Sodium/potassium-transporting ATPase subunit beta-2

Overview
NameSodium/potassium-transporting ATPase subunit beta-2
Smed IDSMED30023733
Length (bp)971
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023733

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30023733SMESG000071416.1 SmedASXL_008396SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30023733SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023733SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023733SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30023733SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
muscle cellSMED30023733SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parapharyngeal regionSMED30023733SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023733SMESG000071416.1 dd_Smed_v4_7917_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023733SMESG000071416.1 Contig4209newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023733SMESG000071416.1 Contig4209uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30023733SMESG000071416.1 dd_Smed_v6_7917_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
photoreceptor neuronSMED30023733SMESG000071416.1 SMED30026182smed_20140614PMID:22884275
Lapan et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
head regionSMED30023733SMESG000071416.1 OX_Smed_1.0.01702ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 138.658 bits (348), Expect = 4.067e-38
Identity = 94/272 (34.56%), Postives = 138/272 (50.74%), Query Frame = 1
Query:  106 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDN---------VDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSS----PTIK---------CFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            +NS  K FLGRT  SW KI +FY I+Y  L   F+  + V L  L  ++  + T Q  +    PGL    +P    T I F  N+P+SY++Y +++  FL  Y+D   +DD  F  C      P             K+CRF L  L +C+  N+  +GY +G PC++IK+N++ G+ P    N S    P +K         C G+   DKD +G ++YF   GNS     F   +YPY G   QP YL P++AVQF  L  +T + ++C+
Sbjct:   17 WNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVML--LTISEF-KPTYQDRVAP--PGLTQ--IPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYF-GLGNSPG---FPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECK 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Match: ATP1B1 (ATPase Na+/K+ transporting subunit beta 1 [Source:HGNC Symbol;Acc:HGNC:804])

HSP 1 Score: 138.658 bits (348), Expect = 4.067e-38
Identity = 94/272 (34.56%), Postives = 138/272 (50.74%), Query Frame = 1
Query:  106 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDN---------VDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSS----PTIK---------CFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            +NS  K FLGRT  SW KI +FY I+Y  L   F+  + V L  L  ++  + T Q  +    PGL    +P    T I F  N+P+SY++Y +++  FL  Y+D   +DD  F  C      P             K+CRF L  L +C+  N+  +GY +G PC++IK+N++ G+ P    N S    P +K         C G+   DKD +G ++YF   GNS     F   +YPY G   QP YL P++AVQF  L  +T + ++C+
Sbjct:   17 WNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVML--LTISEF-KPTYQDRVAP--PGLTQ--IPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYF-GLGNSPG---FPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECK 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Match: ATP1B3 (ATPase Na+/K+ transporting subunit beta 3 [Source:HGNC Symbol;Acc:HGNC:806])

HSP 1 Score: 131.339 bits (329), Expect = 1.373e-35
Identity = 100/287 (34.84%), Postives = 144/287 (50.17%), Query Frame = 1
Query:   70 KPSRCQSFIEG---FYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN----MTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQP---GYLSPIVAVQFMTLKKNT--LVMVKCQF---MNMKFESDLLKF 879
            K S  QS  E     YN  +  FLGRT  SW  I +FY ++Y  L A F   M V L+ L  +++P+   Q       PGL + P P  T     F+ ++P SY  Y  D++ FL PY    L++ KN  +C        K P  V   C+F +++L+ C+  N+  FGYS+GNPC+L+KMN+I G  P+      P I C  +N    ++I  +  +P+N      G  D  ++PY G+    GYL P+VAVQ      NT   V V+C+     N+K + D  KF
Sbjct:    6 KKSLNQSLAEWKLFIYNPTTGEFLGRTAKSWGLILLFYLVFYGFLAALFSFTMWVMLQTL-NDEVPKYRDQIP----SPGLMVFPKP-VTALEYTFSRSDPTSYAGYIEDLKKFLKPYT---LEEQKNLTVCPDGALFEQKGPVYV--ACQFPISLLQACSGMNDPDFGYSQGNPCILVKMNRIIGLKPEGV----PRIDCVSKN----EDIPNVAVYPHN------GMIDLKYFPYYGKKLHVGYLQPLVAVQVSFAPNNTGKEVTVECKIDGSANLKSQDDRDKF 267          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Match: ATP1B2 (ATPase Na+/K+ transporting subunit beta 2 [Source:HGNC Symbol;Acc:HGNC:805])

HSP 1 Score: 124.02 bits (310), Expect = 1.153e-32
Identity = 83/282 (29.43%), Postives = 134/282 (47.52%), Query Frame = 1
Query:   55 EKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDN-----VDKICRFNLTMLEDCN---KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQP---GYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD 867
            EK  C     + + E  +N R+  F+GRT +SW  I +FY ++Y  LTA F   M V L+  V +  P+   + +     PGL +RP  ++   ++   +++ +S+  +   +  FL PY D       +        + PDN       + C+FN T L +C+      ++GYS G PCV IKMN++  +      N S  + C G+   D +N+G    FP NGN       D  ++PY G+     Y  P+VAV+F+ +  N  V V+C+       +D
Sbjct:    6 EKKSCG-QVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFTLTMWVMLQ-TVSDHTPKYQDRLAT----PGLMIRPKTENLDVIVN--VSDTESWDQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGNCSGIGDSTHYGYSTGQPCVFIKMNRVINFYAGA--NQSMNVTCAGKRDEDAENLGNFVMFPANGN------IDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATD 271          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Match: ATP1B4 (ATPase Na+/K+ transporting family member beta 4 [Source:HGNC Symbol;Acc:HGNC:808])

HSP 1 Score: 108.997 bits (271), Expect = 1.295e-26
Identity = 83/276 (30.07%), Postives = 134/276 (48.55%), Query Frame = 1
Query:   76 SRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFF-MSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN----MTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLL 873
             + Q   E  ++   + FL RT  SW  I + YF +Y SL A   + M  +FL   +   IP  T +       PG+ +RP   H+     F ++EP +++ Y + +  FL  Y D  L+++ N         +     D   K C+F  + L++C+  +   FGYS G PC+L+KMN+I G+ P+  D     + C  Q   D+++I  I Y+P + +      FD  +YPY G+     Y SP+VA+ F  + KN  V V+CQ       +D++
Sbjct:   84 QKLQIMSEYLWDPERRMFLARTGQSWSLILLIYFFFYASLAAVITLCMYTLFLT--ISPYIPTFTERVK----PPGVMIRPFA-HSLNF-NFNVSEPDTWQHYVISLNGFLQGYND-SLQEEMNVDCPPGQYFIQDGNEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPELGDPVK--VSCKVQRG-DENDIRSISYYPESAS------FDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGVINDVI 341          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 172.94 bits (437), Expect = 1.936e-51
Identity = 97/295 (32.88%), Postives = 168/295 (56.95%), Query Frame = 1
Query:   85 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKI-CRFNLTMLED-CNKKNNFGYSKGNPCVLIKMNKIFGWIP-DTTDNSSP------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 894
            ++F E  YN ++ T +GRT  SW +I +FY I+Y  L AF+++ + +F++ L    +PR  G+ +++ + PG+G +P     PD  +TLI++ + + +SYK+Y   M+T+LT Y D    + +     +    +  N D + CRF+L++ +  C++K++FGY  G PCV+I +N++ GW P D  +NS P             I C G   +D+++IG++ Y P+NG        D  +YPY+   GY  PI  V+F T+ +N LV+V+C+   +  E D      ++ FE++V+
Sbjct:   27 ETFREFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMKTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKERPD--STLIKYNLRDQKSYKAYLEQMKTYLTKY-DSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNG-------IDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 172.94 bits (437), Expect = 1.936e-51
Identity = 97/295 (32.88%), Postives = 168/295 (56.95%), Query Frame = 1
Query:   85 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKI-CRFNLTMLED-CNKKNNFGYSKGNPCVLIKMNKIFGWIP-DTTDNSSP------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 894
            ++F E  YN ++ T +GRT  SW +I +FY I+Y  L AF+++ + +F++ L    +PR  G+ +++ + PG+G +P     PD  +TLI++ + + +SYK+Y   M+T+LT Y D    + +     +    +  N D + CRF+L++ +  C++K++FGY  G PCV+I +N++ GW P D  +NS P             I C G   +D+++IG++ Y P+NG        D  +YPY+   GY  PI  V+F T+ +N LV+V+C+   +  E D      ++ FE++V+
Sbjct:   27 ETFREFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMKTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKERPD--STLIKYNLRDQKSYKAYLEQMKTYLTKY-DSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNG-------IDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Match: nkb-1 (Sodium/potassium-transporting ATPase subunit beta-1 [Source:UniProtKB/Swiss-Prot;Acc:Q93235])

HSP 1 Score: 172.94 bits (437), Expect = 1.936e-51
Identity = 97/295 (32.88%), Postives = 168/295 (56.95%), Query Frame = 1
Query:   85 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKI-CRFNLTMLED-CNKKNNFGYSKGNPCVLIKMNKIFGWIP-DTTDNSSP------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 894
            ++F E  YN ++ T +GRT  SW +I +FY I+Y  L AF+++ + +F++ L    +PR  G+ +++ + PG+G +P     PD  +TLI++ + + +SYK+Y   M+T+LT Y D    + +     +    +  N D + CRF+L++ +  C++K++FGY  G PCV+I +N++ GW P D  +NS P             I C G   +D+++IG++ Y P+NG        D  +YPY+   GY  PI  V+F T+ +N LV+V+C+   +  E D      ++ FE++V+
Sbjct:   27 ETFREFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMKTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKERPD--STLIKYNLRDQKSYKAYLEQMKTYLTKY-DSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNG-------IDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 160.614 bits (405), Expect = 7.623e-47
Identity = 95/300 (31.67%), Postives = 155/300 (51.67%), Query Frame = 1
Query:   85 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYL-----KDDKNFAICNMTSKVPDNVDKICRFNLTMLE--DCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP-------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 894
            ++F +  YN    T LGRT +SWC+I +FY I+Y  L+AFF+  + +FL  L    +PR  G+ +++ + PG+G +P     PD  +TLI+F + + +S++ Y   +  +L+ Y++          D N A+   T   P      CRF+L + E  +C  K+ +GY  G PCV + +N++ GW P   D+ S              TI C G    DK+++G+++Y P  G        D  +YPY+  P Y  PI  V+F T+ +N LV+V+C+      E D      ++ FE+ V+
Sbjct:   10 ETFAQFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLRTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKENPD--STLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFP------CRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG-------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMVYFELFVE 293          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Match: nkb-3 (Probable sodium/potassium-transporting ATPase subunit beta-3 [Source:UniProtKB/Swiss-Prot;Acc:Q9XUY5])

HSP 1 Score: 160.999 bits (406), Expect = 7.906e-47
Identity = 95/300 (31.67%), Postives = 155/300 (51.67%), Query Frame = 1
Query:   85 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYL-----KDDKNFAICNMTSKVPDNVDKICRFNLTMLE--DCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP-------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 894
            ++F +  YN    T LGRT +SWC+I +FY I+Y  L+AFF+  + +FL  L    +PR  G+ +++ + PG+G +P     PD  +TLI+F + + +S++ Y   +  +L+ Y++          D N A+   T   P      CRF+L + E  +C  K+ +GY  G PCV + +N++ GW P   D+ S              TI C G    DK+++G+++Y P  G        D  +YPY+  P Y  PI  V+F T+ +N LV+V+C+      E D      ++ FE+ V+
Sbjct:   24 ETFAQFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLRTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKENPD--STLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFP------CRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG-------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMVYFELFVE 307          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079382)

HSP 1 Score: 154.836 bits (390), Expect = 2.622e-44
Identity = 100/321 (31.15%), Postives = 149/321 (46.42%), Query Frame = 1
Query:   43 DEDIEKY-ECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLP---DHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPD---------------------TTDNSSPT------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDL------LKFEILVD 894
            DED+    + KP +   F+   YN+   T +GR +SSW KIGIFY  +Y  L A     M  F + L    IP+ T   SL+   PGLG RPLP   +  +TLI +   + ++YK +   +  FL  Y+   L   +   I N     P    ++C  ++     C K+NN+ Y K  PC+ +K+NKI+GWIP+                       + + P       + C G+N  D++NIG + Y P  G       F   FYPY    GYLSP+VAV F   K+  ++ V+C+        D       + +E+L+D
Sbjct:   13 DEDLHNLRKPKPFKLGQFL---YNTEDGTVMGRDRSSWAKIGIFYVAFYGVLAALVAICMWAFFQTL-DPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYLPIRG-------FPGYFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 322          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0079383)

HSP 1 Score: 154.836 bits (390), Expect = 2.622e-44
Identity = 100/321 (31.15%), Postives = 149/321 (46.42%), Query Frame = 1
Query:   43 DEDIEKY-ECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLP---DHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPD---------------------TTDNSSPT------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDL------LKFEILVD 894
            DED+    + KP +   F+   YN+   T +GR +SSW KIGIFY  +Y  L A     M  F + L    IP+ T   SL+   PGLG RPLP   +  +TLI +   + ++YK +   +  FL  Y+   L   +   I N     P    ++C  ++     C K+NN+ Y K  PC+ +K+NKI+GWIP+                       + + P       + C G+N  D++NIG + Y P  G       F   FYPY    GYLSP+VAV F   K+  ++ V+C+        D       + +E+L+D
Sbjct:   13 DEDLHNLRKPKPFKLGQFL---YNTEDGTVMGRDRSSWAKIGIFYVAFYGVLAALVAICMWAFFQTL-DPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYLPIRG-------FPGYFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 322          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Match: nrv2 (gene:FBgn0015777 transcript:FBtr0100381)

HSP 1 Score: 154.836 bits (390), Expect = 2.622e-44
Identity = 100/321 (31.15%), Postives = 149/321 (46.42%), Query Frame = 1
Query:   43 DEDIEKY-ECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLP---DHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPD---------------------TTDNSSPT------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDL------LKFEILVD 894
            DED+    + KP +   F+   YN+   T +GR +SSW KIGIFY  +Y  L A     M  F + L    IP+ T   SL+   PGLG RPLP   +  +TLI +   + ++YK +   +  FL  Y+   L   +   I N     P    ++C  ++     C K+NN+ Y K  PC+ +K+NKI+GWIP+                       + + P       + C G+N  D++NIG + Y P  G       F   FYPY    GYLSP+VAV F   K+  ++ V+C+        D       + +E+L+D
Sbjct:   13 DEDLHNLRKPKPFKLGQFL---YNTEDGTVMGRDRSSWAKIGIFYVAFYGVLAALVAICMWAFFQTL-DPRIPKWTLDRSLIGTNPGLGFRPLPPVDNVESTLIWYKGTQHENYKHWTDSLDDFLAVYKVPGLTPGRGQNIYNCDYNQPPPKGQVCDVDIKTWSPCTKENNYSYHKSAPCIFLKLNKIYGWIPEYYNRSNDLPANMPASLKTYIAEVEKTQPEKLNTIWVSCEGENPADQENIGAVNYLPIRG-------FPGYFYPYQNSEGYLSPLVAVHFQRPKRGIIINVECRAWARNIIHDRKERIGSVHYELLID 322          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Match: nrv1 (gene:FBgn0015776 transcript:FBtr0332370)

HSP 1 Score: 150.984 bits (380), Expect = 4.256e-43
Identity = 99/306 (32.35%), Postives = 151/306 (49.35%), Query Frame = 1
Query:   70 KPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTT--TLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD--------------NSSPT-------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFM--NMKFESDL------LKFEILVD 894
            +P++ Q+F E  YN +  TF GRT  SW ++ +FY I+Y  L A F   M   L   + +  P+   Q SL+   PGLG RPL + T   ++I F   +P     +   +  FL  Y     +D K+        +V +  D +C  N  +   C+K NN+GY    PC+ +K+NKIFGWIP+  D              N + T       + C G    DK+N   I+YFP+ G       F   +YP++ QPGYLSP+VAVQF +  K  ++ V+C+    N+++   +      + F+IL+D
Sbjct:   17 QPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLS-TISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGF----GQVLEPTD-VCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG-------FPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGSVTFQILLD 309          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Match: nrv1 (gene:FBgn0015776 transcript:FBtr0079384)

HSP 1 Score: 150.984 bits (380), Expect = 4.256e-43
Identity = 99/306 (32.35%), Postives = 151/306 (49.35%), Query Frame = 1
Query:   70 KPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTT--TLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD--------------NSSPT-------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFM--NMKFESDL------LKFEILVD 894
            +P++ Q+F E  YN +  TF GRT  SW ++ +FY I+Y  L A F   M   L   + +  P+   Q SL+   PGLG RPL + T   ++I F   +P     +   +  FL  Y     +D K+        +V +  D +C  N  +   C+K NN+GY    PC+ +K+NKIFGWIP+  D              N + T       + C G    DK+N   I+YFP+ G       F   +YP++ QPGYLSP+VAVQF +  K  ++ V+C+    N+++   +      + F+IL+D
Sbjct:   17 QPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLS-TISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGF----GQVLEPTD-VCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG-------FPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGSVTFQILLD 309          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Match: atp1b2a (ATPase Na+/K+ transporting subunit beta 2a [Source:ZFIN;Acc:ZDB-GENE-001127-2])

HSP 1 Score: 133.65 bits (335), Expect = 1.517e-36
Identity = 96/270 (35.56%), Postives = 136/270 (50.37%), Query Frame = 1
Query:   64 ECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPY---EDIYLKDD---KNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            E +     S+ + F+N R+   LGRT SSW  I +FY ++Y  L   F   M V L  L   D  + T Q  L    PG+ +RP  +     I ++    +S++ Y   + +FL PY   +     DD     F I   +  V +N  + CRFN T LEDC+   +  +GY  G PC+LIK+N++ G  P   D  SP + C G    D ++IGEI YFP NG       F+  +YPY G   Q  Y  P+VAV+FM +  NT V V+C+
Sbjct:    4 EDEKKESGSWKDFFWNPRTHELLGRTASSWGLILLFYLVFYTFLAGVFCLTMYVMLLTL---DDYQPTWQDRLAT--PGMMIRPKGEALE--IVYSRENTESWELYVQALDSFLKPYNNSQQAVNNDDCTPDQFNIQEDSGNVRNNPKRSCRFNRTTLEDCSGLTDRFYGYPDGKPCILIKLNRVIGMKPG-KDGQSPYVTC-GAKKEDAESIGEIAYFPPNGT------FNLMYYPYYGMKAQVNYSQPLVAVKFMNISFNTDVNVECK 258          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-010718-1])

HSP 1 Score: 120.939 bits (302), Expect = 1.014e-31
Identity = 83/268 (30.97%), Postives = 132/268 (49.25%), Query Frame = 1
Query:   97 EGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKN-------FAICNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLI--------DKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            E F+N R++ F GRT SSW  I +FY  +Y  L   F   M V L+ L   D  R T Q  L    PG+ +RP  +     I +     ++++ Y   +  FL+PY D  ++  KN       F I   +  + +   + C+F  ++LE C+   +  +GY +G PC++IK+N++ G +P   D   P + C  +           D D +GE+ Y+P NG       F+  +YPY G   Q  Y  P+VAV+F+ + +N  V V+C+
Sbjct:   11 EFFWNPRTREFCGRTASSWGLILLFYLAFYIFLAGLFTLTMYVMLQTL---DDHRPTYQDRLST--PGMMIRPKGEQLE--IAYTTEYTETWERYVQALNNFLSPYNDT-VQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIGLLP-AKDGQPPYVTCGAKKYKVGKDEWTDDSDKLGELAYYPPNGT------FNLMYYPYYGKKAQVNYSQPLVAVKFLNITRNEDVNVECK 263          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2b [Source:ZFIN;Acc:ZDB-GENE-010718-1])

HSP 1 Score: 120.939 bits (302), Expect = 1.014e-31
Identity = 83/268 (30.97%), Postives = 132/268 (49.25%), Query Frame = 1
Query:   97 EGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKN-------FAICNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLI--------DKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            E F+N R++ F GRT SSW  I +FY  +Y  L   F   M V L+ L   D  R T Q  L    PG+ +RP  +     I +     ++++ Y   +  FL+PY D  ++  KN       F I   +  + +   + C+F  ++LE C+   +  +GY +G PC++IK+N++ G +P   D   P + C  +           D D +GE+ Y+P NG       F+  +YPY G   Q  Y  P+VAV+F+ + +N  V V+C+
Sbjct:   11 EFFWNPRTREFCGRTASSWGLILLFYLAFYIFLAGLFTLTMYVMLQTL---DDHRPTYQDRLST--PGMMIRPKGEQLE--IAYTTEYTETWERYVQALNNFLSPYNDT-VQTQKNYECKPDQFFIQEDSGGLKNFPKRSCQFKRSILEKCSGITDRFYGYDEGKPCIIIKLNRVIGLLP-AKDGQPPYVTCGAKKYKVGKDEWTDDSDKLGELAYYPPNGT------FNLMYYPYYGKKAQVNYSQPLVAVKFLNITRNEDVNVECK 263          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Match: atp1b3a (ATPase Na+/K+ transporting subunit beta 3a [Source:ZFIN;Acc:ZDB-GENE-990415-167])

HSP 1 Score: 115.546 bits (288), Expect = 9.817e-30
Identity = 75/258 (29.07%), Postives = 131/258 (50.78%), Query Frame = 1
Query:   88 SFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKK--NTLVMVKCQ 840
            S+ +  YN R+    GRT  +W  I +FY ++Y  L A F+  + V L+ L  +D P+   + +     PGL +RP     +  I F  ++P  Y  Y   + +FL  Y D     +        + +  +++ K+C+F  ++L  C+  +   FGY+KG PCV++KMN+I G  P    +  P I C  +++       ++QYFP+ G        D  ++PY G+    GY+ P+VAV+ +  K+  N+ ++V+C+
Sbjct:   17 SWKDAIYNPRTGELFGRTARNWGLILLFYLVFYGFLAAMFVFTLWVMLQTL-NDDTPKYRDRVA----SPGLVIRP----NSLNIEFNRSDPLEYGQYVQHLESFLHQYNDSEQAKNDLCMAGQYSEQDGESLKKVCQFKRSLLYSCSGMEDTTFGYAKGQPCVIVKMNRIIGLKP----SGDPYINCTSKSV----KPLQMQYFPHEGT------IDRMYFPYYGKKTHKGYVQPLVAVKLLLKKEDYNSELIVECK 251          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Match: atp1b4 (ATPase Na+/K+ transporting subunit beta 4 [Source:ZFIN;Acc:ZDB-GENE-070412-1])

HSP 1 Score: 114.39 bits (285), Expect = 7.291e-29
Identity = 77/258 (29.84%), Postives = 127/258 (49.22%), Query Frame = 1
Query:  103 FYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTL-IRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN----MTSKVPDNVD-KICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQF 843
             +N+ +K F+GR+  SW  I +FY   Y  L A F   M   +       I      ++   + PG+ M P  D      I F  ++  S++ Y   +   L PY+D  L+  +N A       M   + ++ + K C+FN + L  C+  +  +FGYSKG PC+L+KMN+I G++P      +P     G      + +GE+++FPN         FD  +YPY G+     Y SP+VAVQF+ ++ +T + ++C+ 
Sbjct:   80 LWNAETKEFMGRSGKSWSLILLFYAALYIFLAAMFAGCMCCLMW-----SISPYAPTYNDRVMPPGMTMFPHVDTAHGFDIAFNASDRSSWRRYAKTLEAHLKPYDD-GLQSRRNIACKGNAYFMQEDLEESAERKACQFNRSSLGACSGLQDKDFGYSKGRPCILVKMNRILGYLP---GQGTPVNVTCGLKKGSTEVLGEVKFFPNPN-------FDLRYYPYYGKLRHVNYSSPLVAVQFLNVQHDTPLHIQCKL 321          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Match: atp1b3 (ATPase Na+/K+ transporting subunit beta 3 [Source:NCBI gene;Acc:394687])

HSP 1 Score: 117.857 bits (294), Expect = 1.632e-30
Identity = 87/270 (32.22%), Postives = 131/270 (48.52%), Query Frame = 1
Query:  103 FYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQP---GYLSPIVAVQFMTLKKNT---LVMVKCQF---MNMKFESDLLKF 879
             YN +S  F+GRT SSW  I +FY ++Y  L   F   M V L+ L  + +P+   + S     PGL +   P      I+F  N+ QSY+ Y   + TFLTPY D     +   A      +   +  K C+FN + L  C+  + N FGY++G PCV++KMN+I G  P+     +P I C       K     +QYFP NG        D  ++PY G+     Y+ P+VAV+ +    N+    + ++C+     N+K E +  KF
Sbjct:   20 IYNPQSGEFMGRTASSWALILLFYLVFYGFLAGLFTLTMWVMLQTL-DDSVPKYRDRVS----SPGLMIS--PKSAGLEIKFTRNKTQSYQEYIQTLHTFLTPYNDAIQAKNDLCAPGLYFDQDEKDEKKACQFNRSSLGLCSGIEDNTFGYNEGKPCVIVKMNRIIGLKPE----GNPKINC-----TSKTEDVNLQYFPENGK------IDLMYFPYYGKKTHVNYVQPLVAVKIIPPPYNSSLDEISLECKIHGSRNLKNEDERDKF 267          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Match: fam151a (family with sequence similarity 151 member A [Source:Xenbase;Acc:XB-GENE-980030])

HSP 1 Score: 118.627 bits (296), Expect = 1.794e-30
Identity = 90/271 (33.21%), Postives = 130/271 (47.97%), Query Frame = 1
Query:   91 FIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVD------KICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPD---TTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNG-------GYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            F E  +N R++ F+GRT SSW  I  FY ++Y  LT  F   M V L+      I   T ++      PGL +RP  D  T  I ++I+   S+  Y   + + L PY D       +     + +K  D  D      K C+F  + L DC+   +  +GYS G+PC+LIKMNKI  + P    +  N+S TI C G        +G   Y+P++ N SNG       G  D  ++PY G   Q  Y  P+VAV+F  L  N  + V+C+
Sbjct:   17 FKEFMWNPRTREFMGRTASSWGLIVSFYLVFYAFLTGMFALSMYVMLQ-----TIDEYTPKYWDRLTSPGLMIRPKTD--TLEIVYSISGNSSWAPYVSQLNSMLDPYNDTVQMQQGSVCPSGVFNKQDDTGDVRNYPKKACQFLRSSLGDCSGLTDPTYGYSTGSPCLLIKMNKIINFYPGVIPSLSNTSITINCTGTTANMDQMLGSRTYYPSS-NPSNGTSNGTSLGTMDLMYFPYYGNRAQKNYSQPLVAVKFYNLTLNQDLYVQCR 279          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Match: tpst2 (tyrosylprotein sulfotransferase 2 [Source:Xenbase;Acc:XB-GENE-962493])

HSP 1 Score: 115.161 bits (287), Expect = 2.556e-29
Identity = 86/271 (31.73%), Postives = 126/271 (46.49%), Query Frame = 1
Query:  106 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPD----NVD----KICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWI----------PDTTDNSSP---TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            +N   K FLGRT  SW KI +FY I+Y  L   F+  + V L       I     ++      PGL    +P    T I F+ N+P SY  Y   M  F++ Y +     DK      M  +  +    N D    K C F    L++C+      FG+++G PCV++K+N+I  +           P+ T N +P    I C G+   D  NI E++Y+   G +     F  N+YPY G   QP YL P++AVQF  L  NT + ++C+
Sbjct:   18 WNPDKKEFLGRTGGSWFKILLFYLIFYGCLAGIFIGTIQVLLL-----TISEYEPKYQDRVAPPGLTQ--VPKAVKTEINFSPNDPDSYNDYVQSMEKFISKYSNENQVSDKFEDCGTMPGQYRERGGLNKDGGQKKSCVFRRQWLQNCSGIDDQTFGFAEGKPCVIVKLNRIVAFKPVPPQNNSLPPEMTANYNPYVIPIHCQGKRDEDIPNIREVKYYGMGGFAG----FPLNYYPYYGKLLQPEYLQPLIAVQFTNLTFNTEIRIECK 277          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Match: atp1b3 (ATPase Na+/K+ transporting subunit beta 3 [Source:NCBI gene;Acc:394687])

HSP 1 Score: 104.76 bits (260), Expect = 1.135e-25
Identity = 81/267 (30.34%), Postives = 126/267 (47.19%), Query Frame = 1
Query:  103 FYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNT---LVMVKCQF---MNMKFESDLLKF 879
             YN +S  F+GRT SSW  I +FY ++Y  L   F   M V L+ L  + +P+   + S     PGL +   P      I+F  N+ QSY+ Y   + TFLTPY D     +   A      +   +  K C+FN + L  C+  + N FGY++G PCV++KMN+I G  P+     +P I C            ++ Y       S+  Y DH ++       Y+ P+VAV+ +    N+    + ++C+     N+K E +  KF
Sbjct:   20 IYNPQSGEFMGRTASSWALILLFYLVFYGFLAGLFTLTMWVMLQTL-DDSVPKYRDRVS----SPGLMIS--PKSAGLEIKFTRNKTQSYQEYIQTLHTFLTPYNDAIQAKNDLCAPGLYFDQDEKDEKKACQFNRSSLGLCSGIEDNTFGYNEGKPCVIVKMNRIIGLKPE----GNPKINC----------TSKVSY-------SSPSYIDHWWF-----VNYVQPLVAVKIIPPPYNSSLDEISLECKIHGSRNLKNEDERDKF 253          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Match: ATP1B4 (pyrimidine-specific ribonucleoside hydrolase rihA [Source:Xenbase;Acc:XB-GENE-5872373])

HSP 1 Score: 100.138 bits (248), Expect = 1.174e-23
Identity = 81/273 (29.67%), Postives = 125/273 (45.79%), Query Frame = 1
Query:  106 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAIN--EPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN-----MTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEIL 888
            +N   K  LGR K SW  I +FY + YC    F   M  + + GL+    P        +   PGL +RP        + FA N  E  ++ SY   + TFL  Y D   K +KN  +C      +         K C+F+ ++L +C+  +  +FG+++G PC+LIKMN+I G+      +  P          D   +G I ++P++        FD  +YPY G+     Y SP++A+QF  +K+N  V V+C+       SD  K   L
Sbjct:   55 WNPEKKEVLGRDKRSWALILLFYSVLYC----FLAGMFALCMYGLLATISPYVPTYRERV-FPPGLTIRP----QANALYFAFNSSERSTWSSYAESLNTFLEDYNDETQK-EKNL-VCTPGKYFLQPGEDHEERKACQFSRSLLRNCSGIEDPSFGFAQGKPCILIKMNRILGY---QAGSGIPIYVTCEVLKADMSYLGPISFYPSDK-------FDLMYYPYYGKLTHVNYTSPLIAMQFTGVKRNEDVNVQCKINGKDIISDHEKDRFL 306          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Match: Atp1b1 (ATPase, Na+/K+ transporting, beta 1 polypeptide [Source:MGI Symbol;Acc:MGI:88108])

HSP 1 Score: 140.969 bits (354), Expect = 4.249e-39
Identity = 97/275 (35.27%), Postives = 143/275 (52.00%), Query Frame = 1
Query:  106 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAIC-NMTSKVPDNVD--------KICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPT--------------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGY--FDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            +NS  K FLGRT  SW KI +FY I+Y  L   F+  + V L  L  +++ + T Q  +    PGL    +P    T I F  N+P+SY++Y +++  FL  Y+D   KDD  F  C N+ S+  +  D        K+CRF L  L +C+  N+  +GY +G PC++IK+N++ G+ P    N S                ++C G+   DKD +G I+YF        GGY  F   +YPY G   QP YL P++AVQF  L  +T + V+C+
Sbjct:   17 WNSEKKEFLGRTGGSWFKILLFYVIFYGCLAGIFIGTIQVML--LTISEL-KPTYQDRVAP--PGLTQ--IPQIQKTEISFRPNDPKSYEAYVLNIIRFLEKYKDSAQKDDMIFEDCGNVPSEPKERGDINHERGERKVCRFKLDWLGNCSGLNDDSYGYREGKPCIIIKLNRVLGFKPKPPKNESLETYPLMMKYNPNVLPVQCTGKRDEDKDKVGNIEYF------GMGGYYGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTVDTEIRVECK 278          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Match: Atp1b2 (ATPase, Na+/K+ transporting, beta 2 polypeptide [Source:MGI Symbol;Acc:MGI:88109])

HSP 1 Score: 124.405 bits (311), Expect = 6.424e-33
Identity = 84/282 (29.79%), Postives = 134/282 (47.52%), Query Frame = 1
Query:   55 EKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDN-----VDKICRFNLTMLEDCN---KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQP---GYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD 867
            EK  C     + + E  +N R+  F+GRT +SW  I +FY ++Y  LTA F   M V L+  V +  P+   + +     PGL +RP  ++   ++   I++ +S+  +   +  FL PY D       +        + PDN       + C+FN T L DC+      ++GYS G PCV IKMN++  +      N S  + C G+   D +N+G    FP NG+       D  ++PY G+     Y  P+VAV+F+ +  N  V V+C+       +D
Sbjct:    6 EKKSCG-QVVEEWKEFVWNPRTHQFMGRTGTSWAFILLFYLVFYGFLTAMFSLTMWVMLQ-TVSDHTPKYQDRLAT----PGLMIRPKTENLDVIVN--ISDTESWGQHVQKLNKFLEPYNDSIQAQKNDVCRPGRYYEQPDNGVLNYPKRACQFNRTQLGDCSGIGDPTHYGYSTGQPCVFIKMNRVINFYAGA--NQSMNVTCVGKRDEDAENLGHFVMFPANGS------IDLMYFPYYGKKFHVNYTQPLVAVKFLNVTPNVEVNVECRINAANIATD 271          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Match: Atp1b3 (ATPase, Na+/K+ transporting, beta 3 polypeptide [Source:MGI Symbol;Acc:MGI:107788])

HSP 1 Score: 123.635 bits (309), Expect = 9.497e-33
Identity = 91/276 (32.97%), Postives = 130/276 (47.10%), Query Frame = 1
Query:  106 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVD--------KICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQP---GYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 894
            YN  S  FLGRT  SW  I +FY ++Y  L A F   M   L+ L  +++P+   Q       PGL + P P  T     F+++EPQ+YK    D+ +FL PY    +++ KN   C      PD           + C+F +++LE+C+     NFGYSKG PC+L+KMN+I   IPD      P I C     + K+    I  +P        G  D  ++PY G+    GY  P+VAVQ                  +KF+S L K E+ V+
Sbjct:   21 YNPSSGEFLGRTSKSWGLILLFYLVFYGFLAALFTFTMWAMLQTL-NDEVPKYRDQIP----SPGLMVFPKP-QTALEYTFSMSEPQTYKKLVEDLESFLKPYS---VEEQKNLTSC------PDGAPFIQHGPDYRACQFPVSLLEECSGVTDANFGYSKGQPCILVKMNRIIDLIPD----GYPQISC-----LPKEENATIATYPEF------GVLDLKYFPYYGKKRHVGYRQPLVAVQ------------------VKFDSGLNKKEVTVE 248          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Match: Atp1b4 (ATPase, (Na+)/K+ transporting, beta 4 polypeptide [Source:MGI Symbol;Acc:MGI:1915071])

HSP 1 Score: 102.064 bits (253), Expect = 2.869e-24
Identity = 79/274 (28.83%), Postives = 133/274 (48.54%), Query Frame = 1
Query:   79 RCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN----MTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLL 873
            + Q   E  ++   +  L RT  S   I + YF +Y SL A  +++ +  L   +   +P  T Q       PG+ +RP   H+     F ++EP++++ Y + +  FL  Y D  L+++ N         +     D   K C+F  + L++C+  +   FGYS G PC+L+KMN+I G+ P+  D     + C  Q   D+++I  I Y+P + +      FD  +YPY G+     Y SP+VA+ F  + KN  V V+CQ       +D++
Sbjct:   84 KLQIVNEYLWDPEKRMSLARTGQSRSLILVIYFFFYASLAAV-ITLFIYMLFLAISPYMPTFTEQVK----PPGVMIRPFA-HSLNF-NFNVSEPETWQRYVISLNGFLQGYND-SLQEEMNIDCPPGRYFIQDGDEDEDKKACQFKRSFLKNCSGLEDPTFGYSTGQPCILLKMNRIVGFRPEFGDPVK--VSCKVQKG-DENDIRSINYYPESAS------FDLRYYPYYGKLTHVNYTSPLVAMHFTDVVKNQAVPVQCQLKGKGIVNDVI 340          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Match: Atp4b (ATPase, H+/K+ exchanging, beta polypeptide [Source:MGI Symbol;Acc:MGI:88114])

HSP 1 Score: 98.2117 bits (243), Expect = 3.229e-23
Identity = 72/278 (25.90%), Postives = 128/278 (46.04%), Query Frame = 1
Query:   55 EKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRP-LPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFA----ICNMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIG----EIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQFM 846
            EK  C   R   F    +N  +   LGRT + W  I ++Y  +Y  +T  F   + V ++ +     P        LK  PG+ +RP +       I + ++E  S+      + +FL  Y     +D  N          +   P++    C+F   ML++C+     +FG+ +G PC +IKMN+I  ++P  ++N++P + C  Q+   K        +++Y+P NG       F  +++PY G   QP Y +P+VA + + + KN  V + C+ +
Sbjct:    6 EKKSCS-QRMAEFRHYCWNPDTGQMLGRTPARWVWISLYYAGFYVVMTGLFALCIYVLMQTI----DPYTPDYQDQLK-SPGVTLRPDVYGERGLKISYNVSENSSWAGLTHTLHSFLAGYTPASQQDSINCTSEKYFFQESFAAPNHTKFSCKFTADMLQNCSGLADPSFGFEEGKPCFIIKMNRIVKFLP--SNNTAPRVDCTFQDDPQKPRKDTEPLQVEYYPPNGT------FSLHYFPYYGKKAQPHYSNPLVAAKLLNVPKNMQVSIVCKIL 269          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Match: sp|Q93235|AT1B1_CAEEL (Sodium/potassium-transporting ATPase subunit beta-1 OS=Caenorhabditis elegans OX=6239 GN=nkb-1 PE=1 SV=1)

HSP 1 Score: 172.94 bits (437), Expect = 2.463e-50
Identity = 97/295 (32.88%), Postives = 168/295 (56.95%), Query Frame = 1
Query:   85 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKI-CRFNLTMLED-CNKKNNFGYSKGNPCVLIKMNKIFGWIP-DTTDNSSP------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 894
            ++F E  YN ++ T +GRT  SW +I +FY I+Y  L AF+++ + +F++ L    +PR  G+ +++ + PG+G +P     PD  +TLI++ + + +SYK+Y   M+T+LT Y D    + +     +    +  N D + CRF+L++ +  C++K++FGY  G PCV+I +N++ GW P D  +NS P             I C G   +D+++IG++ Y P+NG        D  +YPY+   GY  PI  V+F T+ +N LV+V+C+   +  E D      ++ FE++V+
Sbjct:   27 ETFREFLYNKKNGTVMGRTGKSWFQIIVFYIIFYAFLAAFWLTCLTIFMKTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKERPD--STLIKYNLRDQKSYKAYLEQMKTYLTKY-DSNATETRECGAGDSNDDLEKNPDALPCRFDLSVFDKGCSEKSDFGYKSGKPCVIISLNRLIGWRPTDYQENSVPEEVKDRYKAGSIAINCRGATNVDQEHIGKVTYMPSNG-------IDGRYYPYVFTKGYQQPIAMVKFDTIPRNKLVIVECRAYALNIEHDISSRLGMVYFEVMVE 310          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Match: sp|P25169|AT1B1_ARTSF (Sodium/potassium-transporting ATPase subunit beta OS=Artemia franciscana OX=6661 PE=2 SV=1)

HSP 1 Score: 164.466 bits (415), Expect = 3.932e-47
Identity = 107/321 (33.33%), Postives = 152/321 (47.35%), Query Frame = 1
Query:   43 DEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHT---TTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLED-CNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPT---------------------------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDL------LKFEILVD 894
            DE       K ++ QSF    +NS +  F+GRT  SW KI IFY I+Y  L  FF  M+++F + L    IP+   + SL+   PGLG RP+P      +TLI+F       ++ +   +  FL PYE +     + F  C+     P    K C FN+ +L D C K+NNFGY  G PCVLIK+   FGW P+  ++S+                             + C G+   DK+ IG I Y P  G       F   +YPY+  PGYL+P+VA+QF +L+    V V+C+        D       + FEI +D
Sbjct:    7 DEQFVGSGPKETKWQSFKGFVWNSETSQFMGRTAGSWAKITIFYVIFYTLLAGFFAGMLMIFYQTL-DFKIPKWQNKDSLIGANPGLGFRPMPPEAQVDSTLIQFKHGIKGDWQYWVHSLTEFLEPYETL-TSSGQEFTNCDFDK--PPQEGKACNFNVELLGDHCTKENNFGYELGKPCVLIKLTD-FGWRPEVYNSSAEVPEDMPADLKSYIKDIETGNKTHMNMVWLSCEGETANDKEKIGTITYTPFRG-------FPAYYYPYLNVPGYLTPVVALQFGSLQNGQAVNVECKAWANNISRDRQRRLGSVHFEIRMD 315          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Match: sp|Q9XUY5|AT1B3_CAEEL (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis elegans OX=6239 GN=nkb-3 PE=3 SV=1)

HSP 1 Score: 160.999 bits (406), Expect = 1.006e-45
Identity = 95/300 (31.67%), Postives = 155/300 (51.67%), Query Frame = 1
Query:   85 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYL-----KDDKNFAICNMTSKVPDNVDKICRFNLTMLE--DCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP-------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 894
            ++F +  YN    T LGRT +SWC+I +FY I+Y  L+AFF+  + +FL  L    +PR  G+ +++ + PG+G +P     PD  +TLI+F + + +S++ Y   +  +L+ Y++          D N A+   T   P      CRF+L + E  +C  K+ +GY  G PCV + +N++ GW P   D+ S              TI C G    DK+++G+++Y P  G        D  +YPY+  P Y  PI  V+F T+ +N LV+V+C+      E D      ++ FE+ V+
Sbjct:   24 ETFAQFLYNKDKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLSIFLRTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKENPD--STLIKFNLQDSKSWEPYVKQLDNYLSKYKNTNETRDCGASDNNDALETDTDTFP------CRFDLGLFEKANCGAKDQYGYKSGKPCVAVSLNRLIGWRPVNYDDGSVPEEIKGRYKPGSITINCEGATSFDKEHLGKVKYIPETG-------IDGRYYPYVFVPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDISTRLGMVYFELFVE 307          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Match: sp|A8X4W9|AT1B3_CAEBR (Probable sodium/potassium-transporting ATPase subunit beta-3 OS=Caenorhabditis briggsae OX=6238 GN=nkb-3 PE=3 SV=3)

HSP 1 Score: 159.458 bits (402), Expect = 4.173e-45
Identity = 92/296 (31.08%), Postives = 158/296 (53.38%), Query Frame = 1
Query:   85 QSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPL----PDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKI-CRFNLTMLE--DCNKKNNFGYSKGNPCVLIKMNKIFGWIP-DTTDNSSP------------TIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESD------LLKFEILVD 894
            ++F +  YN +  T LGRT +SWC+I +FY I+Y  L+AFF+  + +FL+ L    +PR  G+ +++ + PG+G +P     PD  +TLI+F + + +S++ Y   +  + + Y +    D +     +    +  + D + CRF+L + E  +C  K+ +G+  G PCV++ +N++ GW P D   NS P            TI C G    DK+++G+++Y P  G        D  +YPY+  P Y  PI  V+F T+ +N LV+V+C+      E D      ++ FE+ V+
Sbjct:   33 ETFRQFLYNKQKGTVLGRTGTSWCQITVFYIIFYIFLSAFFIGCLAIFLKTL-DPKVPRFYGKGTIIGVNPGVGYQPWLKENPD--STLIKFNLQDSKSWEPYVKQLDGYFSRYNNT--NDTRECGAEDSNEALQTDPDSLPCRFDLGLFEKANCGAKDQYGFKSGKPCVVVSLNRLIGWRPVDYDGNSVPEEIKSRYKSGSITINCEGATPFDKEHLGKVKYIPEAG-------IDGRYYPYVFLPSYQQPIAMVKFDTIPRNKLVIVECRAYASNIEHDVSTRIGMVYFELFVE 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Match: sp|Q24046|ATPB1_DROME (Sodium/potassium-transporting ATPase subunit beta-1 OS=Drosophila melanogaster OX=7227 GN=nrv1 PE=1 SV=2)

HSP 1 Score: 150.984 bits (380), Expect = 4.266e-42
Identity = 99/306 (32.35%), Postives = 151/306 (49.35%), Query Frame = 1
Query:   70 KPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTT--TLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD--------------NSSPT-------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFM--NMKFESDL------LKFEILVD 894
            +P++ Q+F E  YN +  TF GRT  SW ++ +FY I+Y  L A F   M   L   + +  P+   Q SL+   PGLG RPL + T   ++I F   +P     +   +  FL  Y     +D K+        +V +  D +C  N  +   C+K NN+GY    PC+ +K+NKIFGWIP+  D              N + T       + C G    DK+N   I+YFP+ G       F   +YP++ QPGYLSP+VAVQF +  K  ++ V+C+    N+++   +      + F+IL+D
Sbjct:   17 QPAKKQTFSEMIYNPQEGTFFGRTGKSWSQLLLFYTIFYIVLAALFTICMQGLLS-TISDTEPKWKLQDSLIGTNPGLGFRPLSEQTERGSVIAFDGKKPAESDYWIELIDDFLRDYNHTEGRDMKHCGF----GQVLEPTD-VCVVNTDLFGGCSKANNYGYKTNQPCIFLKLNKIFGWIPEVYDKEEKDMPDDLKKVINETKTEERQQVWVSCNGHLGKDKENFQNIRYFPSQG-------FPSYYYPFLNQPGYLSPLVAVQFNSPPKGQMLDVECRAWAKNIQYSGSVRDRKGSVTFQILLD 309          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Match: A0A564YRD5 (Uncharacterized protein OS=Hymenolepis diminuta OX=6216 GN=WMSIL1_LOCUS8659 PE=4 SV=1)

HSP 1 Score: 245.358 bits (625), Expect = 2.798e-76
Identity = 120/278 (43.17%), Postives = 175/278 (62.95%), Query Frame = 1
Query:   73 PSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP--TIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMK-FESDLLKFEILVD 894
            PSRC ++I   YN + K+ LGRT  SW +I  +Y I+Y  L  FFM MM VFL+ +V    P RTGQ SLLK +PGLG+RP+ D   TLI ++  +PQ Y  Y  ++   L+ YE I  K +  FA C    KVP++  K+CRF+L  L  CNK NNFGY    PC ++K+N+++GW+PD  D   P   + C GQN  D DN+G ++++P+   N +  G F + ++P++GQ GY SP+VAVQF  L K+ +++++C    +K  ++D + FEIL+D
Sbjct:   20 PSRCPNWI---YNKKDKSILGRTCVSWAQIFTYYCIFYALLIGFFMGMMTVFLQLIVPPQYPLRTGQQSLLKFQPGLGVRPIVDEDKTLIFYSKKDPQVYYEYVDNINALLSYYEKINEKPETGFATCTTDGKVPNDPKKVCRFDLNSLGPCNKANNFGYPDDKPCAILKLNRVYGWMPDVMDPEIPHTLVSCQGQNPEDHDNMGPVKFYPSITANGTEYGVFHNQYFPFLGQNGYTSPLVAVQFENLTKHVIILIQCTLQGVKNIDTDPVTFEILLD 294          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Match: A0A068XXJ4 (Sodium:potassium dependent atpase beta subunit OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000413500 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 7.208e-76
Identity = 116/278 (41.73%), Postives = 182/278 (65.47%), Query Frame = 1
Query:   73 PSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP--TIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNM-KFESDLLKFEILVD 894
            PSRC +++   YN + K+FLGRT +SW KI ++Y  +Y  L+ FF+ M++VFL+ +V   +P RTG  SLL+ +PGLGMRP+ D   TLI ++  +PQ Y  Y  ++   ++ YE+I +K    FA C    K P+   K+CRF+L  L  CNK NN+GY    PCV++K+N+++GW+PD TD + P   + C GQN  D++N+G ++++P+   N +  G F + ++P++GQ GY SP+VAVQF  L+K+ L++V+C+       + + +KFEIL+D
Sbjct:   18 PSRCPTWL---YNKKDKSFLGRTCASWAKIFLYYCFFYAILSGFFLGMIMVFLQFIVPAKVPMRTGHQSLLRFQPGLGMRPIIDEDKTLIYYSSRDPQVYYEYVDNLNALISYYEEINVKPAIGFANCTNDQKSPNEPKKVCRFDLESLGPCNKSNNYGYPDDKPCVILKLNRVYGWMPDVTDAAIPHTLVSCEGQNPEDQENVGPMKFYPSIIKNGTEYGVFHNQYFPFLGQNGYTSPLVAVQFEKLEKHILILVQCRLHGATNVDPEPVKFEILLD 292          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Match: U6JI80 (Sodium/potassium-transporting ATPase subunit beta-2 OS=Echinococcus granulosus OX=6210 GN=EGR_08763 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 7.287e-76
Identity = 116/278 (41.73%), Postives = 182/278 (65.47%), Query Frame = 1
Query:   73 PSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSP--TIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNM-KFESDLLKFEILVD 894
            PSRC +++   YN + K+FLGRT +SW KI ++Y  +Y  L+ FF+ M++VFL+ +V   +P RTG  SLL+ +PGLGMRP+ D   TLI ++  +PQ Y  Y  ++   ++ YE+I +K    FA C    K P+   K+CRF+L  L  CNK NN+GY    PCV++K+N+++GW+PD TD + P   + C GQN  D++N+G ++++P+   N +  G F + ++P++GQ GY SP+VAVQF  L+K+ L++V+C+       + + +KFEIL+D
Sbjct:   18 PSRCPTWL---YNKKDKSFLGRTCASWAKIFLYYCFFYAILSGFFLGMIMVFLQFIVPAKVPMRTGHQSLLRFQPGLGMRPIIDEDKTLIYYSSRDPQVYYEYVDNLNALISYYEEINVKPAIGFANCTNDQKSPNEPKKVCRFDLESLGPCNKSNNYGYPDDKPCVILKLNRVYGWMPDVTDAAIPHTLVSCEGQNPEDQENVGPMKFYPSIIKNGTEYGVFHNQYFPFLGQNGYTSPLVAVQFEKLEKHILILVQCRLYGATNVDPEPVKFEILLD 292          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Match: A0A267GYP4 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig022013g1 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 1.987e-75
Identity = 118/284 (41.55%), Postives = 171/284 (60.21%), Query Frame = 1
Query:   34 INFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDD--KNFAICNMTSKVPDNVDKICRFNLT-MLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNS--SPTIKCFGQNLIDKDNIGEIQYFPN-----NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMK 855
            ++ D D    E +P R  +F+   YN  +   LGRT  SW KIG FY +YY  L  FF+ M+ VFL G++  DIP RTG++SLL++ PGLG RP P   +TLI F   EP +Y     +++     Y+++ LK D       C   SK      K+C+FN T  L+DCN   +FGY+ G PCV++KMN+++GW+PD  D     P + CFG+N  D +NIGE++YFP+      G  +  GYF   ++PY+ Q GY +P+VAV+F  L+ N+LVMV+C+  N++
Sbjct:   24 LDVDIDATNEEARPCRGAAFLRFLYNRNTGQILGRTGVSWAKIGAFYIVYYSCLAGFFVGMLSVFLYGVIVEDIPYRTGENSLLQMNPGLGFRPQPSMDSTLIEFVQGEPATYAGEMANLQQMYDTYKEMELKPDNVNVRKACEPDSKPDREPFKVCKFNWTRWLQDCNPSTDFGYAVGKPCVVLKMNRVYGWLPDPLDPEVPHPMVTCFGENPADTENIGELEYFPSMETNYTGTPARMGYFSQAYFPYLKQVGYRAPLVAVRFSNLRNNSLVMVRCELRNLR 307          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Match: A0A267DGL6 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig008425g2 PE=4 SV=1)

HSP 1 Score: 244.202 bits (622), Expect = 2.393e-75
Identity = 118/284 (41.55%), Postives = 171/284 (60.21%), Query Frame = 1
Query:   34 INFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDD--KNFAICNMTSKVPDNVDKICRFNLT-MLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNS--SPTIKCFGQNLIDKDNIGEIQYFPN-----NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMK 855
            ++ D D    E +P R  +F+   YN  +   LGRT  SW KIG FY +YY  L  FF+ M+ VFL G++  DIP RTG++SLL++ PGLG RP P   +TLI F   EP +Y     +++     Y+++ LK D       C   SK      K+C+FN T  L+DCN   +FGY+ G PCV++KMN+++GW+PD  D     P + CFG+N  D +NIGE++YFP+      G  +  GYF   ++PY+ Q GY +P+VAV+F  L+ N+LVMV+C+  N++
Sbjct:   33 LDVDIDATNEEARPCRGAAFLRFLYNRNTGQILGRTGVSWAKIGAFYIVYYSCLAGFFVGMLSVFLYGVIVEDIPYRTGENSLLQMNPGLGFRPQPSMDSTLIEFVQGEPATYAGEMANLQQMYDTYKEMELKPDNVNVRKACEPDSKPDREPFKVCKFNWTRWLQDCNPSTDFGYAVGKPCVVLKMNRVYGWLPDPLDPEVPHPMVTCFGENPADTENIGELEYFPSMETNYTGTPARMGYFSQAYFPYLKQVGYRAPLVAVRFSNLRNNSLVMVRCELRNLR 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 135.576 bits (340), Expect = 2.282e-37
Identity = 86/272 (31.62%), Postives = 143/272 (52.57%), Query Frame = 1
Query:   67 CKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAI-------CNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQFM 846
             K  +   + E F+N R++ F GRT SSW  I +FY  +Y  L   F+  M V L  L  N   + T Q  L    PGL +RP  +    +  +A    +S+ ++   + +FL+PY D  +++ KN+A           +  V +N  + C+F  ++LEDC+   +  +GY +G PC++IK+N++ G +P   D  +P+I C    + D D +GE+ YFP NG       F+  ++PY G   Q  Y  P+VA++F+ +  NT + V+C+ +
Sbjct:    2 AKGDKKNEWKEFFWNPRTREFCGRTASSWGLIFLFYLAFYIFLAGMFILTMYVMLLTLDDN---KPTYQDRLAT--PGLMIRPKGEEMEII--YAKENTESWDTHVQALNSFLSPYND-SVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLP-GKDGQAPSISC-APKIDDTDKMGEVAYFPRNGT------FNLMYFPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKII 257          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Match: atp1b2b (sodium/potassium-transporting ATPase subunit beta-2 [Source:NCBI gene;Acc:103046346])

HSP 1 Score: 132.494 bits (332), Expect = 4.520e-36
Identity = 87/280 (31.07%), Postives = 146/280 (52.14%), Query Frame = 1
Query:   67 CKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAI-------CNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKC------FGQN--LIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQFM 846
             K  +   + E F+N R++ F GRT SSW  I +FY  +Y  L   F+  M V L  L  N   + T Q  L    PGL +RP  +    +  +A    +S+ ++   + +FL+PY D  +++ KN+A           +  V +N  + C+F  ++LEDC+   +  +GY +G PC++IK+N++ G +P   D  +P+I C       G++  + D D +GE+ YFP NG       F+  ++PY G   Q  Y  P+VA++F+ +  NT + V+C+ +
Sbjct:    2 AKGDKKNEWKEFFWNPRTREFCGRTASSWGLIFLFYLAFYIFLAGMFILTMYVMLLTLDDN---KPTYQDRLAT--PGLMIRPKGEEMEII--YAKENTESWDTHVQALNSFLSPYND-SVQEQKNYACKPDQYFKQEDSDSVKNNPKRSCQFRRSILEDCSGLTDRYYGYDEGKPCIIIKLNRVIGMLP-GKDGQAPSISCAPKKYKIGKDEWIDDTDKMGEVAYFPRNGT------FNLMYFPYYGKKAQVNYSQPLVAIKFLNITLNTEINVECKII 266          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Match: atp1b2a (sodium/potassium-transporting ATPase subunit beta-2-like [Source:NCBI gene;Acc:103043075])

HSP 1 Score: 130.183 bits (326), Expect = 2.310e-35
Identity = 90/270 (33.33%), Postives = 139/270 (51.48%), Query Frame = 1
Query:   64 ECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDI--YLKDD----KNFAICNMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            E    +   + E F+N R+   LGRT SSW  I +FY ++Y  L   F   M V L  L   D  + T Q  L    PGL +R  P  ++  I+++    +S+  Y   + +FLTPY++    + +D      + I   +  V +N  + C+FN T+L DC+     N+GY  G PC+ IK+N++ G +P   D  SP + C G    D + +G++ YFP+N +      F+  +YPY G   Q  Y  P+VAV+F+ L  NT V V+C+
Sbjct:    4 EEDKKKSGEWREFFWNPRTHELLGRTASSWGLILLFYLVFYTFLAGMFCLTMYVMLLTL---DDYKPTWQDRLAT--PGLMIR--PKGSSMEIQYSKQNTESWDKYVKTLNSFLTPYDNSQQVMNNDPCTPDKYFIQEDSGSVRNNPKRSCQFNRTVLGDCDGLTDPNYGYRDGKPCIFIKLNRVIGMLP-GKDGQSPYVTC-GAKREDSELLGDMAYFPSNAS------FNLMYYPYYGKKAQVNYSQPLVAVKFLNLTLNTDVNVECK 258          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Match: atp1b3b (sodium/potassium-transporting ATPase subunit beta-3-like [Source:NCBI gene;Acc:103044362])

HSP 1 Score: 122.865 bits (307), Expect = 1.348e-32
Identity = 90/272 (33.09%), Postives = 133/272 (48.90%), Query Frame = 1
Query:   55 EKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDN---VDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKK--NTLVMVKCQ 840
            EK E K S  + FI   YN R+  F+GRT SSW  I +FY ++Y  L   F   M V L+ L  ND    T ++      PGL +RP        I    + PQ Y  Y   + +FL  Y D     ++N         + +N   V  +C+F  + L  C+     NFGY++G PCVLIKMN+I G +P       P I C  +    +D   ++QYFP+ G       FD  ++PY G+   P Y+ P+VAV+ +  ++  NT + ++C+
Sbjct:    6 EKPEGKDSSWKDFI---YNPRTGEFIGRTASSWALIFLFYLVFYGFLAGMFSLTMWVMLQTL--NDY---TPKYRDRVASPGLMIRP----KYFDIEVNRSNPQQYNKYVQGLESFLQQYNDTL--QEQNTVCTEGDYYMQENNELVKNVCQFKRSQLRQCSGLADTNFGYAEGQPCVLIKMNRIIGLVP----RGDPYINCTAK----RDTPLQMQYFPSEGR------FDKMYFPYYGKKAHPNYVQPVVAVKLLFSEQDYNTQLTIECR 249          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Match: atp1b1b (sodium/potassium-transporting ATPase subunit beta-233-like [Source:NCBI gene;Acc:103031172])

HSP 1 Score: 117.857 bits (294), Expect = 1.851e-30
Identity = 86/275 (31.27%), Postives = 130/275 (47.27%), Query Frame = 1
Query:  106 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAIC-----------NMTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKI--FGWIPDTTDNSSPT------------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            +NS ++  LGRT  SW KI +FY I+Y  L   F+  +   L  L  N  P  T Q  +    PGL   P  D +   + F++N+ ++Y  Y   MR FL  Y +   +D   F  C           ++ S +     K CRF  T L  C+  +   FG+S+G PC+++K+N+I  F   P  T+ S P             I C  +   D+  +GE++Y+        GG F   +YPY G+   P YL P+VAVQF+ L  N  + ++C+
Sbjct:   16 WNSETREVLGRTGGSWAKILLFYVIFYGFLAGIFIGTIQALLLTL-SNYKP--TWQDRIAP--PGLTHTPRSDKSE--LSFSVNDVETYLKYTKSMREFLEAYNEETQRDQMKFEDCGDQPQEYKHRGDLESDI--GARKACRFQRTFLGPCSGIEDKEFGFSEGKPCLIVKLNRIVNFKPKPPLTNESIPEEAQHKIQRNVIPIYCHNKREEDEGKLGEVKYY------GIGGGFPLQYYPYYGKLLHPQYLQPLVAVQFVNLTMNYELRIECK 275          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005979.1 (pep scaffold:Pmarinus_7.0:GL479225:261160:295076:-1 gene:ENSPMAG00000005385.1 transcript:ENSPMAT00000005979.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 101.293 bits (251), Expect = 1.395e-25
Identity = 78/253 (30.83%), Postives = 122/253 (48.22%), Query Frame = 1
Query:  160 IGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNM-----TSKVPDNVDKI---CRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQFM--NMKFESDLLKF 879
            I +FY ++Y  L + F+  M V L+  V +  P+   + S     PG+ MRP        +   IN   ++      + TF   Y ++   +  N A+C         K P N D +   CRFN +   +C   + +GY+   PCV IK+N+I G+ P T    +P + C  +   +  N+GE++YFP      NGG  D  ++PY G+   P Y  P+VAV+F+ L K   V V+C+ +  N+K   D  KF
Sbjct:    3 ILLFYTVFYAFLASLFVFTMWVMLQ-TVDDKNPKYQDRVS----SPGVVMRP---KMNKALELYINR-NTHSDIIEHLNTFFEAYNEV---NQTNKALCEAGKYRDNQKGPPNEDNVWPACRFNRSDFGECASPD-YGYTNQTPCVFIKLNRIIGFKPGTV-KEAPKVMCSSKK--ESGNLGELEYFP------NGGTMDQMYFPYYGKKLDPMYTQPLVAVRFLNLTKQMEVTVECKVIARNVKVIDDRDKF 233          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005895.1 (pep scaffold:Pmarinus_7.0:GL479457:3011:19118:1 gene:ENSPMAG00000005327.1 transcript:ENSPMAT00000005895.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 66.6254 bits (161), Expect = 6.494e-13
Identity = 67/271 (24.72%), Postives = 112/271 (41.33%), Query Frame = 1
Query:   79 RCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNM------TSKVPDNVDKICRFNLTMLE--------DCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHN--FYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQF 843
            R +     FYN  +   +GRT  SW +I +FYF+Y+  L A F   M   +  L   ++P+   + S     PGL +R  P      I F  N P+S++ Y   +   L+ Y++      +NF    +       +  P  V  +C F    L+          +  N F   K +      + +     P+  DN S  I C  ++ +     G  ++FPN  +  +  YF      +P   Q  Y  P+VA +F+ L  +T V ++C+ 
Sbjct:   12 RLKGLRHFFYNPHTGEVVGRTPKSWGQICLFYFLYFSFLGALFAFTMWALVMTL-SYELPKYQDRVS----SPGLMIR--PRAPLFEINFMSNSPKSFEPYVNSINELLSSYQNT----SENFCDAGLYRDQQAGAGQPGPVPLMCPFASPPLDAPYVYRQCSSSADNRFQAGKSHESGQSHLRREAVNWPE--DNGSSEINCTNRDEVS----GNSEFFPN--DIFDPMYFSRAPVVFPLRAQGMYTQPLVAARFLNLTHDTPVTIECRL 263          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Nematostella
Match: EDO32320 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVE8])

HSP 1 Score: 107.457 bits (267), Expect = 3.405e-27
Identity = 80/276 (28.99%), Postives = 132/276 (47.83%), Query Frame = 1
Query:   46 EDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLG-MRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFA--ICNMTS--KVPDNVDKICRFNLTMLEDCNKKNN---FGYSKGNPCVLIKMNKIFGWIPDTTDN-SSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFM 846
            E + ++E        F    YN      +GR   SW KIG+F+ ++Y  L  FF +M+ +FL  L     P R     L +   G   + P+P  +  +  +  N+  SY S+  D+ +FL  Y      +   FA   CN TS    P +  K CRF+LT L  C K      +G+  G+PC  ++MNK+F ++P+     S   ++C  ++   K+N+  I+ +P      N G+   +FYPY  +  +L+P++AVQ  T    +   V+C+ +
Sbjct:    9 EGMTRWEVIVQNANDFKTFLYNKEKGEVMGRNGQSWAKIGLFFLVFYLCLAGFFAAMLSIFLSTL-----PDRADGPKLTQYIAGKPVLNPVP--SNKIEGYDPNKASSYSSHVSDINSFLNQYVRQGGANKDQFAPDFCNGTSGEPRPKDAKKQCRFDLTNLGPCYKNETGFKYGFDTGSPCFFLRMNKVFNFVPEPNSGLSYIKVECDAKD-SSKNNL--IKVYP----EENPGW-PVSFYPYRMEDNWLAPVIAVQVNT---TSTTEVRCRAL 266          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 141.354 bits (355), Expect = 1.593e-39
Identity = 89/261 (34.10%), Postives = 137/261 (52.49%), Query Frame = 1
Query:   97 EGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAIC-------NMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQF 843
            E  +N R++ FLGRT SSW  I +FY ++Y  L   F   M + L+ L   D  + T Q  L    PG+ +RP  D T  ++ + I   +S+  Y   +  FL PY D  L+  KN             +  V +N  + C+FN T+LE+C+  N+  +GY +G PC++IKMN++ G +P   D  +P++ C  +   D D +GE+ YFP NG       F+  +YPY G   Q  Y  P+VAV+F+ +  N  V ++C+ 
Sbjct:   11 EYLWNPRTREFLGRTASSWGLILLFYLVFYIFLAGLFALTMYIMLQTL---DDHKPTWQDRLAT--PGMVIRPNTDETFEIV-YNIQNTESWDMYAQALDKFLAPYNDT-LQAQKNHECTPDQYFQQEDSGDVKNNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPG-KDGQTPSVTCAAKR-DDSDKLGELVYFPPNGT------FNLMYYPYYGKKAQVNYSQPLVAVKFLNITVNQEVNIECKI 256          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Match: atp1b2b (ATPase Na+/K+ transporting subunit beta 2 [Source:NCBI gene;Acc:101166489])

HSP 1 Score: 131.724 bits (330), Expect = 6.301e-36
Identity = 84/257 (32.68%), Postives = 138/257 (53.70%), Query Frame = 1
Query:   97 EGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTF---LTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNN--FGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIG---QPGYLSPIVAVQFMTLKKNTLVMVKCQF 843
            E  +N R++ FLGRT SSW  I +FY ++Y  L   F   M + L+ L   D  + T Q  L    PG+ +RP  D T  ++ + I   +S+  +Y+   ++   L   ++     D+ F   + +  V +N  + C+FN T+LE+C+  N+  +GY +G PC++IKMN++ G +P   D  +P++ C  +   D D +GE+ YFP NG       F+  +YPY G   Q  Y  P+VAV+F+ +  N  V ++C+ 
Sbjct:   11 EYLWNPRTREFLGRTASSWGLILLFYLVFYIFLAGLFALTMYIMLQTL---DDHKPTWQDRLAT--PGMVIRPNTDETFEIV-YNIQNTESWDIFYIKADSYNDTLQAQKNHECTPDQYFQQED-SGDVKNNPKRSCQFNRTILEECSGLNDRYYGYREGQPCIIIKMNRVIGMLPG-KDGQTPSVTCAAKR-DDSDKLGELVYFPPNGT------FNLMYYPYYGKKAQVNYSQPLVAVKFLNITVNQEVNIECKI 252          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Match: atp1b1b (sodium/potassium-transporting ATPase subunit beta-233-like [Source:NCBI gene;Acc:101166353])

HSP 1 Score: 112.079 bits (279), Expect = 2.141e-28
Identity = 84/273 (30.77%), Postives = 131/273 (47.99%), Query Frame = 1
Query:  106 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAIC-------NMTSKVPDN--VDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKI--FGWIPDTTDNSSPT------------IKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQ 840
            ++S    F+GRT  SW KI +FY +++  L   F+  + V L  L  ND  + T Q  +    PGL   P  D     + ++I   ++Y  +   +R F++ Y+D    D   F  C            + DN  V K CRF+ T+L  C+  +   FG+  G PCV++K+N+I  F   P ++++S P             + C  +   D D IGEI+Y+  NG       F   +YPY G+   P YL P+VAVQF  L +N  + ++C+
Sbjct:   15 WDSDKGEFMGRTGGSWFKITLFYVVFFGCLAGVFVGTIQVML--LTLNDF-KPTWQDRVAP--PGLSHTPKLDKAE--VSYSIKGIETYLPFTKTLREFVSQYDDSKQLDASKFENCPAEPADYKERGTLDDNAGVRKACRFSRTLLGPCSGLEDETFGFKDGKPCVIVKLNRIVNFRPRPPSSNDSIPEEAWPKVQPNLIPLFCTNKREEDADKIGEIKYYGINGG------FPLQYYPYYGKRLHPHYLQPLVAVQFTNLTQNMELRIECK 274          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Match: atp1b3a (ATPase Na+/K+ transporting subunit beta 3 [Source:NCBI gene;Acc:101157248])

HSP 1 Score: 110.923 bits (276), Expect = 4.259e-28
Identity = 81/260 (31.15%), Postives = 122/260 (46.92%), Query Frame = 1
Query:   88 SFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICN--MTSKVPDNVDKICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPG---YLSPIVAVQFMTLKK--NTLVMVKCQ 840
            S+ +  YN R+   +GRT SSW  I +FY ++YC L   F   M V L  L  + +P+   +       PGL +RP     +  I F  ++P  Y  Y   +  FL  Y D   + ++N       +       V + C F   +L  C+     N+GY +G PCV++KMN+I G  PD      P I C     + KD+  ++ Y PNNG        D  F+PY G+     YL P+VAV+ +  K+  N  + V+C+
Sbjct:   16 SWKDSIYNPRTGELMGRTASSWALILLFYLVFYCFLAGLFALTMWVLLFTL-DDYVPKYRDRVPY----PGLVIRP----NSLDISFNKSDPLKYAQYVQHLEKFLERYNDSAQEKNENCISGEFYLQDGPISMVRRACPFRRALLSFCSGLSDTNYGYQEGKPCVILKMNRIIGLKPD----GEPYINC----TVKKDHPIQMYYSPNNGQ------IDKMFFPYYGKKAHENYLQPLVAVKLLITKEDYNKELTVECR 252          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Match: atp1b4 (ATPase Na+/K+ transporting family member beta 4 [Source:NCBI gene;Acc:101161164])

HSP 1 Score: 98.5969 bits (244), Expect = 3.435e-23
Identity = 77/258 (29.84%), Postives = 127/258 (49.22%), Query Frame = 1
Query:  103 FYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRP-LPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVD-----KICRFNLTMLEDCN--KKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQ---PGYLSPIVAVQFMTLKKNTLVMVKCQF 843
             +N+ +K F+GR+  SW  I +FY   Y  L A F   +   +  +     P     +  + + PG+ M P L  H    I F  ++ +S+K Y   M  FL PY D   +D KN    +    + D+++     K C+F  + L DC+  +  ++GYS+G PC+L++MN+I G++P       P            + +GEIQ+FP +        FD  +YPY G+     Y SP+VAV+F  ++ +T + V+C+ 
Sbjct:   78 LWNAETKEFMGRSGKSWSLILLFYAALYAFLAAMFGGCLFCLMWSIS----PYHPTYNDRV-MPPGMTMAPHLEGHE---IAFNASDRKSWKKYARSMDEFLRPYNDG-AQDRKNIRCTHDAYFMQDDLEESAERKACQFKRSWLGDCSGLQDPHYGYSQGRPCILLRMNRILGYLP---GQGKPINVTCAVKKGPAETLGEIQFFPRS-------IFDLKYYPYYGKLRHVNYSSPVVAVRFAGVQYDTHIQVQCKL 316          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Match: SMESG000071416.1 (SMESG000071416.1)

HSP 1 Score: 598.201 bits (1541), Expect = 0.000e+0
Identity = 289/291 (99.31%), Postives = 290/291 (99.66%), Query Frame = 1
Query:   22 MSNYINFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 894
            MSNYINFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLK+DKNFAICNMTSKVPDNVDKICRFNLTMLEDCN KNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD
Sbjct:    1 MSNYINFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKEDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNNKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 291          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Match: SMESG000061672.1 (SMESG000061672.1)

HSP 1 Score: 224.172 bits (570), Expect = 6.601e-72
Identity = 114/267 (42.70%), Postives = 159/267 (59.55%), Query Frame = 1
Query:  106 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNS---SPTIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 894
            Y+S +K FLGR+K  W K   F+FI    +   F+ M  +F EG++  D+P RTG +S+LK  P L  RP+ D  T LIR++  +P +Y  Y   MR  +  YED  L  + ++A C    K PD++ K CRFN+  L+ C K+ NFGY +  PCVLIKMN+IFGW+PD  ++S      IKC GQN  D +N   ++Y+PN   N    GY    +YPY+ Q GY  P+V V+F   KKN L+M+ C  +N+  +S  L FEIL+D
Sbjct:    3 YDSANKKFLGRSKIDWVKFLAFFFICLILMIIIFIGMFFLFTEGVINEDVPYRTGLNSILKNIPNLSFRPVIDFKTALIRYSDADPSTYMLYIQSMRALVQTYEDADLISEDSYATCIDGKKTPDDITKPCRFNILQLDRCIKQYNFGYDRTKPCVLIKMNRIFGWLPDIANSSFSKDILIKCAGQNAEDVENFNTVRYYPNVTINGVVYGYMSSLYYPYLVQYGYRQPLVGVEFDRPKKNVLLMITCHIVNLLTKSAPLTFEILID 269          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Match: SMESG000061673.1 (SMESG000061673.1)

HSP 1 Score: 222.631 bits (566), Expect = 6.999e-71
Identity = 112/269 (41.64%), Postives = 163/269 (60.59%), Query Frame = 1
Query:  106 YNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTDNSSPT---IKCFGQNLIDKDNIGEIQYFPN---NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 894
            YN     +LGRT + W K  + + +   SL A F+ M  +F EG++  D P RTG HS L+  P L  RP+ D  T LIR+A ++P +Y  Y   MRTF+  YED  L  + ++A C    K PD++++ CRFN+  L+ C K+ NFGY +  PCV +K+NK++GW+PD T++S      + C GQNL D +    I Y+PN   NGN    GYF + +YPY+ Q GY  PI+A++    KKN ++M++C+ +N+   +D L FEILVD
Sbjct:   33 YNKNENKYLGRTPNDWGKFILLFLMLVGSLIAIFVGMFFMFTEGVIDEDRPFRTGSHSALQNIPSLSFRPVIDFKTALIRYADSDPSTYMGYIQSMRTFIQTYEDADLISEDSYATCIDGKKTPDDINRPCRFNILQLDRCIKQYNFGYDRTKPCVFLKLNKVYGWVPDVTNSSVSKDVLVTCGGQNLEDIEYFPNILYYPNVTVNGNIY--GYFSNLYYPYLVQYGYRQPIIALEINQPKKNVVLMIRCRIINLLTPTDPLTFEILVD 299          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Match: SMESG000064593.1 (SMESG000064593.1)

HSP 1 Score: 158.303 bits (399), Expect = 3.953e-46
Identity = 97/297 (32.66%), Postives = 157/297 (52.86%), Query Frame = 1
Query:   22 MSNYINFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAIN-EPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMT-SKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD---NSSPTIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD 894
            MS+Y     D      + ++CQ  +   YN++  T  GRT  SW  I +FY I+Y  L+ FF+ M+ VF+ G V    P RTG++S+L   PG+   P   + + LI  + N + + YK+Y      FL  Y    +   K    CN T  + P N+ K C+F+L++L  C         KG  CV ++ NKI+GW+P   +   ++   I+C GQN  D +N+G+ +++P+   N+   G   + FYP++ Q  Y SP+VAVQF  + KN  ++V+C   N+      ++FE+++ 
Sbjct:    1 MSSYHKAKTDEFDTTSEKNKCQKCLTNLYNNKKGTICGRTPKSWGLICVFYLIFYSCLSGFFLGMISVFMYGFVSKMEPMRTGRNSILTFTPGVNANPRSTNESALIVGSTNKDSKLYKNYLKMANEFLKKYTLNPVDGVK----CNETVDQTPKNLTKFCKFDLSLLGPCANP-EAELDKGLLCVYVRPNKIYGWLPQIENPNLSNDILIECDGQNPGDTNNLGKPKFYPSYTNNTKTYGRIPNMFYPFVMQRNYSSPMVAVQFPEMVKNLAILVQCSLKNLINSYKPVRFEVMLQ 292          
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Match: SMESG000064592.1 (SMESG000064592.1)

HSP 1 Score: 150.599 bits (379), Expect = 4.585e-43
Identity = 91/296 (30.74%), Postives = 148/296 (50.00%), Query Frame = 1
Query:   25 SNYINFDEDIE-KYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIFYFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLPDHTTTLIRFAINEPQSYKSYYMDM--RTFLTPYEDIYLKDDKNFAICNMTSKVPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD---NSSPTIKCFGQNLIDKDNIGEIQYFPN-NGNSSNGGYFDHNFYPYIGQPGYLSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILV 891
            + YI   ED E K + KP++ Q  +   YN R+    GRT  +WC++ +++  +Y  LTAFF +M+ +F+  ++    P RTG +S+L   PG+   P     + LI    NE     + Y+    + FL  + D+    + +  +     + P N+   C FN TML  C          G  CV IK+NKI+GW+P   D   ++   + C GQ   D +N+G+  Y+P     +   G   + ++P+  Q  Y SP VA+QF  + KN  +M++C   N+K     +KFEI++
Sbjct:    3 TKYIRAKEDEEEKVKIKPNKFQKKLNFLYNRRTGHICGRTGLNWCQLILYFICFYIVLTAFFFAMIYIFMNKIISPKTPFRTGTNSILTFTPGINANPRMSIESGLILATSNESNPIFTKYLSAVNKFFLKTFPDL---QNSSAGLNCSDDRTPTNISNFCIFNKTMLGPCADPEK-ELKSGKLCVYIKVNKIYGWLPMIVDPNVSNETFVHCDGQGKPDANNLGKPVYYPEIKTENITYGVIPNLYFPFTNQKNYYSPTVAIQFPEMSKNVAIMIQCSLRNIKNSYKPIKFEIML 294          
The following BLAST results are available for this feature:
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ATP1B14.067e-3834.56ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
ATP1B14.067e-3834.56ATPase Na+/K+ transporting subunit beta 1 [Source:... [more]
ATP1B31.373e-3534.84ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
ATP1B21.153e-3229.43ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
ATP1B41.295e-2630.07ATPase Na+/K+ transporting family member beta 4 [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nkb-11.936e-5132.88Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-11.936e-5132.88Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-11.936e-5132.88Sodium/potassium-transporting ATPase subunit beta-... [more]
nkb-37.623e-4731.67Probable sodium/potassium-transporting ATPase subu... [more]
nkb-37.906e-4731.67Probable sodium/potassium-transporting ATPase subu... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrv22.622e-4431.15gene:FBgn0015777 transcript:FBtr0079382[more]
nrv22.622e-4431.15gene:FBgn0015777 transcript:FBtr0079383[more]
nrv22.622e-4431.15gene:FBgn0015777 transcript:FBtr0100381[more]
nrv14.256e-4332.35gene:FBgn0015776 transcript:FBtr0332370[more]
nrv14.256e-4332.35gene:FBgn0015776 transcript:FBtr0079384[more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2a1.517e-3635.56ATPase Na+/K+ transporting subunit beta 2a [Source... [more]
atp1b2b1.014e-3130.97ATPase Na+/K+ transporting subunit beta 2b [Source... [more]
atp1b2b1.014e-3130.97ATPase Na+/K+ transporting subunit beta 2b [Source... [more]
atp1b3a9.817e-3029.07ATPase Na+/K+ transporting subunit beta 3a [Source... [more]
atp1b47.291e-2929.84ATPase Na+/K+ transporting subunit beta 4 [Source:... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b31.632e-3032.22ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
fam151a1.794e-3033.21family with sequence similarity 151 member A [Sour... [more]
tpst22.556e-2931.73tyrosylprotein sulfotransferase 2 [Source:Xenbase;... [more]
atp1b31.135e-2530.34ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
ATP1B41.174e-2329.67pyrimidine-specific ribonucleoside hydrolase rihA ... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Atp1b14.249e-3935.27ATPase, Na+/K+ transporting, beta 1 polypeptide [S... [more]
Atp1b26.424e-3329.79ATPase, Na+/K+ transporting, beta 2 polypeptide [S... [more]
Atp1b39.497e-3332.97ATPase, Na+/K+ transporting, beta 3 polypeptide [S... [more]
Atp1b42.869e-2428.83ATPase, (Na+)/K+ transporting, beta 4 polypeptide ... [more]
Atp4b3.229e-2325.90ATPase, H+/K+ exchanging, beta polypeptide [Source... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q93235|AT1B1_CAEEL2.463e-5032.88Sodium/potassium-transporting ATPase subunit beta-... [more]
sp|P25169|AT1B1_ARTSF3.932e-4733.33Sodium/potassium-transporting ATPase subunit beta ... [more]
sp|Q9XUY5|AT1B3_CAEEL1.006e-4531.67Probable sodium/potassium-transporting ATPase subu... [more]
sp|A8X4W9|AT1B3_CAEBR4.173e-4531.08Probable sodium/potassium-transporting ATPase subu... [more]
sp|Q24046|ATPB1_DROME4.266e-4232.35Sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A564YRD52.798e-7643.17Uncharacterized protein OS=Hymenolepis diminuta OX... [more]
A0A068XXJ47.208e-7641.73Sodium:potassium dependent atpase beta subunit OS=... [more]
U6JI807.287e-7641.73Sodium/potassium-transporting ATPase subunit beta-... [more]
A0A267GYP41.987e-7541.55Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267DGL62.393e-7541.55Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2b2.282e-3731.62sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2b4.520e-3631.07sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b2a2.310e-3533.33sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b3b1.348e-3233.09sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b1b1.851e-3031.27sodium/potassium-transporting ATPase subunit beta-... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSPMAT00000005979.11.395e-2530.83pep scaffold:Pmarinus_7.0:GL479225:261160:295076:-... [more]
ENSPMAT00000005895.16.494e-1324.72pep scaffold:Pmarinus_7.0:GL479457:3011:19118:1 ge... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO323203.405e-2728.99Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
atp1b2b1.593e-3934.10ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
atp1b2b6.301e-3632.68ATPase Na+/K+ transporting subunit beta 2 [Source:... [more]
atp1b1b2.141e-2830.77sodium/potassium-transporting ATPase subunit beta-... [more]
atp1b3a4.259e-2831.15ATPase Na+/K+ transporting subunit beta 3 [Source:... [more]
atp1b43.435e-2329.84ATPase Na+/K+ transporting family member beta 4 [S... [more]
back to top
BLAST of Sodium/potassium-transporting ATPase subunit beta-2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000071416.10.000e+099.31SMESG000071416.1[more]
SMESG000061672.16.601e-7242.70SMESG000061672.1[more]
SMESG000061673.16.999e-7141.64SMESG000061673.1[more]
SMESG000064593.13.953e-4632.66SMESG000064593.1[more]
SMESG000064592.14.585e-4330.74SMESG000064592.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023733 ID=SMED30023733|Name=Sodium/potassium-transporting ATPase subunit beta-2|organism=Schmidtea mediterranea sexual|type=transcript|length=971bp
CAAAATTTATAATAAATCAAAATGTCAAATTATATCAATTTTGATGAAGA
TATAGAAAAATATGAATGTAAACCAAGTCGTTGTCAATCATTTATAGAAG
GATTTTATAATTCAAGAAGCAAAACATTTTTAGGAAGAACAAAGAGTAGT
TGGTGTAAAATTGGAATTTTTTATTTTATTTATTATTGCTCATTAACGGC
CTTTTTCATGTCCATGATGCTTGTTTTTCTCGAAGGTTTAGTTGGAAATG
ATATACCCAGAAGAACTGGTCAGCACAGCTTGCTCAAATTAGAACCTGGT
CTTGGCATGAGACCACTTCCAGACCATACTACAACTCTTATTCGATTCGC
TATAAATGAACCTCAATCTTACAAGAGTTATTATATGGATATGCGTACTT
TTCTAACACCATACGAAGATATTTATCTCAAAGATGACAAAAACTTTGCG
ATTTGTAACATGACATCAAAGGTACCAGATAATGTGGATAAAATATGCCG
ATTTAATCTGACAATGCTTGAGGATTGCAACAAAAAAAATAATTTTGGAT
ATTCAAAAGGAAATCCTTGTGTGTTGATTAAGATGAATAAAATATTTGGA
TGGATTCCTGATACGACTGACAATTCAAGCCCCACAATAAAATGTTTTGG
ACAAAATCTAATTGACAAGGATAATATTGGTGAAATACAATATTTTCCAA
ACAACGGAAATAGCTCGAATGGTGGCTACTTTGATCATAACTTTTATCCG
TATATCGGTCAACCTGGTTATTTATCACCGATTGTTGCCGTTCAATTCAT
GACTCTTAAAAAGAATACCCTCGTTATGGTGAAATGTCAATTTATGAACA
TGAAATTTGAAAGTGATTTACTCAAATTCGAAATACTTGTGGATTAATGC
ATTAACCGCTCCATTACAAAAAAAAACGATAAAAAAATAATAATAACAAT
AATAGTATATTTACATTTATC
back to top

protein sequence of SMED30023733-orf-1

>SMED30023733-orf-1 ID=SMED30023733-orf-1|Name=SMED30023733-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=292bp
MSNYINFDEDIEKYECKPSRCQSFIEGFYNSRSKTFLGRTKSSWCKIGIF
YFIYYCSLTAFFMSMMLVFLEGLVGNDIPRRTGQHSLLKLEPGLGMRPLP
DHTTTLIRFAINEPQSYKSYYMDMRTFLTPYEDIYLKDDKNFAICNMTSK
VPDNVDKICRFNLTMLEDCNKKNNFGYSKGNPCVLIKMNKIFGWIPDTTD
NSSPTIKCFGQNLIDKDNIGEIQYFPNNGNSSNGGYFDHNFYPYIGQPGY
LSPIVAVQFMTLKKNTLVMVKCQFMNMKFESDLLKFEILVD*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000017photoreceptor neuron
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000418head
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR038702Na/K_ATPase_sub_beta_sf
IPR000402Na/K_ATPase_sub_beta
Vocabulary: biological process
TermDefinition
GO:0006814sodium ion transport
GO:0006813potassium ion transport
Vocabulary: cellular component
TermDefinition
GO:0005890sodium:potassium-exchanging ATPase complex
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000402Sodium/potassium-transporting ATPase subunit betaPFAMPF00287Na_K-ATPasecoord: 19..278
e-value: 1.7E-69
score: 234.1
IPR000402Sodium/potassium-transporting ATPase subunit betaPANTHERPTHR11523SODIUM/POTASSIUM-DEPENDENT ATPASE BETA SUBUNITcoord: 19..276
IPR038702Sodium/potassium-transporting ATPase subunit beta superfamilyGENE3DG3DSA:2.60.40.1660coord: 15..290
e-value: 4.7E-77
score: 261.3
NoneNo IPR availableTMHMMTMhelixcoord: 47..69