTNSSTNSSSYNPYFSQNSYGNFHNPDYDTPI 431          
BLAST of sine oculis-1/2 vs. TrEMBL
Match: Q9NFY0 (Homeodomain transcription factor OS=Girardia tigrina OX=6162 GN=so PE=2 SV=1)

HSP 1 Score: 745.732 bits (1924), Expect = 0.000e+0
Identity = 381/431 (88.40%), Postives = 403/431 (93.50%), Query Frame = 3
Query:  213 MVSYEQSCLAAPALDYQTNQDSVISPDSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHXXXXXXXXXXXXXXXIKETNHENA--IKKIQSYPIGVGNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRESMANTDTSYMNPAKSELSSKALKLNQVSECEDIEPADQTTNLLNQQSYETSNSDYHSMSSTNSSYLNYEKIFNTNITENPLSRXXXXXXXXXXXYNPYFSQNTYGNFHNPDYDTPI 1499
            MV YEQ+CL AP LDY T QDSVIS DSG MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTS TTTQVSNWFKNRRQRDRAAENKDKHDDLSAS ADSESLKDIKE NHEN   +KK+QSYPIGVGNPSLMF GFNE++SPF+T A  IQGGYC+PYIYNSNPAANYISYFSSGLHNLPI+GQYPNILSRES+ NTDTSYMN  K++ +SK LKLNQVS+C+D++  DQT+NLLN  +Y+TSNSDYHSMSSTNS+YLNY+K+F TNI ENPLSRTNTNSSTNSSSYNPYFSQNTYGNFHNPDYDTPI
Sbjct:    1 MVPYEQTCLTAPTLDYITPQDSVISSDSGTMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSFTTTQVSNWFKNRRQRDRAAENKDKHDDLSASGADSESLKDIKEGNHENGGPLKKLQSYPIGVGNPSLMFSGFNETMSPFNTNATGIQGGYCTPYIYNSNPAANYISYFSSGLHNLPITGQYPNILSRESLVNTDTSYMNSGKNDHTSKLLKLNQVSDCDDLDSPDQTSNLLNPPAYDTSNSDYHSMSSTNSTYLNYDKLFTTNIPENPLSRTNTNSSTNSSSYNPYFSQNTYGNFHNPDYDTPI 431          
BLAST of sine oculis-1/2 vs. TrEMBL
Match: H6V053 (SO (Fragment) OS=Schmidtea polychroa OX=50054 GN=so PE=2 SV=1)

HSP 1 Score: 640.573 bits (1651), Expect = 0.000e+0
Identity = 322/333 (96.70%), Postives = 327/333 (98.20%), Query Frame = 3
Query:  276 SVISPDSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHXXXXXXXXXXXXXXXIKETNHEN--AIKKIQSYPIGVGNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRESMANTDTSYMNPAKSELSSKALKLNQVSECEDIEPADQT 1268
            SVISPDSG MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSASEADSESLKDIKETNH++  AIKKIQSYPIGVGNPSLMFPGF+ESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRE MANTDTSYMN +KSE S+KALKLNQVSECEDIEPADQT
Sbjct:    1 SVISPDSGTMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSASEADSESLKDIKETNHDSGVAIKKIQSYPIGVGNPSLMFPGFSESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSREPMANTDTSYMNSSKSEHSTKALKLNQVSECEDIEPADQT 333          
BLAST of sine oculis-1/2 vs. TrEMBL
Match: Q7Z1Y5 (Sine oculis protein (Fragment) OS=Dugesia japonica OX=6161 GN=sine oculis PE=2 SV=1)

HSP 1 Score: 410.609 bits (1054), Expect = 7.679e-139
Identity = 226/261 (86.59%), Postives = 244/261 (93.49%), Query Frame = 3
Query:  723 PYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHXXXXXXXXXXXXXXXIKETNHEN--AIKKIQSYPIGVGNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRESMANTDTSYMNPAKSELSSKALKLNQVSECEDIEPADQTTNLLNQQSYETSNSDYHSMSSTNSSYLNYEKIFNTNITENPLSRXXXXXXXXXXXYNPYFSQNTYGNFHNPDYDTPI 1499
            PYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSAS+ADSESLKDIKE NH++   +KK+Q+YPIGVGNPSLMFPGFNE+VSPFST+A +IQGGYC+PYIYNSNP ANYISYFSSGLHNLPISGQYPNILSRESM NTDTSYMN +KSE  +K +KLNQVSEC+DI+  DQT NLLN  +YETSNSDYHSMSSTNS+YLNYEKIFNT ITENPLSRTNTNSSTNSSSYNPYFSQN+YGNFHNPDYDTPI
Sbjct:    1 PYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSASDADSESLKDIKEGNHDSNGTMKKLQNYPIGVGNPSLMFPGFNETVSPFSTSATNIQGGYCTPYIYNSNPTANYISYFSSGLHNLPISGQYPNILSRESMVNTDTSYMNSSKSEHPTKVIKLNQVSECDDIDTTDQTPNLLNPPTYETSNSDYHSMSSTNSTYLNYEKIFNTTITENPLSRTNTNSSTNSSSYNPYFSQNSYGNFHNPDYDTPI 261          
BLAST of sine oculis-1/2 vs. Ensembl Cavefish
Match: six1b (homeobox protein six1b [Source:NCBI gene;Acc:103034839])

HSP 1 Score: 323.168 bits (827), Expect = 9.377e-108
Identity = 157/252 (62.30%), Postives = 183/252 (72.62%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHXXXXXXXXXXXXXXXIKETNHENAIKKIQSYPIGVGNPSLMFPG---FNESVSPFSTTAASIQGGYCSP 1046
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++ +                E N+  A K+ Q  P+  G  SLM      F+   SP  ++   +QG    P
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKERENS---------------ENNNSGANKQSQLSPLD-GGKSLMSSSDEEFSPPQSPDQSSVLLLQGNMSHP 241          
BLAST of sine oculis-1/2 vs. Ensembl Cavefish
Match: six2a (SIX homeobox 2 [Source:NCBI gene;Acc:103025828])

HSP 1 Score: 321.242 bits (822), Expect = 7.633e-107
Identity = 141/181 (77.90%), Postives = 160/181 (88.40%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
             GFTQEQVACVCEVL+ GGNI+RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPR+IWDGEETSYCFKEKSR+VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. Ensembl Cavefish
Match: ENSAMXT00000021946.2 (homeobox protein six1b [Source:NCBI gene;Acc:103045548])

HSP 1 Score: 310.842 bits (795), Expect = 5.119e-103
Identity = 136/184 (73.91%), Postives = 158/184 (85.87%), Query Frame = 3
Query:  294 SGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            S + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY+ILE + FS HNH KLQ LWL+AHY E E+++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR+VLR WY HNPYPSPREK++LA+ T L+TTQVSNWFKNRRQRDRAAE K++
Sbjct:    4 SSSFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACEHLHKNESVLKAKAMVAFHRGNFRELYKILEGHQFSTHNHGKLQQLWLRAHYAEAERLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRSVLRDWYTHNPYPSPREKRELAQATGLSTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. Ensembl Cavefish
Match: six2b (SIX homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-080723-23])

HSP 1 Score: 305.834 bits (782), Expect = 8.746e-101
Identity = 132/173 (76.30%), Postives = 152/173 (87.86%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQR 818
            + GFTQEQVACVCEVL+ GG+I+RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY++LES+ FSPHNH KLQ LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VL++WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQR
Sbjct:    6 SFGFTQEQVACVCEVLQQGGSIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKVLESHQFSPHNHPKLQQLWLKAHYMEAEKVRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRCVLKEWYSHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQR 178          
BLAST of sine oculis-1/2 vs. Ensembl Cavefish
Match: six9 (homeobox protein SIX2-like [Source:NCBI gene;Acc:111191018])

HSP 1 Score: 256.144 bits (653), Expect = 5.116e-82
Identity = 121/190 (63.68%), Postives = 141/190 (74.21%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQ----------LQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENK 839
            AM F+++QV CVCEVL   G +DRLA F+ SLP              LQ  ESVL A+AAVAFH+  F ELY ++E + FSP +H  LQ LWL+AHY+E E  +GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY   PYPSPREK+DLA  T LT TQVSNWFKNRRQRDRAA+ +
Sbjct:    2 AMVFSEDQVGCVCEVLLQSGCMDRLASFLRSLPSSSSSSSSSSSYPGLQGMESVLKARAAVAFHQGRFTELYALIEGHAFSPLSHALLQQLWLRAHYLEAELQRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRCVLREWYCRKPYPSPREKRDLAAATGLTATQVSNWFKNRRQRDRAAQGR 191          
BLAST of sine oculis-1/2 vs. Ensembl Sea Lamprey
Match: six1a (SIX homeobox 1a [Source:NCBI gene;Acc:494168])

HSP 1 Score: 241.121 bits (614), Expect = 2.287e-78
Identity = 107/150 (71.33%), Postives = 127/150 (84.67%), Query Frame = 3
Query:  363 IDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRR 812
            ++RL  F+WSLP C+Q+Q +ES+L AKA VAFH+ NF+ELY +LES  FS  NH KLQ LWL+AHY E E+++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKE+SR VLR WY HNPYPSPREK++LA+ T LTTTQVSNWFKNRR
Sbjct:    1 MERLGRFLWSLPACEQIQRSESILMAKAVVAFHQGNFRELYAVLESQPFSARNHPKLQQLWLKAHYTEAERLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKERSRGVLRDWYAHNPYPSPREKRELAQATGLTTTQVSNWFKNRR 150          
BLAST of sine oculis-1/2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002854.1 (pep scaffold:Pmarinus_7.0:GL480305:17375:18769:1 gene:ENSPMAG00000002608.1 transcript:ENSPMAT00000002854.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 220.705 bits (561), Expect = 1.708e-69
Identity = 97/173 (56.07%), Postives = 134/173 (77.46%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPC----QQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNR 809
            + F+ +QVA VCE LE  G+I+RL  F+WSLP      + L   E+VL A+A VAFH  N+++LY ILE + FS  +H KLQA+WL+AHY+E E+++GR LG V KYR+R+K+PLPRTIWDGE+ ++CFKE++R++LR+WYL +PYP+P +K++LA+ T LT TQV NWFKNR
Sbjct:   39 LSFSPQQVASVCETLEESGDIERLGRFLWSLPVAPGAWEALNRQEAVLRARAVVAFHASNYRDLYAILEGHKFSKASHAKLQAMWLEAHYLEAERLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELAQATGLTPTQVGNWFKNR 211          
BLAST of sine oculis-1/2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000011157.1 (pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 gene:ENSPMAG00000010130.1 transcript:ENSPMAT00000011157.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.523 bits (249), Expect = 1.935e-26
Identity = 40/63 (63.49%), Postives = 55/63 (87.30%), Query Frame = 3
Query:  624 KYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRR 812
            K+PLP+TIWDGE+ ++CFKE++R +LR+WYL +PYP+P +K++LA+ T LT TQV NWFKNRR
Sbjct:    1 KFPLPKTIWDGEQKTHCFKERTRNLLREWYLQDPYPNPSKKRELAQATGLTPTQVGNWFKNRR 63          
BLAST of sine oculis-1/2 vs. Ensembl Sea Lamprey
Match: Six4 (pep scaffold:Pmarinus_7.0:GL478660:19078:19268:1 gene:ENSPMAG00000010180.1 transcript:ENSPMAT00000011207.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:Six4)

HSP 1 Score: 96.2857 bits (238), Expect = 6.689e-25
Identity = 42/63 (66.67%), Postives = 49/63 (77.78%), Query Frame = 3
Query:  624 KYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRR 812
            K+PLPRTIWDGEET YCFKEKSR  L+  Y    YP+P EK+ LA++T L+  QVSNWFKNRR
Sbjct:    1 KFPLPRTIWDGEETVYCFKEKSRNFLKDCYRRTRYPAPDEKRRLAKLTGLSVVQVSNWFKNRR 63          
BLAST of sine oculis-1/2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001924.1 (pep scaffold:Pmarinus_7.0:GL488033:11:347:-1 gene:ENSPMAG00000001748.1 transcript:ENSPMAT00000001924.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 3.362e-19
Identity = 37/76 (48.68%), Postives = 51/76 (67.11%), Query Frame = 3
Query:  321 QVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWL 548
            QVACVCE L+ GG++ RLA F+W+LP       +E+VL A+A VAFH  +++ELY +LE + F   +H  L AL L
Sbjct:    1 QVACVCEALQQGGDVARLARFLWALPGPAAASRDEAVLRARAHVAFHSGSYRELYDVLEGHAFEARHHAALLALSL 76          
BLAST of sine oculis-1/2 vs. Ensembl Yeast
Match: TOS8 (Homeodomain-containing protein and putative transcription factor; found associated with chromatin; target of SBF transcription factor; induced during meiosis and under cell-damaging conditions; TOS8 has a paralog, CUP9, that arose from the whole genome duplication [Source:SGD;Acc:S000003064])

HSP 1 Score: 47.3654 bits (111), Expect = 2.214e-6
Identity = 20/46 (43.48%), Postives = 32/46 (69.57%), Query Frame = 3
Query:  693 AVLRQW---YLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRD 821
            ++L +W   +++NPYP+ +EK++L   T LT  Q+SNWF N R+R 
Sbjct:  207 SILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 252          
BLAST of sine oculis-1/2 vs. Ensembl Yeast
Match: CUP9 (Homeodomain-containing transcriptional repressor; regulates expression of PTR2, which encodes a major peptide transporter; imported peptides activate ubiquitin-dependent proteolysis, resulting in degradation of Cup9p and de-repression of PTR2 transcription; CUP9 has a paralog, TOS8, that arose from the whole genome duplication; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000006098])

HSP 1 Score: 45.8246 bits (107), Expect = 7.638e-6
Identity = 21/44 (47.73%), Postives = 30/44 (68.18%), Query Frame = 3
Query:  696 VLRQW---YLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQR 818
            +L  W   +L+NPYP+ +EK++L   T LT  Q+SNWF N R+R
Sbjct:  176 ILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRR 219          
BLAST of sine oculis-1/2 vs. Ensembl Nematostella
Match: EDO34334 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SPN4])

HSP 1 Score: 295.049 bits (754), Expect = 1.375e-98
Identity = 133/180 (73.89%), Postives = 156/180 (86.67%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENK 839
            +  FT EQVACVCEVL+  G+I+RL  F+WSLP C+ +Q NESVL AKA V+FH+QNF+ELYRILE+  FSP+ H KLQ+LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR +LR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K
Sbjct:    4 SFSFTPEQVACVCEVLQQSGDIERLGRFLWSLPECETIQKNESVLKAKAIVSFHQQNFQELYRILENNNFSPNAHPKLQSLWLKAHYMEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRNILREWYSHNPYPSPREKRELAEGTGLTTTQVSNWFKNRRQRDRAAEAK 183          
BLAST of sine oculis-1/2 vs. Ensembl Nematostella
Match: EDO42933 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S005])

HSP 1 Score: 251.906 bits (642), Expect = 7.418e-82
Identity = 115/182 (63.19%), Postives = 143/182 (78.57%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPP-CQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            M F+ EQ+  VCE L+N GNI+RLA F+WSLP   +++   E++L AKA VAFH+ NFKELY ILES  F    H KLQ LW  AHYIE E+++GR LGAV KYR+RRK+PLPRTIWDGEET+YCFKEKSR++L + Y+ +PYP+PREK +LA+MT LT TQVSNWFKN+RQR RAAE + +
Sbjct:    1 MPFSMEQIISVCECLQNSGNIERLARFLWSLPKDSEEIHACETILVAKAVVAFHQNNFKELYSILESRKFQRSEHEKLQCLWRTAHYIEAERVRGRPLGAVGKYRVRRKFPLPRTIWDGEETTYCFKEKSRSILNKAYVDSPYPTPREKHELAKMTDLTVTQVSNWFKNKRQRVRAAEIRKR 182          
BLAST of sine oculis-1/2 vs. Ensembl Nematostella
Match: EDO31034 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SZ27])

HSP 1 Score: 234.572 bits (597), Expect = 3.020e-75
Identity = 108/174 (62.07%), Postives = 134/174 (77.01%), Query Frame = 3
Query:  318 EQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENK 839
            +QVACVC+ L   G+I+RL+ F+WSLPP   L  +ESVL A+A V+FHR  ++E+Y ILE+  F P +H  LQ LW +AHY E EK++GRSLGAV KYRIRRK+PLPRTIWDGEET YCFKEK+RA L+  Y  N YP+P+EK+ +A+ T+LT  QVSNWFKNRRQRDR   NK
Sbjct:    1 DQVACVCDALRQAGDIERLSRFLWSLPPDDLLNGSESVLKARAIVSFHRGRYREVYNILETNEFDPSSHELLQCLWYKAHYSEAEKLRGRSLGAVDKYRIRRKFPLPRTIWDGEETVYCFKEKARAALKDCYEQNKYPTPQEKRLIAKQTNLTLKQVSNWFKNRRQRDRIPSNK 174          
BLAST of sine oculis-1/2 vs. Ensembl Nematostella
Match: EDO33059 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7ST96])

HSP 1 Score: 222.246 bits (565), Expect = 2.944e-70
Identity = 98/174 (56.32%), Postives = 136/174 (78.16%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLP----PCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNR 809
            A+ F+  Q+A VCE LE  G+++RLA F+WSLP      + L  +ESVL A+A VAFH  NF++LY ILE++ F+  +H KLQA+WL+AHY E E+++GR LG V KYR+R+K+PLPRTIWDGE+ ++CFKE++R++LR+WYL +PYP+P +K++LA+ T LT TQV NWFKNR
Sbjct:    7 ALSFSAHQIAQVCETLEESGDVERLARFLWSLPVAPGTLEALGKHESVLRARAIVAFHMGNFRDLYHILETHRFTRESHAKLQAMWLEAHYQEAERLRGRPLGPVDKYRVRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPTKKRELAQATGLTPTQVGNWFKNR 180          
BLAST of sine oculis-1/2 vs. Ensembl Nematostella
Match: EDO33407 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SS98])

HSP 1 Score: 176.407 bits (446), Expect = 5.465e-53
Identity = 86/165 (52.12%), Postives = 115/165 (69.70%), Query Frame = 3
Query:  318 EQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRR 812
            +QVAC+C+ L   G+I RL+ F+ S+P       +ES+L A+A VAFHR  ++E+Y ILE+  F   +H  LQ LW +AHY E EK++GRSL AV K+RIR+K PLP TI DGE+T Y FKEK R VL++ Y H  YP+ +EK+ +A  T+LT  QV NWF+NRR
Sbjct:    1 DQVACICDALFQEGDIKRLSQFLLSIPQEDLQNKSESLLKARAMVAFHRGCYQEVYNILENNKFDTSSHEFLQCLWYKAHYSEGEKLRGRSLSAVDKFRIRKKSPLPNTISDGEKTIYFFKEKVRTVLKECYEHKKYPTLKEKRVIATQTNLTLRQVRNWFRNRR 165          
BLAST of sine oculis-1/2 vs. Ensembl Medaka
Match: six1b (SIX homeobox 1 [Source:NCBI gene;Acc:101175523])

HSP 1 Score: 320.857 bits (821), Expect = 7.963e-107
Identity = 140/182 (76.92%), Postives = 159/182 (87.36%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            + GFTQEQVACVCEVL+ GGN++RL  F+WSLP C  L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHY+E EK++GR LGAV KYR+RRK+PLPRTIWDGEETSYCFKEKSR VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K++
Sbjct:    6 SFGFTQEQVACVCEVLQQGGNLERLGRFLWSLPACDHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYVEAEKLRGRPLGAVGKYRVRRKFPLPRTIWDGEETSYCFKEKSRGVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAKER 187          
BLAST of sine oculis-1/2 vs. Ensembl Medaka
Match: six2a (SIX homeobox 2 [Source:NCBI gene;Acc:101161260])

HSP 1 Score: 319.701 bits (818), Expect = 2.643e-106
Identity = 141/179 (78.77%), Postives = 158/179 (88.27%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENK 839
             GFTQEQVACVCEVL+ GGNI+RL  F+WSLP C+ L  NESVL AKA VAFHR NF+ELY+ILES+ FSPHNH KLQ LWL+AHYIE EK++GR LGAV KYR+RRK+PLPR+IWDGEETSYCFKEKSR+VLR+WY HNPYPSPREK++LAE T LTTTQVSNWFKNRRQRDRAAE K
Sbjct:    7 FGFTQEQVACVCEVLQQGGNIERLGRFLWSLPACEHLHKNESVLKAKAVVAFHRGNFRELYKILESHQFSPHNHPKLQQLWLKAHYIEAEKLRGRPLGAVGKYRVRRKFPLPRSIWDGEETSYCFKEKSRSVLREWYTHNPYPSPREKRELAEATGLTTTQVSNWFKNRRQRDRAAEAK 185          
BLAST of sine oculis-1/2 vs. Ensembl Medaka
Match: six4a (SIX homeobox 4 [Source:NCBI gene;Acc:101159478])

HSP 1 Score: 258.84 bits (660), Expect = 4.345e-78
Identity = 114/175 (65.14%), Postives = 138/175 (78.86%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDR 824
            ++ F+ EQVACVCE L+ GGN+DRLA F+WSLP    L+ NES+L A+A VAFH+  ++ELY ILE+++FSP NH  LQ LW +A Y E EK +GR LGAV KYRIRRKYPLPRTIWDGEET YCFKE+SR  L+  Y  N YPSP EK++LA++T L+ TQVSNWFKNRRQRDR
Sbjct:   62 SLAFSPEQVACVCEALQQGGNVDRLARFLWSLPQSDLLRGNESILKAQALVAFHQARYQELYSILENHSFSPSNHTFLQDLWYKARYTEAEKARGRPLGAVDKYRIRRKYPLPRTIWDGEETVYCFKERSRNALKDLYNQNRYPSPAEKRNLAKITGLSLTQVSNWFKNRRQRDR 236          
BLAST of sine oculis-1/2 vs. Ensembl Medaka
Match: six9 (homeobox protein six1a-like [Source:NCBI gene;Acc:101162149])

HSP 1 Score: 235.728 bits (600), Expect = 1.497e-74
Identity = 112/176 (63.64%), Postives = 132/176 (75.00%), Query Frame = 3
Query:  303 MGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQ-LQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRA 827
            M FT EQV CVCEVL   G IDRLA F+ ++PP    L+  E VL AKAAVAFH   F +LY +LES+ FS  +H+ LQ LWL+A Y E E+ +GR LGAV KYR+RRK+PLP TIWDGEET YCFKEKSR +L++WY   PYPS REK++LA  T LT TQVSNWFKNRRQR+RA
Sbjct:    5 MIFTPEQVICVCEVLLQAGCIDRLAGFLRTIPPSSSGLEELEGVLKAKAAVAFHHGRFSDLYALLESFPFSSSSHWFLQQLWLRARYTEAERQRGRPLGAVGKYRVRRKFPLPHTIWDGEETIYCFKEKSRRILKEWYRRGPYPSTREKRELAAATGLTATQVSNWFKNRRQRERA 180          
BLAST of sine oculis-1/2 vs. Ensembl Medaka
Match: six7 (homeobox protein SIX6-like [Source:NCBI gene;Acc:101175353])

HSP 1 Score: 235.728 bits (600), Expect = 5.232e-74
Identity = 107/185 (57.84%), Postives = 140/185 (75.68%), Query Frame = 3
Query:  309 FTQEQVACVCEVLENGGNIDRLALFIWSLPPC------QQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            FT +QVA VCE LE  G+I+RL  F+WSLP        + L  +ESV+ A+A VAFH  NF+ LY+IL+S+ F+  +H KLQ LWL AHY E E+++GR LG V KYRIR+K+PLPRTIWDGE+ ++CFKE++R++LR+WYL +PYP+P  K+ LA+ T LT TQV NWFKNRRQRDRAA  K++
Sbjct:    7 FTPDQVARVCENLEETGDIERLGRFLWSLPAAVPGSAGEALNRHESVMRARALVAFHVGNFEALYQILQSHRFTRESHAKLQDLWLDAHYREAERLRGRPLGPVEKYRIRKKFPLPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPSRKRHLAQATGLTPTQVGNWFKNRRQRDRAASAKNR 191          
BLAST of sine oculis-1/2 vs. Planmine SMEST
Match: SMESG000001687.1 (SMESG000001687.1)

HSP 1 Score: 944.88 bits (2441), Expect = 0.000e+0
Identity = 481/482 (99.79%), Postives = 482/482 (100.00%), Query Frame = 3
Query:   54 MRSISTSQATDIQQNICDQFSNSGDYKSLDGPVVSSPSESDSNVNYASFHQFGMVSYEQSCLAAPALDYQTNQDSVISPDSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHXXXXXXXXXXXXXXXIKETNHENAIKKIQSYPIGVGNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRESMANTDTSYMNPAKSELSSKALKLNQVSECEDIEPADQTTNLLNQQSYETSNSDYHSMSSTNSSYLNYEKIFNTNITENPLSRXXXXXXXXXXXYNPYFSQNTYGNFHNPDYDTPI 1499
            MRSISTSQATDIQQNICDQFSNSGDYKSLDGPVVSSPSESDSNVNYASFHQFGMVSYEQSCLAAPALDYQTNQDSVISPDSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSASEADSESLKDIKETNHENAIKKIQSYPIGVGNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRESMANTDTSYMNPAKSE+SSKALKLNQVSECEDIEPADQTTNLLNQQSYETSNSDYHSMSSTNSSYLNYEKIFNTNITENPLSRTNTNSSTNSSSYNPYFSQNTYGNFHNPDYDTPI
Sbjct:    1 MRSISTSQATDIQQNICDQFSNSGDYKSLDGPVVSSPSESDSNVNYASFHQFGMVSYEQSCLAAPALDYQTNQDSVISPDSGAMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDKHDDLSASEADSESLKDIKETNHENAIKKIQSYPIGVGNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGLHNLPISGQYPNILSRESMANTDTSYMNPAKSEISSKALKLNQVSECEDIEPADQTTNLLNQQSYETSNSDYHSMSSTNSSYLNYEKIFNTNITENPLSRTNTNSSTNSSSYNPYFSQNTYGNFHNPDYDTPI 482          
BLAST of sine oculis-1/2 vs. Planmine SMEST
Match: SMESG000005975.1 (SMESG000005975.1)

HSP 1 Score: 316.62 bits (810), Expect = 1.979e-102
Identity = 140/181 (77.35%), Postives = 160/181 (88.40%), Query Frame = 3
Query:  300 AMGFTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKD 842
            + GFTQEQVACVCEVL+ GG+IDRLA F+WSLP C+ LQ NESVL AKA VAFHR NFKELYRILES+ FS  NH+KLQ LWL+AHY+E EKI+GR LGAV KYR+R+K+PLPRTIWDG+ETSYCFKEKSR VLR+WY  NPYP+PREK++LAE T LTTTQVSNWFKNRRQRDRA+ENK+
Sbjct:  100 SCGFTQEQVACVCEVLQQGGSIDRLARFLWSLPNCEYLQKNESVLKAKAVVAFHRGNFKELYRILESHNFSVQNHHKLQDLWLKAHYVESEKIRGRPLGAVGKYRVRKKFPLPRTIWDGDETSYCFKEKSRNVLREWYSQNPYPTPREKRELAEATGLTTTQVSNWFKNRRQRDRASENKE 280          
BLAST of sine oculis-1/2 vs. Planmine SMEST
Match: SMESG000017729.1 (SMESG000017729.1)

HSP 1 Score: 239.58 bits (610), Expect = 7.486e-73
Identity = 104/183 (56.83%), Postives = 140/183 (76.50%), Query Frame = 3
Query:  309 FTQEQVACVCEVLENGGNIDRLALFIWSLPP----CQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            F  +Q+A VCE LE  G+I+RL  F+WS+P      + L  +E++L A+A VAFH  NF+ELY ILE + F   +H KLQALWL+AHY E EK++GR LG V KYR+R+K+P+PRTIWDGE+ ++CFKE++R++LR+WYL +PYP+P +K++LA  T LT TQV NWFKNRRQRDRAA +K +
Sbjct:   40 FAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 222          
BLAST of sine oculis-1/2 vs. Planmine SMEST
Match: SMESG000017729.1 (SMESG000017729.1)

HSP 1 Score: 239.58 bits (610), Expect = 7.540e-73
Identity = 104/183 (56.83%), Postives = 140/183 (76.50%), Query Frame = 3
Query:  309 FTQEQVACVCEVLENGGNIDRLALFIWSLPP----CQQLQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAAENKDK 845
            F  +Q+A VCE LE  G+I+RL  F+WS+P      + L  +E++L A+A VAFH  NF+ELY ILE + F   +H KLQALWL+AHY E EK++GR LG V KYR+R+K+P+PRTIWDGE+ ++CFKE++R++LR+WYL +PYP+P +K++LA  T LT TQV NWFKNRRQRDRAA +K +
Sbjct:   47 FAPDQIAKVCETLEESGDIERLGRFLWSMPTNSILWKSLNEHEALLRARAIVAFHTGNFRELYHILEKHHFEKSSHAKLQALWLEAHYQEAEKLRGRPLGPVDKYRVRKKFPMPRTIWDGEQKTHCFKERTRSLLREWYLQDPYPNPAKKRELASATGLTPTQVGNWFKNRRQRDRAAASKHR 229          
BLAST of sine oculis-1/2 vs. Planmine SMEST
Match: SMESG000020326.1 (SMESG000020326.1)

HSP 1 Score: 210.69 bits (535), Expect = 1.347e-64
Identity = 95/178 (53.37%), Postives = 129/178 (72.47%), Query Frame = 3
Query:  309 FTQEQVACVCEVLENGGNIDRLALFIWSLPPCQQ----LQTNESVLTAKAAVAFHRQNFKELYRILESYTFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWDGEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFKNRRQRDRAA 830
            F+  Q+  VCE LE  G+I RLA F+W L  CQ     L  +ES+L A++ VAFH  N+ ELY ILE++ FS  +H KLQ+ W  AHY E EK++GR+LG V KYR+R+++PLP TIWDG++ ++CF+E++R +L+  Y  +PYP+P +K++LA  T LT TQV NWFKNRRQRDRAA
Sbjct:   23 FSLSQICQVCENLEESGDIKRLARFLWCLSSCQSIWNSLLHHESILRARSIVAFHSGNYAELYFILENHRFSSQSHMKLQSFWFDAHYSEAEKLRGRALGPVDKYRVRKRHPLPSTIWDGQQRTHCFQERTRCLLKDCYSKDPYPNPNKKRELAIRTGLTATQVGNWFKNRRQRDRAA 200          
The following BLAST results are available for this feature:
BLAST of sine oculis-1/2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SIX12.611e-10676.92SIX homeobox 1 [Source:HGNC Symbol;Acc:HGNC:10887][more]
SIX26.546e-10678.77SIX homeobox 2 [Source:HGNC Symbol;Acc:HGNC:10888][more]
SIX42.040e-7462.64SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890][more]
SIX47.439e-7362.64SIX homeobox 4 [Source:HGNC Symbol;Acc:HGNC:10890][more]
SIX61.248e-7158.38SIX homeobox 6 [Source:HGNC Symbol;Acc:HGNC:10892][more]
back to top
BLAST of sine oculis-1/2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ceh-339.325e-7762.64Homeobox protein ceh-33 [Source:UniProtKB/Swiss-P... [more]
ceh-341.506e-6153.72Homeobox protein ceh-34 [Source:UniProtKB/Swiss-P... [more]
ceh-321.696e-6054.95Homeobox protein ceh-32 [Source:UniProtKB/Swiss-P... [more]
unc-393.098e-3532.94Homeobox protein unc-39 [Source:UniProtKB/Swiss-P... [more]
unc-629.867e-749.02Homeobox protein unc-62 [Source:UniProtKB/Swiss-P... [more]
back to top
BLAST of sine oculis-1/2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
so3.164e-10377.35gene:FBgn0003460 transcript:FBtr0088970[more]
Six42.999e-7157.38gene:FBgn0027364 transcript:FBtr0078274[more]
Six42.999e-7157.38gene:FBgn0027364 transcript:FBtr0078275[more]
Optix2.836e-6450.48gene:FBgn0025360 transcript:FBtr0088865[more]
Optix3.185e-6450.48gene:FBgn0025360 transcript:FBtr0329885[more]
back to top
BLAST of sine oculis-1/2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six1b3.566e-10762.30SIX homeobox 1b [Source:NCBI gene;Acc:404627][more]
six2a4.551e-10777.90SIX homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-010412-1... [more]
six2a4.551e-10777.90SIX homeobox 2a [Source:ZFIN;Acc:ZDB-GENE-010412-1... [more]
six1a2.772e-10576.37SIX homeobox 1a [Source:NCBI gene;Acc:494168][more]
six2b2.871e-10576.24SIX homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-080723-2... [more]
back to top
BLAST of sine oculis-1/2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six13.103e-10676.92SIX homeobox 1 [Source:NCBI gene;Acc:100101702][more]
six27.491e-10678.21SIX homeobox 2 [Source:NCBI gene;Acc:100101784][more]
SIX46.339e-7360.44SIX homeobox 4 [Source:NCBI gene;Acc:100498150][more]
six66.629e-7259.54SIX homeobox 6 [Source:NCBI gene;Acc:100101705][more]
tmem1362.604e-7156.90transmembrane protein 136 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of sine oculis-1/2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Six11.557e-10676.92sine oculis-related homeobox 1 [Source:MGI Symbol;... [more]
Six23.413e-10678.77sine oculis-related homeobox 2 [Source:MGI Symbol;... [more]
Six23.413e-10678.77sine oculis-related homeobox 2 [Source:MGI Symbol;... [more]
Six45.925e-7462.64sine oculis-related homeobox 4 [Source:MGI Symbol;... [more]
Six49.243e-7362.64sine oculis-related homeobox 4 [Source:MGI Symbol;... [more]
back to top
BLAST of sine oculis-1/2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q6NZ04|SIX1B_DANRE2.692e-10662.30Homeobox protein six1b OS=Danio rerio OX=7955 GN=s... [more]
sp|A2D5H2|SIX1_LAGLA1.077e-10576.92Homeobox protein SIX1 OS=Lagothrix lagotricha OX=9... [more]
sp|Q62231|SIX1_MOUSE1.089e-10576.92Homeobox protein SIX1 OS=Mus musculus OX=10090 GN=... [more]
sp|Q9I8H0|SIX1_XENLA1.227e-10576.92Homeobox protein six1 OS=Xenopus laevis OX=8355 GN... [more]
sp|Q15475|SIX1_HUMAN1.254e-10576.92Homeobox protein SIX1 OS=Homo sapiens OX=9606 GN=S... [more]
back to top
BLAST of sine oculis-1/2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9B8J40.000e+099.79Sine oculis-1/2 OS=Schmidtea mediterranea OX=79327... [more]
Q86FY70.000e+090.02Six1-2 protein OS=Dugesia japonica OX=6161 GN=six1... [more]
Q9NFY00.000e+088.40Homeodomain transcription factor OS=Girardia tigri... [more]
H6V0530.000e+096.70SO (Fragment) OS=Schmidtea polychroa OX=50054 GN=s... [more]
Q7Z1Y57.679e-13986.59Sine oculis protein (Fragment) OS=Dugesia japonica... [more]
back to top
BLAST of sine oculis-1/2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six1b9.377e-10862.30homeobox protein six1b [Source:NCBI gene;Acc:10303... [more]
six2a7.633e-10777.90SIX homeobox 2 [Source:NCBI gene;Acc:103025828][more]
ENSAMXT00000021946.25.119e-10373.91homeobox protein six1b [Source:NCBI gene;Acc:10304... [more]
six2b8.746e-10176.30SIX homeobox 2b [Source:ZFIN;Acc:ZDB-GENE-080723-2... [more]
six95.116e-8263.68homeobox protein SIX2-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of sine oculis-1/2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six1a2.287e-7871.33SIX homeobox 1a [Source:NCBI gene;Acc:494168][more]
ENSPMAT00000002854.11.708e-6956.07pep scaffold:Pmarinus_7.0:GL480305:17375:18769:1 g... [more]
ENSPMAT00000011157.11.935e-2663.49pep scaffold:Pmarinus_7.0:GL488016:7246:7434:-1 ge... [more]
Six46.689e-2566.67pep scaffold:Pmarinus_7.0:GL478660:19078:19268:1 g... [more]
ENSPMAT00000001924.13.362e-1948.68pep scaffold:Pmarinus_7.0:GL488033:11:347:-1 gene:... [more]
back to top
BLAST of sine oculis-1/2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
TOS82.214e-643.48Homeodomain-containing protein and putative transc... [more]
CUP97.638e-647.73Homeodomain-containing transcriptional repressor; ... [more]
back to top
BLAST of sine oculis-1/2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO343341.375e-9873.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO429337.418e-8263.19Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO310343.020e-7562.07Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO330592.944e-7056.32Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO334075.465e-5352.12Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of sine oculis-1/2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
six1b7.963e-10776.92SIX homeobox 1 [Source:NCBI gene;Acc:101175523][more]
six2a2.643e-10678.77SIX homeobox 2 [Source:NCBI gene;Acc:101161260][more]
six4a4.345e-7865.14SIX homeobox 4 [Source:NCBI gene;Acc:101159478][more]
six91.497e-7463.64homeobox protein six1a-like [Source:NCBI gene;Acc:... [more]
six75.232e-7457.84homeobox protein SIX6-like [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of sine oculis-1/2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000001687.10.000e+099.79SMESG000001687.1[more]
SMESG000005975.11.979e-10277.35SMESG000005975.1[more]
SMESG000017729.17.486e-7356.83SMESG000017729.1[more]
SMESG000017729.17.540e-7356.83SMESG000017729.1[more]
SMESG000020326.11.347e-6453.37SMESG000020326.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30023736
GenBankAFC87779.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023736 ID=SMED30023736|Name=sine oculis-1/2|organism=Schmidtea mediterranea sexual|type=transcript|length=1537bp
CAACAACAGAATATTAGGTTGCTTTACCGACATCTCAAATTACTTGTTTG
ACTATGAGATCGATATCCACGAGCCAAGCAACAGACATTCAACAAAATAT
ATGCGATCAATTTTCTAATTCAGGTGATTACAAATCACTCGATGGCCCAG
TCGTTTCGTCTCCATCCGAATCGGATTCGAATGTTAATTACGCATCATTC
CATCAATTCGGCATGGTATCCTATGAACAGTCATGCTTGGCAGCTCCGGC
TCTAGATTATCAGACTAATCAAGACTCGGTTATTTCTCCCGATTCTGGTG
CAATGGGTTTCACTCAAGAACAAGTCGCATGCGTTTGCGAAGTCCTTGAA
AACGGTGGCAACATCGACAGATTAGCATTGTTCATTTGGTCTCTGCCACC
TTGCCAGCAGCTGCAAACGAATGAAAGCGTCCTAACAGCAAAAGCCGCAG
TTGCTTTTCATCGGCAAAATTTCAAAGAACTCTATAGAATATTAGAATCG
TACACTTTTTCACCGCACAACCATTACAAACTACAGGCACTCTGGTTGCA
AGCACATTACATTGAAGAAGAAAAAATCAAAGGTCGCTCACTGGGAGCTG
TGGCAAAGTACAGAATTCGACGAAAATATCCATTGCCGAGAACGATTTGG
GACGGTGAAGAAACCAGTTATTGTTTCAAAGAAAAATCAAGAGCCGTTCT
TCGACAATGGTATTTGCATAATCCTTACCCGTCACCGAGAGAAAAGAAAG
ATCTCGCTGAAATGACGAGTTTGACAACAACTCAGGTGTCTAATTGGTTT
AAAAACCGACGCCAACGAGATCGAGCAGCAGAAAACAAAGACAAACATGA
TGACCTATCTGCTTCCGAAGCTGACAGCGAGTCATTGAAGGATATCAAAG
AAACAAATCACGAAAATGCAATAAAGAAAATCCAATCCTATCCAATTGGA
GTTGGGAATCCAAGTTTGATGTTTCCTGGATTTAATGAATCAGTAAGCCC
ATTTAGCACGACTGCTGCCAGCATTCAAGGCGGATATTGTTCTCCTTATA
TATATAACTCCAACCCTGCAGCAAACTACATCTCGTACTTTAGTTCTGGA
TTGCATAACCTCCCGATATCTGGACAATATCCCAATATTCTATCCAGAGA
ATCCATGGCTAATACCGATACCAGCTACATGAATCCCGCAAAATCTGAAC
TTTCTTCAAAAGCATTGAAGCTCAACCAGGTGTCTGAGTGTGAGGATATC
GAACCAGCAGACCAAACAACGAATTTGCTCAACCAACAATCCTATGAAAC
CTCAAATAGTGACTACCATTCAATGTCAAGCACAAATTCATCTTATCTCA
ATTATGAAAAAATATTCAACACAAATATCACAGAAAATCCTCTATCAAGA
ACCAACACAAATAGTTCCACCAACAGCAGCTCCTACAATCCGTATTTCTC
TCAGAATACGTATGGGAATTTTCACAATCCAGACTATGATACGCCTATTT
ACAGTTACAACTAATTTTTTTTCTAATATTTTTATTG
back to top

protein sequence of SMED30023736-orf-1

>SMED30023736-orf-1 ID=SMED30023736-orf-1|Name=SMED30023736-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=487bp
MRSISTSQATDIQQNICDQFSNSGDYKSLDGPVVSSPSESDSNVNYASFH
QFGMVSYEQSCLAAPALDYQTNQDSVISPDSGAMGFTQEQVACVCEVLEN
GGNIDRLALFIWSLPPCQQLQTNESVLTAKAAVAFHRQNFKELYRILESY
TFSPHNHYKLQALWLQAHYIEEEKIKGRSLGAVAKYRIRRKYPLPRTIWD
GEETSYCFKEKSRAVLRQWYLHNPYPSPREKKDLAEMTSLTTTQVSNWFK
NRRQRDRAAENKDKHDDLSASEADSESLKDIKETNHENAIKKIQSYPIGV
GNPSLMFPGFNESVSPFSTTAASIQGGYCSPYIYNSNPAANYISYFSSGL
HNLPISGQYPNILSRESMANTDTSYMNPAKSELSSKALKLNQVSECEDIE
PADQTTNLLNQQSYETSNSDYHSMSSTNSSYLNYEKIFNTNITENPLSRT
NTNSSTNSSSYNPYFSQNTYGNFHNPDYDTPIYSYN*
back to top
Aliases
The feature 'sine oculis-1/2' has the following synonyms
Synonym
six-1/2
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000075optic cup
Vocabulary: INTERPRO
TermDefinition
IPR001356Homeobox_dom
IPR031701SIX1_SD
IPR009057Homeobox-like_sf
IPR017970Homeobox_CS
Vocabulary: molecular function
TermDefinition
GO:0003677DNA binding
GO:0043565sequence-specific DNA binding
Vocabulary: biological process
TermDefinition
GO:0006355regulation of transcription, DNA-templated
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001356Homeobox domainSMARTSM00389HOX_1coord: 202..263
e-value: 4.5E-16
score: 69.4
IPR001356Homeobox domainPFAMPF00046Homeodomaincoord: 207..257
e-value: 5.6E-13
score: 48.5
IPR001356Homeobox domainPROSITEPS50071HOMEOBOX_2coord: 199..259
score: 14.771
IPR001356Homeobox domainCDDcd00086homeodomaincoord: 206..257
e-value: 8.39179E-17
score: 72.276
NoneNo IPR availableGENE3DG3DSA:1.10.10.60coord: 201..271
e-value: 5.1E-19
score: 69.5
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 251..280
NoneNo IPR availablePANTHERPTHR10390:SF61SIX HOMEOBOX 2coord: 83..369
NoneNo IPR availablePANTHERPTHR10390HOMEOBOX PROTEIN SIXcoord: 83..369
IPR031701Homeobox protein SIX1, N-terminal SD domainPFAMPF16878SIX1_SDcoord: 86..196
e-value: 1.6E-44
score: 150.9
IPR017970Homeobox, conserved sitePROSITEPS00027HOMEOBOX_1coord: 234..257
IPR009057Homeobox-like domain superfamilySUPERFAMILYSSF46689Homeodomain-likecoord: 199..261