Peptidase M60 domain-containing protein

Overview
NamePeptidase M60 domain-containing protein
Smed IDSMED30023730
Length (bp)381
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase M60 domain-containing protein (SMED30023730) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase M60 domain-containing protein (SMED30023730) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023730

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail regionSMED30023730h1SMcG0015809 SmedASXL_017337SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
parapharyngeal regionSMED30023730h1SMcG0015809 dd_Smed_v4_11710_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023730h1SMcG0015809 dd_Smed_v4_11710_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
tail regionSMED30023730h1SMcG0015809 dd_Smed_v6_11710_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
tail regionSMED30023730h1SMcG0015809 dd_Smed_v6_14792_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S6KMG4 (Peptidase M60 domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 2.657e-44
Identity = 100/123 (81.30%), Postives = 111/123 (90.24%), Query Frame = 2
Query:    2 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMXXXXXXXXXXXXXMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNXXXXXXXXXXXXXXINGMRPNFIQEI 370
            MSQYLGWGF+KD+FE+Y+TN ISP TDS+KMITFMNI+SIISQQN+IS+FDFWGFPID +L QQLS LPCFFPADDFLV+ S  RKNYISNKYP+CNSKSSFYKDY    FINGMRPNFIQEI
Sbjct:  799 MSQYLGWGFYKDLFEYYDTNNISPSTDSEKMITFMNITSIISQQNMISIFDFWGFPIDNNLSQQLSTLPCFFPADDFLVALSPKRKNYISNKYPQCNSKSSFYKDYSPDLFINGMRPNFIQEI 921          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: A0A1S6KMG0 (Peptidase M60 domain-containing protein OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.076e-10
Identity = 49/123 (39.84%), Postives = 79/123 (64.23%), Query Frame = 2
Query:    2 MSQYLGWGFFKDVFEFYETN-KISPITDSQKMITFMXXXXXXXXXXXXXMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNXXXXXXXXXXXXXXINGMRPNFIQE 367
            M+ + G+GFF   F++Y  + ++   +D +K   + N++S I+ QNL+ +FD W  PI + +R+ LSK  CF P DDF +  S  R+ +I  KYP+C+ KS+FY+D++  S   G RPNFI++
Sbjct:  808 MANHFGFGFFNKAFKYYLNHPELKADSDEEKYDLWANVTSTITNQNLMPIFDLWNIPIGDEMRKYLSKFQCFLP-DDFFLKSSRSREEFILKKYPDCHRKSTFYEDFNPESLTQGHRPNFIKK 929          
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Match: R7UHN9 (Peptidase M60 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_195748 PE=4 SV=1)

HSP 1 Score: 57.3806 bits (137), Expect = 5.510e-7
Identity = 30/78 (38.46%), Postives = 48/78 (61.54%), Query Frame = 2
Query:    2 MSQYLGWGFFKDVFEFYE--TNKISPITDSQKMITFMXXXXXXXXXXXXXMFDFWGFPIDESLRQQLSKLPCFFPADD 229
            ++ +LGWG +K VF  YE  +N+  P TD +K+  ++   +    QNL ++F FWGF I   L++ L++LP F P D+
Sbjct:  600 LAHHLGWGTYKAVFRKYEVMSNEQKPKTDDEKIRLWITTFAECCGQNLCALFRFWGFTIPNDLQRNLAELPLFLPMDE 677          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042170.1 (SMESG000042170.1)

HSP 1 Score: 193.356 bits (490), Expect = 2.534e-58
Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 2
Query:    2 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMXXXXXXXXXXXXXMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNXXXXXXXXXXXXXXINGMRPNFIQEI 370
            MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQEI
Sbjct:  800 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQEI 922          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042170.1 (SMESG000042170.1)

HSP 1 Score: 193.356 bits (490), Expect = 2.601e-58
Identity = 123/123 (100.00%), Postives = 123/123 (100.00%), Query Frame = 2
Query:    2 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMXXXXXXXXXXXXXMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNXXXXXXXXXXXXXXINGMRPNFIQEI 370
            MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQEI
Sbjct:  797 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQEI 919          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042174.1 (SMESG000042174.1)

HSP 1 Score: 191.815 bits (486), Expect = 1.196e-57
Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 2
Query:    2 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMXXXXXXXXXXXXXMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNXXXXXXXXXXXXXXINGMRPNFIQEI 370
            MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVS SLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQEI
Sbjct:  800 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSLSLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQEI 922          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042174.1 (SMESG000042174.1)

HSP 1 Score: 191.43 bits (485), Expect = 1.241e-57
Identity = 122/123 (99.19%), Postives = 122/123 (99.19%), Query Frame = 2
Query:    2 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMXXXXXXXXXXXXXMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNXXXXXXXXXXXXXXINGMRPNFIQEI 370
            MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVS SLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQEI
Sbjct:  797 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSLSLIRKNYISNKYPECNSKSSFYKDYDSSSFINGMRPNFIQEI 919          
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Match: SMESG000042235.1 (SMESG000042235.1)

HSP 1 Score: 179.489 bits (454), Expect = 2.241e-53
Identity = 113/123 (91.87%), Postives = 117/123 (95.12%), Query Frame = 2
Query:    2 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMXXXXXXXXXXXXXMFDFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNXXXXXXXXXXXXXXINGMRPNFIQEI 370
            MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESL QQLS LPCFFPADDFLVS SLIRK+YISNKYP+CNSK+SFYKDYD + FI GMRPNFIQEI
Sbjct:  737 MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMFDFWGFPIDESLSQQLSTLPCFFPADDFLVSLSLIRKSYISNKYPKCNSKTSFYKDYDPNPFIKGMRPNFIQEI 859          
The following BLAST results are available for this feature:
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 3
Match NameE-valueIdentityDescription
A0A1S6KMG42.657e-4481.30Peptidase M60 domain-containing protein OS=Schmidt... [more]
A0A1S6KMG01.076e-1039.84Peptidase M60 domain-containing protein OS=Schmidt... [more]
R7UHN95.510e-738.46Peptidase M60 domain-containing protein OS=Capitel... [more]
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M60 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000042170.12.534e-58100.00SMESG000042170.1[more]
SMESG000042170.12.601e-58100.00SMESG000042170.1[more]
SMESG000042174.11.196e-5799.19SMESG000042174.1[more]
SMESG000042174.11.241e-5799.19SMESG000042174.1[more]
SMESG000042235.12.241e-5391.87SMESG000042235.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023730 ID=SMED30023730|Name=Peptidase M60 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=381bp
AATGTCCCAGTATTTAGGTTGGGGTTTTTTTAAAGATGTTTTTGAATTTT
ATGAAACAAACAAAATATCTCCAATAACTGACAGTCAGAAAATGATAACT
TTCATGAACATTTCAAGCATCATATCTCAACAGAATTTGATTTCTATGTT
CGATTTCTGGGGATTTCCTATCGATGAAAGTTTAAGGCAACAATTGTCAA
AGTTGCCTTGTTTTTTCCCTGCTGATGATTTTCTTGTATCGTTCAGTCTA
ATAAGAAAGAATTACATTTCCAACAAATATCCAGAATGCAACAGCAAATC
GTCATTTTACAAAGATTATGATTCAAGTTCCTTCATAAATGGAATGAGAC
CTAATTTCATTCAAGAGATTTAATTGGAAAC
back to top

protein sequence of SMED30023730-orf-1

>SMED30023730-orf-1 ID=SMED30023730-orf-1|Name=SMED30023730-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=124bp
MSQYLGWGFFKDVFEFYETNKISPITDSQKMITFMNISSIISQQNLISMF
DFWGFPIDESLRQQLSKLPCFFPADDFLVSFSLIRKNYISNKYPECNSKS
SFYKDYDSSSFINGMRPNFIQEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000421tail
PLANA:0000484secretory system
PLANA:0003117parapharyngeal cell
Vocabulary: INTERPRO
TermDefinition
IPR042279Pep_M60_3
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR042279Peptidase M60, enhancin-like domain 3GENE3DG3DSA:1.10.390.30coord: 1..76
e-value: 1.6E-11
score: 46.4