Fatty acid hydroxylase domain-containing protein

Overview
NameFatty acid hydroxylase domain-containing protein
Smed IDSMED30023727
Length (bp)1259
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Fatty acid hydroxylase domain-containing protein (SMED30023727) t-SNE clustered cells

Violin plots show distribution of expression levels for Fatty acid hydroxylase domain-containing protein (SMED30023727) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Fatty acid hydroxylase domain-containing protein (SMED30023727) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Fatty acid hydroxylase domain-containing protein (SMED30023727) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023727

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
neuronSMED30023727SMESG000019318.1 dd_Smed_v4_2938_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023727SMESG000019318.1 dd_Smed_v4_2938_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
posterior region of the whole animalSMED30023727SMESG000019318.1 dd_Smed_v4_2938_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023727SMESG000019318.1 dd_Smed_v4_2938_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023727SMESG000019318.1 OX_Smed_1.0.12565ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023727SMESG000019318.1 dd_Smed_v4_2938_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Human
Match: FAXDC2 (fatty acid hydroxylase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:1334])

HSP 1 Score: 287.345 bits (734), Expect = 4.864e-94
Identity = 148/319 (46.39%), Postives = 214/319 (67.08%), Query Frame = 3
Query:  117 KESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFT-YLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKK 1070
             + +  ++ S+R+ AFI+G+ L+ F+A  N++TWHLQ+FWGASG  WQ+ +++   T    ++ + F G + +  + +W +  LLL  D    P F+ +Y+IQ    + +   K+ + ++ V FNQ  I  P   +L   +  WR+      LPTF W LLEL +F L+EEVLFYY+HRLLHHP FYK+IHK HHEWTA +G++ +YAHPIE+ VSN++P+ VGPL+MGSH+++  MWF LA+  T  SH GYH PFLPSPE HD+HHLKF   +GVLGVLD LHGTD +F+ + A++RH+++L   P  +  PD  K+
Sbjct:   14 SKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPC-RRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDSPKR 331          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Human
Match: FAXDC2 (fatty acid hydroxylase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:1334])

HSP 1 Score: 285.419 bits (729), Expect = 1.311e-93
Identity = 147/309 (47.57%), Postives = 209/309 (67.64%), Query Frame = 3
Query:  147 IRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFT-YLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKK 1070
            +R+ AFI+G+ L+ F+A  N++TWHLQ+FWGASG  WQ+ +++   T    ++ + F G + +  + +W +  LLL  D    P F+ +Y+IQ    + +   K+ + ++ V FNQ  I  P   +L   +  WR+      LPTF W LLEL +F L+EEVLFYY+HRLLHHP FYK+IHK HHEWTA +G++ +YAHPIE+ VSN++P+ VGPL+MGSH+++  MWF LA+  T  SH GYH PFLPSPE HD+HHLKF   +GVLGVLD LHGTD +F+ + A++RH+++L   P  +  PD  K+
Sbjct:    1 MRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPC-RRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDSPKR 308          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Human
Match: MSMO1 (methylsterol monooxygenase 1 [Source:HGNC Symbol;Acc:HGNC:10545])

HSP 1 Score: 108.227 bits (269), Expect = 4.900e-26
Identity = 84/271 (31.00%), Postives = 129/271 (47.60%), Query Frame = 3
Query:  258 QSIFDKFYATMGND--DFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVN--KLLKIVSFNQFCIGIP-------FTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP--------SPEAHDFHHLKFVNNFG-VLGVLDRLHGTDNLFRNSTAFKR 1010
            Q  F   +  M N+   F +  +G+L++   +Y+ + L    F  I    ++K+YKIQ D     P    N  K  K++ FN FCI +P       FT    + Y W        +P + ++L       ++E+   Y+ HRLLHH   YK IHK+HHE+ A  G+   YAHP+E L+       +G +L+  H+   W W  + +  T++ HSGY  P  P            HDFHH+ F+ N+       DR+ GTD+ + N+   KR
Sbjct:   30 QEPFKNAWNYMLNNYTKFQIATWGSLIVHEALYFLFCLPGFLFQFI---PYMKKYKIQKDK----PETWENQWKCFKVLLFNHFCIQLPLICGTYYFTEYFNIPYDWER------MPRWYFLLARCFGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGT-GFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQY-NAYNEKR 285          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Human
Match: FAXDC2 (fatty acid hydroxylase domain containing 2 [Source:HGNC Symbol;Acc:HGNC:1334])

HSP 1 Score: 93.5893 bits (231), Expect = 2.856e-22
Identity = 49/146 (33.56%), Postives = 82/146 (56.16%), Query Frame = 3
Query:  147 IRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPF-TYLSTLIYMWRECSFSGPLPTF 581
            +R+ AFI+G+ L+ F+A  N++TWHLQ+FWGASG  WQ+ +++   T    ++ + F G + +  + +W +  LLL  D    P F+ +Y+IQ    + +   K+ + ++ V FNQ  I  P   +L   +  WR+      LPTF
Sbjct:    1 MRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPC-RRELPTF 145          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Human
Match: MSMO1 (methylsterol monooxygenase 1 [Source:HGNC Symbol;Acc:HGNC:10545])

HSP 1 Score: 88.1965 bits (217), Expect = 4.004e-20
Identity = 50/134 (37.31%), Postives = 71/134 (52.99%), Query Frame = 3
Query:  636 YYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP--------SPEAHDFHHLKFVNNFG-VLGVLDRLHGTDNLFRNSTAFKR 1010
            Y+ HRLLHH   YK IHK+HHE+ A  G+   YAHP+E L+       +G +L+  H+   W W  + +  T++ HSGY  P  P            HDFHH+ F+ N+       DR+ GTD+ + N+   KR
Sbjct:   23 YFLHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGT-GFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQY-NAYNEKR 154          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Celegans
Match: drd-1 (Dietary restriction down regulated [Source:UniProtKB/TrEMBL;Acc:Q20611])

HSP 1 Score: 199.519 bits (506), Expect = 3.666e-61
Identity = 109/272 (40.07%), Postives = 164/272 (60.29%), Query Frame = 3
Query:  258 QSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKS 1073
            ++ + K Y     D   +   G  ++ N+ +W + L  ++ D+I+ P++++ YKIQ +   K P  K     K++  NQF  G   T       +W   SF+GPLP+   +  ++V+ +L EE+ FYY+HRL HHP  YK IHK HHEWTA V +  +Y HP+E+ +SN+ P+ +GP + GSH+ T W+W  +AI +T  SHSGYHFPF+ SPE HD+HH  F   FG  G+LD +HGTD+ FR S   KR+ M  ++ P +Q+ P+  K+ 
Sbjct:    2 EAAYLKIYDYFDGDPLLIYVIGGTVIVNINFWLFNLFFITIDMID-PKWVQPYKIQDE--KKPPLSKYLGAFKVILANQFIAGPLITLFWYFPAVWFGTSFTGPLPSGWQIFRDIVISILCEEIGFYYSHRLFHHPKIYKYIHKKHHEWTAPVSITSIYCHPLEHAISNLSPVLLGPTICGSHVITLWIWASIAILSTTCSHSGYHFPFMLSPEPHDYHHKVFNECFGT-GLLDWIHGTDSTFRKSIEGKRNYMSWSMKPIKQIHPEQQKEE 269          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Celegans
Match: drd-1 (Dietary restriction down regulated [Source:UniProtKB/TrEMBL;Acc:Q20611])

HSP 1 Score: 164.081 bits (414), Expect = 3.206e-48
Identity = 89/220 (40.45%), Postives = 134/220 (60.91%), Query Frame = 3
Query:  258 QSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHH 917
            ++ + K Y     D   +   G  ++ N+ +W + L  ++ D+I+ P++++ YKIQ +   K P  K     K++  NQF  G   T       +W   SF+GPLP+   +  ++V+ +L EE+ FYY+HRL HHP  YK IHK HHEWTA V +  +Y HP+E+ +SN+ P+ +GP + GSH+ T W+W  +AI +T  SHSGYHFPF+ SPE HD+HH
Sbjct:    2 EAAYLKIYDYFDGDPLLIYVIGGTVIVNINFWLFNLFFITIDMID-PKWVQPYKIQDE--KKPPLSKYLGAFKVILANQFIAGPLITLFWYFPAVWFGTSFTGPLPSGWQIFRDIVISILCEEIGFYYSHRLFHHPKIYKYIHKKHHEWTAPVSITSIYCHPLEHAISNLSPVLLGPTICGSHVITLWIWASIAILSTTCSHSGYHFPFMLSPEPHDYHH 218          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Celegans
Match: F49E12.10 (pep chromosome:WBcel235:II:8391088:8392281:1 gene:WBGene00009903.1 transcript:F49E12.10.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F49E12.10)

HSP 1 Score: 159.458 bits (402), Expect = 1.254e-45
Identity = 95/268 (35.45%), Postives = 144/268 (53.73%), Query Frame = 3
Query:  258 QSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDD 1061
            Q ++ + Y     D++ +       +  + +W Y L  +  D +  P++++ YKIQ +   K    K   +LK+V  NQ  +    T L   +  W    F   +P++  +L +  + + ++E+ FYYTHRL HHP  YK IHK HHEW A V +  +YAHP+E+ +SN+ PI +G +L   H+ + +++   AI  T   HSGYHFPF+ S E HDFHH  F   +G  G LD LHGTD  FR S    R  +     P ++L P+D
Sbjct:    3 QELYTRLYNYFDGDEYMLYVVVGNAVAGISFWLYNLFFIIID-VTDPKWVQPYKIQEEK--KPSLSKYLSILKVVGPNQLIVTPIVTTLWFYVARWWGMDFGPVIPSWYILLRDACLCMAMDEIGFYYTHRLFHHPKLYKHIHKKHHEWNAPVSISSIYAHPLEHAISNLSPIYLGAVLFRCHVVSHYIFTSYAILTTTFHHSGYHFPFMLSAEHHDFHHKVFNECYG-FGPLDWLHGTDKTFRKSIEHPRDYVYYGTTPIKELIPED 266          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Celegans
Match: F35C8.5 (Cholesterol 25-hydroxylase-like protein [Source:UniProtKB/Swiss-Prot;Acc:Q20027])

HSP 1 Score: 57.3806 bits (137), Expect = 5.750e-9
Identity = 61/206 (29.61%), Postives = 90/206 (43.69%), Query Frame = 3
Query:  384 LINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHH-PLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFP--------FLPSPEAHDFHHLKFVNNFGV-LGVLDRLHG 971
            L N P F K  KIQ D   K+  D + K LK+  +NQ     P   L  LI++  +       PT   +L +L +F L  +  +++ H + H     Y+  H +HH +++       + HP E        I   P +  +H  T W+WF +A + +   H GY FP        F     AHD HHL+ +  F      LDRL G
Sbjct:   67 LCNVP-FFKDAKIQKDR--KVTWDLIKKSLKLQGWNQLLWIYPMA-LVQLIWV-PDTELPILAPTVFEMLSQLAIFFLAFDFTYFWFHYINHKVKWLYRWCHSVHHMYSSPFAASAQHLHPFELFFVGTF-ITTIPWIFPTHCLTYWIWFFIAQSVSYEVHIGYDFPFALHRIFWFYSGAPAHDMHHLRPLTCFQPWFNYLDRLMG 266          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Fly
Match: CG1998 (gene:FBgn0030485 transcript:FBtr0073787)

HSP 1 Score: 319.316 bits (817), Expect = 8.068e-106
Identity = 167/311 (53.70%), Postives = 207/311 (66.56%), Query Frame = 3
Query:  138 FDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKK 1070
              S+    FII   L  FI  RN LTWHLQ FWGASG+ WQS +DKF  + G++   +  FGT + T +VYW  G L    DL N P  L++YKIQP   + +   ++ K++  V  NQ  +GIP  Y S  +   R  S    LPTF WV  EL V +L+EE+ FYY+HRLLHH   YK IHK HHEWTA + +  +Y HPIE++ SN++P  +G  LMGSH+ATAW+WF LAI +TLN+HSGYH PF PSPEAHDFHHLKF N FGVLGVLDRLHGTD+LFR + ++ RHIMML+  PPR  FPD   K
Sbjct:   96 LSSLHSVIFIITCALAAFILFRNVLTWHLQSFWGASGDFWQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQPGTNEPVEVRRLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLSDIRDLPTFHWVCFELTVCILMEELGFYYSHRLLHHKHIYKYIHKQHHEWTAPISVTAIYCHPIEHIFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGYHLPFFPSPEAHDFHHLKFNNCFGVLGVLDRLHGTDSLFRATKSYARHIMMLSFKPPRDAFPDPTMK 406          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Fly
Match: CG1998 (gene:FBgn0030485 transcript:FBtr0343148)

HSP 1 Score: 319.316 bits (817), Expect = 8.068e-106
Identity = 167/311 (53.70%), Postives = 207/311 (66.56%), Query Frame = 3
Query:  138 FDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKK 1070
              S+    FII   L  FI  RN LTWHLQ FWGASG+ WQS +DKF  + G++   +  FGT + T +VYW  G L    DL N P  L++YKIQP   + +   ++ K++  V  NQ  +GIP  Y S  +   R  S    LPTF WV  EL V +L+EE+ FYY+HRLLHH   YK IHK HHEWTA + +  +Y HPIE++ SN++P  +G  LMGSH+ATAW+WF LAI +TLN+HSGYH PF PSPEAHDFHHLKF N FGVLGVLDRLHGTD+LFR + ++ RHIMML+  PPR  FPD   K
Sbjct:   96 LSSLHSVIFIITCALAAFILFRNVLTWHLQSFWGASGDFWQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQPGTNEPVEVRRLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLSDIRDLPTFHWVCFELTVCILMEELGFYYSHRLLHHKHIYKYIHKQHHEWTAPISVTAIYCHPIEHIFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGYHLPFFPSPEAHDFHHLKFNNCFGVLGVLDRLHGTDSLFRATKSYARHIMMLSFKPPRDAFPDPTMK 406          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Fly
Match: CG1998 (gene:FBgn0030485 transcript:FBtr0301560)

HSP 1 Score: 299.286 bits (765), Expect = 1.808e-99
Identity = 155/284 (54.58%), Postives = 194/284 (68.31%), Query Frame = 3
Query:  219 HLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKK 1070
            HLQ FWGASG+ WQS +DKF  + G++   +  FGT + T +VYW  G L    DL N P  L++YKIQP   + +   ++ K++  V  NQ  +GIP  Y S  +   R  S    LPTF WV  EL V +L+EE+ FYY+HRLLHH   YK IHK HHEWTA + +  +Y HPIE++ SN++P  +G  LMGSH+ATAW+WF LAI +TLN+HSGYH PF PSPEAHDFHHLKF N FGVLGVLDRLHGTD+LFR + ++ RHIMML+  PPR  FPD   K
Sbjct:   15 HLQSFWGASGDFWQSQWDKFIDSFGDEPMVLWVFGTTIFTMLVYWTVGTLYTFMDLTNRPACLRKYKIQPGTNEPVEVRRLLKVIWCVVCNQIFVGIPLAYASYRLMEIRGLSDIRDLPTFHWVCFELTVCILMEELGFYYSHRLLHHKHIYKYIHKQHHEWTAPISVTAIYCHPIEHIFSNLLPPFLGVFLMGSHVATAWLWFALAILSTLNAHSGYHLPFFPSPEAHDFHHLKFNNCFGVLGVLDRLHGTDSLFRATKSYARHIMMLSFKPPRDAFPDPTMK 298          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Fly
Match: CG11162 (gene:FBgn0030509 transcript:FBtr0073811)

HSP 1 Score: 172.94 bits (437), Expect = 8.705e-51
Identity = 99/249 (39.76%), Postives = 155/249 (62.25%), Query Frame = 3
Query:  234 WGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLS-TLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP-SPEAHDFHHLKFVNNFGVLGVLDRLHGT 974
            W  SG+  Q  +     T+G + + +   G+ ++  +VYW Y  +    D+ N P+FL++YKIQP   + +   K+   +K+V FN   +    +++    +Y          LPTF+  L +LVVFV+LEE++FYY HRLLHH   YK +HK HHEWTA +  + +YAHP+E++++N++P+A    ++G+H+A A++ F LAI N+++ H+GY FP+   S   HD+HH KF  N+GVLG LD+LHGT
Sbjct:    8 WTQSGDYLQDKWTLLLDTVGEESWRLWVVGSTVVIFIVYWLYAGIFTLMDITNRPRFLRKYKIQPGQNEPVNLAKLWHAVKVVLFNLTVVNFLVSWVVYEFVYKSENSQDIRVLPTFKRSLRDLVVFVVLEEIMFYYAHRLLHHRSVYKYVHKKHHEWTAPIAAITLYAHPVEHVLANLLPVATSIAILGTHVALAYVIFALAIINSMSDHTGYSFPWSAGSVRFHDYHHAKFNYNYGVLGFLDKLHGT 256          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Zebrafish
Match: faxdc2 (fatty acid hydroxylase domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2907])

HSP 1 Score: 307.375 bits (786), Expect = 3.526e-102
Identity = 155/321 (48.29%), Postives = 216/321 (67.29%), Query Frame = 3
Query:  111 VVKESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKS 1073
            +  ES   ++DS+RKAAF+IG+ L   I  RN++TWHLQ+FWGASG+ WQ+ + + +  MG +   + F GT+L+  + +W +  LL+  D+   P F+ +Y+IQ D    +   ++   +K V FNQ C+  P   L+  +   R       LPTF WVLLEL    L+EE+LFYYTHRL+HHP  YK IHK+HHEWTA VG+V +YAHP+E+++SN++P  +GPLL+GSH++T  +WF +A+  T  SH GYH P LPSPE HD+HHLKF   +GVLGVLDRLHGTD  FRNS A++RH ++L L P  +  P+  KK+
Sbjct:    1 MATESSGGVWDSLRKAAFVIGSGLFFLIGFRNSVTWHLQRFWGASGDFWQTQWSRIHQAMGGNQTALFFIGTMLVPTLSFWLFNALLMLVDVTGKPNFITRYRIQTDKNSPVDTGRLWHAVKTVLFNQVCLSGPVVALTYQLMRLRGDPCGPELPTFHWVLLELAFCGLMEEILFYYTHRLVHHPSLYKSIHKIHHEWTAPVGVVALYAHPVEHVLSNMLPALIGPLLLGSHVSTTSLWFTIALLVTTVSHCGYHLPLLPSPEFHDYHHLKFNQCYGVLGVLDRLHGTDEKFRNSRAYERHTVLLGLTPLSESIPEHSKKT 321          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Zebrafish
Match: faxdc2 (fatty acid hydroxylase domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2907])

HSP 1 Score: 306.99 bits (785), Expect = 5.390e-102
Identity = 155/318 (48.74%), Postives = 215/318 (67.61%), Query Frame = 3
Query:  120 ESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKS 1073
            ES   ++DS+RKAAF+IG+ L   I  RN++TWHLQ+FWGASG+ WQ+ + + +  MG +   + F GT+L+  + +W +  LL+  D+   P F+ +Y+IQ D    +   ++   +K V FNQ C+  P   L+  +   R       LPTF WVLLEL    L+EE+LFYYTHRL+HHP  YK IHK+HHEWTA VG+V +YAHP+E+++SN++P  +GPLL+GSH++T  +WF +A+  T  SH GYH P LPSPE HD+HHLKF   +GVLGVLDRLHGTD  FRNS A++RH ++L L P  +  P+  KK+
Sbjct:    8 ESSGGVWDSLRKAAFVIGSGLFFLIGFRNSVTWHLQRFWGASGDFWQTQWSRIHQAMGGNQTALFFIGTMLVPTLSFWLFNALLMLVDVTGKPNFITRYRIQTDKNSPVDTGRLWHAVKTVLFNQVCLSGPVVALTYQLMRLRGDPCGPELPTFHWVLLELAFCGLMEEILFYYTHRLVHHPSLYKSIHKIHHEWTAPVGVVALYAHPVEHVLSNMLPALIGPLLLGSHVSTTSLWFTIALLVTTVSHCGYHLPLLPSPEFHDYHHLKFNQCYGVLGVLDRLHGTDEKFRNSRAYERHTVLLGLTPLSESIPEHSKKT 325          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Zebrafish
Match: msmo1 (methylsterol monooxygenase 1 [Source:NCBI gene;Acc:406662])

HSP 1 Score: 107.842 bits (268), Expect = 4.089e-26
Identity = 76/246 (30.89%), Postives = 123/246 (50.00%), Query Frame = 3
Query:  303 FYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIP-------FTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP--------SPEAHDFHHLKFVNNFG-VLGVLDRLHGTDNLFRN 992
            F +  +G+L++  ++Y+ + L    F  +    F+++YKIQPD  +    +K  K  K++ FN FCI +P       FT   ++ Y W        +P + ++L +     ++E+   Y+ HR LHH   YK IHK+HH++T+  G+   YAHP+E L+       +G ++  +H+   W W    +  T++ HSGY  P  P            HDFHH+ FV N+G      DRL  TD+ F  
Sbjct:   47 FQIATWGSLIVHELIYFLFCLPGFIFQFL---PFMQKYKIQPDKPET--WEKQWKCFKMLLFNHFCIQLPLICGTYYFTEFFSIPYDWET------MPRWPFLLAQCFGCAVIEDTWHYFLHRALHHRRIYKYIHKVHHDFTSPFGMQAEYAHPLETLILGA-GFFIGIMVFCNHMILLWAWVTFRLLETIDVHSGYDIPLNPLHLIPFYAGARFHDFHHMNFVGNYGSTFTWWDRLFDTDSQFNK 280          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Zebrafish
Match: msmo1 (methylsterol monooxygenase 1 [Source:NCBI gene;Acc:406662])

HSP 1 Score: 107.842 bits (268), Expect = 4.089e-26
Identity = 76/246 (30.89%), Postives = 123/246 (50.00%), Query Frame = 3
Query:  303 FYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIP-------FTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP--------SPEAHDFHHLKFVNNFG-VLGVLDRLHGTDNLFRN 992
            F +  +G+L++  ++Y+ + L    F  +    F+++YKIQPD  +    +K  K  K++ FN FCI +P       FT   ++ Y W        +P + ++L +     ++E+   Y+ HR LHH   YK IHK+HH++T+  G+   YAHP+E L+       +G ++  +H+   W W    +  T++ HSGY  P  P            HDFHH+ FV N+G      DRL  TD+ F  
Sbjct:   47 FQIATWGSLIVHELIYFLFCLPGFIFQFL---PFMQKYKIQPDKPET--WEKQWKCFKMLLFNHFCIQLPLICGTYYFTEFFSIPYDWET------MPRWPFLLAQCFGCAVIEDTWHYFLHRALHHRRIYKYIHKVHHDFTSPFGMQAEYAHPLETLILGA-GFFIGIMVFCNHMILLWAWVTFRLLETIDVHSGYDIPLNPLHLIPFYAGARFHDFHHMNFVGNYGSTFTWWDRLFDTDSQFNK 280          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Zebrafish
Match: msmo1 (methylsterol monooxygenase 1 [Source:NCBI gene;Acc:406662])

HSP 1 Score: 107.457 bits (267), Expect = 5.917e-26
Identity = 76/246 (30.89%), Postives = 123/246 (50.00%), Query Frame = 3
Query:  303 FYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIP-------FTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP--------SPEAHDFHHLKFVNNFG-VLGVLDRLHGTDNLFRN 992
            F +  +G+L++  ++Y+ + L    F  +    F+++YKIQPD  +    +K  K  K++ FN FCI +P       FT   ++ Y W        +P + ++L +     ++E+   Y+ HR LHH   YK IHK+HH++T+  G+   YAHP+E L+       +G ++  +H+   W W    +  T++ HSGY  P  P            HDFHH+ FV N+G      DRL  TD+ F  
Sbjct:   47 FQIATWGSLIVHELIYFLFCLPGFIFQFL---PFMQKYKIQPDKPET--WEKQWKCFKMLLFNHFCIQLPLICGTYYFTEFFSIPYDWDT------MPRWPFLLAQCFGCAVIEDTWHYFLHRALHHRRIYKYIHKVHHDFTSPFGMQAEYAHPLETLILGA-GFFIGIMVFCNHMILLWAWVTFRLLETIDVHSGYDIPLNPLHLIPFYAGARFHDFHHMNFVGNYGSTFTWWDRLFDTDSQFNK 280          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Xenopus
Match: FAXDC2 (fatty acid hydroxylase domain containing 2 [Source:NCBI gene;Acc:100496051])

HSP 1 Score: 311.997 bits (798), Expect = 1.141e-103
Identity = 159/319 (49.84%), Postives = 217/319 (68.03%), Query Frame = 3
Query:  117 KESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKS 1073
            +    +++DS++K AF++GT L+ F A RN++TWHLQQFWGASG+ WQ+ + K +     +   +   GT+L+  + +W +  +L+  DL   P F+ +Y+IQP   D +   K+ + +  V  NQ  +  P   L   I +WR       LPTF WVLLEL VF L+EE+LFYY+HRL+HHPL YKRIHK HHEWTA VG+V +YAHP+E++ SN++P  VGP++MGSH+AT  +WFCLA+  T  SH GYH PFLPSPE HDFHHLKF   +GVLGVLD LHGTD +F+ + A++RHI+++ L P  Q  PD  KKS
Sbjct:   16 RSQDGQVWDSVKKTAFVLGTGLLIFAAFRNSVTWHLQQFWGASGDFWQAQWGKLHTFFDGNQLALFCLGTMLMPTLSFWVFNAMLMLIDLTGKPYFITKYRIQPGKNDPVDPAKLRQAVITVLANQVFLSFPMIVLMYPIMLWRGNPCGPELPTFHWVLLELTVFALVEEILFYYSHRLVHHPLLYKRIHKKHHEWTAPVGVVCLYAHPLEHIFSNMLPSMVGPMVMGSHVATTMLWFCLALITTTISHCGYHLPFLPSPEFHDFHHLKFNQCYGVLGVLDHLHGTDLMFKQTKAYERHILLMNLTPLSQSIPDTPKKS 334          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Xenopus
Match: FAXDC2 (fatty acid hydroxylase domain containing 2 [Source:NCBI gene;Acc:100496051])

HSP 1 Score: 312.383 bits (799), Expect = 5.676e-103
Identity = 159/319 (49.84%), Postives = 217/319 (68.03%), Query Frame = 3
Query:  117 KESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKS 1073
            +    +++DS++K AF++GT L+ F A RN++TWHLQQFWGASG+ WQ+ + K +     +   +   GT+L+  + +W +  +L+  DL   P F+ +Y+IQP   D +   K+ + +  V  NQ  +  P   L   I +WR       LPTF WVLLEL VF L+EE+LFYY+HRL+HHPL YKRIHK HHEWTA VG+V +YAHP+E++ SN++P  VGP++MGSH+AT  +WFCLA+  T  SH GYH PFLPSPE HDFHHLKF   +GVLGVLD LHGTD +F+ + A++RHI+++ L P  Q  PD  KKS
Sbjct:   73 RSQDGQVWDSVKKTAFVLGTGLLIFAAFRNSVTWHLQQFWGASGDFWQAQWGKLHTFFDGNQLALFCLGTMLMPTLSFWVFNAMLMLIDLTGKPYFITKYRIQPGKNDPVDPAKLRQAVITVLANQVFLSFPMIVLMYPIMLWRGNPCGPELPTFHWVLLELTVFALVEEILFYYSHRLVHHPLLYKRIHKKHHEWTAPVGVVCLYAHPLEHIFSNMLPSMVGPMVMGSHVATTMLWFCLALITTTISHCGYHLPFLPSPEFHDFHHLKFNQCYGVLGVLDHLHGTDLMFKQTKAYERHILLMNLTPLSQSIPDTPKKS 391          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Xenopus
Match: nudt22 (nudix hydrolase 22 [Source:Xenbase;Acc:XB-GENE-5961541])

HSP 1 Score: 103.219 bits (256), Expect = 2.304e-24
Identity = 72/246 (29.27%), Postives = 120/246 (48.78%), Query Frame = 3
Query:  303 FYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIP-------FTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYH--------FPFLPSPEAHDFHHLKFVNNFG-VLGVLDRLHGTDNLFRN 992
            F +  +G+LL+  ++Y+ + L    F  +    F+++YKIQ D  +    +   +  K++ FN FCI  P       FT    + Y W        +P +  +  +     ++E+   Y+ HR+LHH   YK IHK+HHE+T+  G+   YAHP+E L+       +G ++  +H+   W W  + +  T++ HSGY         FPF      HDFHH+ FV N+       D++  TD+ + N
Sbjct:   47 FQIATWGSLLVHELIYFLFCLPGFIFQFL---PFMQKYKIQQDKPET--WESQWRCFKMLLFNHFCIQFPLIFGTFHFTEYFNIPYDWES------MPRWYILCAQCFGCAVIEDAWHYFLHRILHHKRIYKYIHKVHHEFTSPFGMQAEYAHPLETLILGA-GFFIGIMVFCNHVVLMWAWVMVRLLETIDVHSGYDIPLNPLHLFPFYAGARFHDFHHMNFVGNYASTFTWWDKILSTDSQYNN 280          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Xenopus
Match: CH25H (cholesterol 25-hydroxylase [Source:NCBI gene;Acc:100494906])

HSP 1 Score: 52.373 bits (124), Expect = 5.146e-7
Identity = 36/110 (32.73%), Postives = 53/110 (48.18%), Query Frame = 3
Query:  648 RLLHH--PLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPF-----LP-----SPEAHDFHHLKFVNNFG 941
             L+HH  P  YK  HK+HH++T++  L   Y+   E L   +    V P+ +G H  T   +F + I  ++  HSGY  P+     +P      P  HD HH KF  N+ 
Sbjct:  136 HLVHHKVPWLYKNFHKMHHKYTSTFALATQYSGAWETLSLGIF-AGVVPMALGCHPMTEMAFFIINIYLSVEDHSGYDLPWSSHKLVPFGLCGGPGHHDLHHQKFNYNYA 244          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Xenopus
Match: SC5D (sterol-C5-desaturase [Source:NCBI gene;Acc:100490845])

HSP 1 Score: 52.373 bits (124), Expect = 5.759e-7
Identity = 39/131 (29.77%), Postives = 61/131 (46.56%), Query Frame = 3
Query:  636 YYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSG-YHFP-----FLPSPEAHDFHHLKFVNNFGVLGVL-DRLHGTDNLFRNSTAFK 1007
            Y+ HR LHH LFYKR HK HH W  +        HP++  + + +P  + P +   H  T    +      T++ H G Y  P      +     H  HHL F  N+G    L D++ G+   ++N ++F+
Sbjct:  135 YWIHRFLHHKLFYKRFHKPHHLWKVTTPFASHAFHPVDGFMQS-LPYHIYPFIFPLHKVTYLGLYVFVNIWTVSIHDGDYRVPKFLEHIINGAAHHTDHHLFFDYNYGQYFTLWDKIGGS---YKNPSSFE 261          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Mouse
Match: Gm12248 (predicted gene 12248 [Source:MGI Symbol;Acc:MGI:3651124])

HSP 1 Score: 254.988 bits (650), Expect = 6.695e-82
Identity = 130/310 (41.94%), Postives = 196/310 (63.23%), Query Frame = 3
Query:  144 SIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKS 1073
            S+R    I G+ L+  +   N++TWHLQ+FW ASG   Q+ ++K  +T    ++ + + G +L+  + +WG   LLL  D    P F+ +Y+IQ    + +   K+ + +  V FNQ  I IP   +      WR    S  LPTF W L+E+  F LL+E+LFYY HRL HHP+ YK+ HK HHEWTA +G+V +YA P E++V+N++P+ VGPL MGSH+++  +W  + +  ++ +H+GYH PFLPSPE HD+HHLK    +GVLG++D LHGTD LF+ + A++RH+++L   P  +  PD  KK+
Sbjct:    1 SMRNTTLIQGSGLLLLLVFWNSVTWHLQRFWDASGYFCQTQWEKLLSTFEGYEWILYYIGVILVPGLCFWGLSGLLLLVDTTEKPTFISRYRIQRGKNEPVDPVKLRQAVLTVLFNQNFISIPMLVIYYPFLKWRRDPCSRELPTFHWFLVEMAFFTLLQEILFYYAHRLFHHPMLYKKSHKKHHEWTAPIGVVSIYADPPEHVVANMLPVLVGPLAMGSHLSSITVWLSMVLIVSIINHTGYHLPFLPSPEFHDYHHLKSNQCYGVLGLMDHLHGTDTLFKQTKAYERHVILLGFTPLSESIPDSPKKT 310          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Mouse
Match: Gm12248 (predicted gene 12248 [Source:MGI Symbol;Acc:MGI:3651124])

HSP 1 Score: 253.832 bits (647), Expect = 2.520e-81
Identity = 129/309 (41.75%), Postives = 195/309 (63.11%), Query Frame = 3
Query:  147 IRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKS 1073
            +R    I G+ L+  +   N++TWHLQ+FW ASG   Q+ ++K  +T    ++ + + G +L+  + +WG   LLL  D    P F+ +Y+IQ    + +   K+ + +  V FNQ  I IP   +      WR    S  LPTF W L+E+  F LL+E+LFYY HRL HHP+ YK+ HK HHEWTA +G+V +YA P E++V+N++P+ VGPL MGSH+++  +W  + +  ++ +H+GYH PFLPSPE HD+HHLK    +GVLG++D LHGTD LF+ + A++RH+++L   P  +  PD  KK+
Sbjct:    1 MRNTTLIQGSGLLLLLVFWNSVTWHLQRFWDASGYFCQTQWEKLLSTFEGYEWILYYIGVILVPGLCFWGLSGLLLLVDTTEKPTFISRYRIQRGKNEPVDPVKLRQAVLTVLFNQNFISIPMLVIYYPFLKWRRDPCSRELPTFHWFLVEMAFFTLLQEILFYYAHRLFHHPMLYKKSHKKHHEWTAPIGVVSIYADPPEHVVANMLPVLVGPLAMGSHLSSITVWLSMVLIVSIINHTGYHLPFLPSPEFHDYHHLKSNQCYGVLGLMDHLHGTDTLFKQTKAYERHVILLGFTPLSESIPDSPKKT 309          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Mouse
Match: Gm12248 (predicted gene 12248 [Source:MGI Symbol;Acc:MGI:3651124])

HSP 1 Score: 240.736 bits (613), Expect = 1.874e-76
Identity = 122/285 (42.81%), Postives = 182/285 (63.86%), Query Frame = 3
Query:  219 HLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKS 1073
            HLQ+FW ASG   Q+ ++K  +T    ++ + + G +L+  + +WG   LLL  D    P F+ +Y+IQ    + +   K+ + +  V FNQ  I IP   +      WR    S  LPTF W L+E+  F LL+E+LFYY HRL HHP+ YK+ HK HHEWTA +G+V +YA P E++V+N++P+ VGPL MGSH+++  +W  + +  ++ +H+GYH PFLPSPE HD+HHLK    +GVLG++D LHGTD LF+ + A++RH+++L   P  +  PD  KK+
Sbjct:    7 HLQRFWDASGYFCQTQWEKLLSTFEGYEWILYYIGVILVPGLCFWGLSGLLLLVDTTEKPTFISRYRIQRGKNEPVDPVKLRQAVLTVLFNQNFISIPMLVIYYPFLKWRRDPCSRELPTFHWFLVEMAFFTLLQEILFYYAHRLFHHPMLYKKSHKKHHEWTAPIGVVSIYADPPEHVVANMLPVLVGPLAMGSHLSSITVWLSMVLIVSIINHTGYHLPFLPSPEFHDYHHLKSNQCYGVLGLMDHLHGTDTLFKQTKAYERHVILLGFTPLSESIPDSPKKT 291          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Mouse
Match: Msmo1 (methylsterol monoxygenase 1 [Source:MGI Symbol;Acc:MGI:1913484])

HSP 1 Score: 101.293 bits (251), Expect = 1.090e-23
Identity = 74/241 (30.71%), Postives = 115/241 (47.72%), Query Frame = 3
Query:  303 FYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIP-------FTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP--------SPEAHDFHHLKFVNNFG-VLGVLDRLHGTD 977
            F +  +G+L++   +Y+ + L    F  I    ++++YKIQ D  +    +   K LK + FN F I +P       FT    + Y W        +P +   L   +   ++E+   Y+ HRLLHH   YK IHK+HHE+ A  G+   YAHP+E L+       +G +L+  H+   W W  + +  T++ HSGY  P  P            HDFHH+ F+ N+       D+L GTD
Sbjct:   47 FQIATWGSLIVHEAIYFLFSLPGFLFQFI---PYMRKYKIQKDKPETF--EGQWKCLKKILFNHFFIQLPLICGTYYFTEFFNIPYDWER------MPRWYLTLARCLGCAVIEDTWHYFLHRLLHHKRIYKYIHKVHHEFQAPFGIEAEYAHPLETLILGT-GFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLVPFYTGARHHDFHHMNFIGNYASTFTWWDKLFGTD 275          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Mouse
Match: Sc5d (sterol-C5-desaturase [Source:MGI Symbol;Acc:MGI:1353611])

HSP 1 Score: 49.2914 bits (116), Expect = 3.840e-6
Identity = 39/131 (29.77%), Postives = 60/131 (45.80%), Query Frame = 3
Query:  636 YYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYH------FPFLPSPEAHDFHHLKFVNNFGVLGVL-DRLHGTDNLFRNSTAFK 1007
            Y+ HR LHH L YKRIHK HH W           HP++  + + +P  + P +   H       + L    T++ H G         PF+     H  HH+ F  N+G    L DR+ G+   F++ ++F+
Sbjct:  135 YWIHRGLHHRLVYKRIHKPHHIWKIPTPFASHAFHPVDGFLQS-LPYHIYPFVFPLHKVVYLGLYVLVNVWTISIHDGDFRVPQILRPFINGSAHHTDHHMFFDYNYGQYFTLWDRIGGS---FKHPSSFE 261          
BLAST of Fatty acid hydroxylase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q96IV6|FXDC2_HUMAN (Fatty acid hydroxylase domain-containing protein 2 OS=Homo sapiens OX=9606 GN=FAXDC2 PE=1 SV=1)

HSP 1 Score: 287.345 bits (734), Expect = 2.336e-93
Identity = 148/319 (46.39%), Postives = 214/319 (67.08%), Query Frame = 3
Query:  117 KESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFT-YLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKK 1070
             + +  ++ S+R+ AFI+G+ L+ F+A  N++TWHLQ+FWGASG  WQ+ +++   T    ++ + F G + +  + +W +  LLL  D    P F+ +Y+IQ    + +   K+ + ++ V FNQ  I  P   +L   +  WR+      LPTF W LLEL +F L+EEVLFYY+HRLLHHP FYK+IHK HHEWTA +G++ +YAHPIE+ VSN++P+ VGPL+MGSH+++  MWF LA+  T  SH GYH PFLPSPE HD+HHLKF   +GVLGVLD LHGTD +F+ + A++RH+++L   P  +  PD  K+
Sbjct:   14 SKQEGHIWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMISFPMVVFLYPFLKWWRDPC-RRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHAVSNMLPVIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYERHVLLLGFTPLSESIPDSPKR 331          
BLAST of Fatty acid hydroxylase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9GKT2|FXDC2_MACFA (Fatty acid hydroxylase domain-containing protein 2 OS=Macaca fascicularis OX=9541 GN=FAXDC2 PE=2 SV=1)

HSP 1 Score: 283.108 bits (723), Expect = 1.325e-91
Identity = 144/312 (46.15%), Postives = 207/312 (66.35%), Query Frame = 3
Query:  135 LFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKK 1070
            ++ S+R+ AFI+G+ L+ F+A  N++TWHLQ+FWGASG  WQ+ +++   T    ++ + F G + +  + +W +  LLL  D    P F+ +Y+IQ    + +   K+ + ++ V FNQ  +  P          W        LPTF W LLEL +F L+EEVLFYY+HRLLHHP FYK+IHK HHEWTA +G++ +YAHPIE++VSN++P  VGPL+MGSH+++  MWF LA+  T  SH GYH PFLPSPE HD+HHLKF   +GVLGVLD LHGTD +F+ + A+++H+++L   P  +  PD  K+
Sbjct:   20 IWGSMRRTAFILGSGLLSFVAFWNSVTWHLQRFWGASGYFWQAQWERLLTTFEGKEWILFFIGAIQVPCLFFWSFNGLLLVVDTTGKPNFISRYRIQVGKNEPVDPVKLRQSIRTVLFNQCMVSFPMVVFLYPFLKWWGDPCRRELPTFHWFLLELAIFTLIEEVLFYYSHRLLHHPTFYKKIHKKHHEWTAPIGVISLYAHPIEHVVSNMLPAIVGPLVMGSHLSSITMWFSLALIITTISHCGYHLPFLPSPEFHDYHHLKFNQCYGVLGVLDHLHGTDTMFKQTKAYEKHVLLLGFTPLSESIPDSPKR 331          
BLAST of Fatty acid hydroxylase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q69L93|GLO18_ORYSJ (Very-long-chain aldehyde decarbonylase GL1-8 OS=Oryza sativa subsp. japonica OX=39947 GN=GL1-8 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 6.726e-26
Identity = 82/250 (32.80%), Postives = 123/250 (49.20%), Query Frame = 3
Query:  297 DDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPS--------PEAHDFHH----LKFVNNFGVLGVLDRLHGTDNLFRNSTAFKR 1010
             +F +   GT LL   V++  GL  L F+ +       +YKIQ  +    P D  N+ +  +     C+ +P T LS   + +     + PLP +  V+ +++ F +LE+ +FY+ HR LH    Y+ +H +HHE+    GL   YAHP E L      +A GP L G H+ T W+W  L +  T+ +HSGYHFP+ PS         E HD+HH     K  N       +D L GTD  +R + A + 
Sbjct:   19 SEFQLASIGTFLLHESVFFLSGLPSLLFERLG---LFSKYKIQKKS--NTP-DYQNRCVVRLVLYHVCVNLPLTILSYRTFKFMGLRSTLPLPHWTVVVSQVLFFFVLEDFIFYWGHRALHTKWLYQHVHSVHHEYATPFGLTSEYAHPAEILFLGFATVA-GPALTGPHLFTLWVWMVLRVLETVEAHSGYHFPWSPSNFLPLYGGAEFHDYHHRVLYTKSGNYSSTFIYMDWLFGTDKDYRKTKALEE 261          
BLAST of Fatty acid hydroxylase domain-containing protein vs. UniProt/SwissProt
Match: sp|B8B6I2|GLO18_ORYSI (Very-long-chain aldehyde decarbonylase GL1-8 OS=Oryza sativa subsp. indica OX=39946 GN=GL18 PE=3 SV=2)

HSP 1 Score: 108.997 bits (271), Expect = 6.726e-26
Identity = 82/250 (32.80%), Postives = 123/250 (49.20%), Query Frame = 3
Query:  297 DDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPS--------PEAHDFHH----LKFVNNFGVLGVLDRLHGTDNLFRNSTAFKR 1010
             +F +   GT LL   V++  GL  L F+ +       +YKIQ  +    P D  N+ +  +     C+ +P T LS   + +     + PLP +  V+ +++ F +LE+ +FY+ HR LH    Y+ +H +HHE+    GL   YAHP E L      +A GP L G H+ T W+W  L +  T+ +HSGYHFP+ PS         E HD+HH     K  N       +D L GTD  +R + A + 
Sbjct:   19 SEFQLASIGTFLLHESVFFLSGLPSLLFERLG---LFSKYKIQKKS--NTP-DYQNRCVVRLVLYHVCVNLPLTILSYRTFKFMGLRSTLPLPHWTVVVSQVLFFFVLEDFIFYWGHRALHTKWLYQHVHSVHHEYATPFGLTSEYAHPAEILFLGFATVA-GPALTGPHLFTLWVWMVLRVLETVEAHSGYHFPWSPSNFLPLYGGAEFHDYHHRVLYTKSGNYSSTFIYMDWLFGTDKDYRKTKALEE 261          
BLAST of Fatty acid hydroxylase domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4R4Q4|MSMO1_MACFA (Methylsterol monooxygenase 1 OS=Macaca fascicularis OX=9541 GN=MSMO1 PE=2 SV=1)

HSP 1 Score: 108.997 bits (271), Expect = 1.079e-25
Identity = 81/263 (30.80%), Postives = 125/263 (47.53%), Query Frame = 3
Query:  258 QSIFDKFYATMGND--DFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVN--KLLKIVSFNQFCIGIP-------FTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP--------SPEAHDFHHLKFVNNFG-VLGVLDRLHGTDNLF 986
            Q  F   +  M N+   F +  +G+L++   +Y+ + L    F  I    ++K+YKIQ D     P    N  K  K++ FN FCI +P       FT    + Y W        +P + ++L       ++E+   Y+ HRLLHH   YK IHK+HHE+ A  G+   YAHP+E L+       +G +L+  H+   W W  + +  T++ HSGY  P  P            HDFHH+ F+ N+       DR+ GTD+ +
Sbjct:   30 QEPFKNAWNYMLNNYTKFQIATWGSLIVHEALYFSFCLPGFLFQFI---PYMKKYKIQKDK----PETWENQWKCFKVLLFNHFCIQLPLICGTYYFTEYFNIPYDWER------MPRWYFLLARCFGCAVIEDTWHYFMHRLLHHKRIYKYIHKVHHEFQAPFGMEAEYAHPLETLILGT-GFFIGIVLLCDHVILLWAWVTIRLLETIDVHSGYDIPLNPLNLIPFYAGSRHHDFHHMNFIGNYASTFTWWDRIFGTDSQY 278          
BLAST of Fatty acid hydroxylase domain-containing protein vs. TrEMBL
Match: A0A267G4U0 (Fatty acid hydroxylase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig010714g7 PE=3 SV=1)

HSP 1 Score: 364.77 bits (935), Expect = 7.236e-121
Identity = 183/330 (55.45%), Postives = 235/330 (71.21%), Query Frame = 3
Query:   81 VKMKFEINKEVVKESKTRLF-DSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGK 1067
            V M+    K V      R + DS +K AF++GT LI F+A RNT T  LQ+FWGASG  WQ  FD  YA  G+DD     FGTL +T VVYW + L L+  D+ N PQFL +YK+QPD    I +  + K +  V FN+F +  PF  L   +Y WR  +FSG LPTFQWV+LE+ VF L EEV FYY+HR+LHHP  Y+ +HK+HHEWTA +G++ +YAHPIE+++SN++P  +GPL+MGSH+ T W+WFCLA+ +T  SH GYHFP LPSPEAHDFHHLKFVNNFGVLG+LD LHGTD LFR S A++RH ++L+L+P R+L+PD  K
Sbjct:    4 VAMETARQKAVAMVPPRRQWIDSAKKTAFVLGTSLIVFVAARNTATDLLQRFWGASGNYWQQAFDWTYAAFGSDDRCAWLFGTLAITGVVYWAFNLFLMLLDVFNWPQFLLKYKVQPDKNAPIDKRMLAKAVATVLFNEFVVAPPFMLLMFALYSWRGVAFSGELPTFQWVILEIAVFSLTEEVFFYYSHRMLHHPRIYRYVHKIHHEWTAPIGIISLYAHPIEHVLSNLLPPCMGPLIMGSHLGTIWLWFCLALVSTSISHCGYHFPLLPSPEAHDFHHLKFVNNFGVLGILDSLHGTDRLFRASRAYQRHFLLLSLVPVRELYPDGDK 333          
BLAST of Fatty acid hydroxylase domain-containing protein vs. TrEMBL
Match: A0A1I8HYV7 (Fatty acid hydroxylase domain-containing protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 1.288e-120
Identity = 177/319 (55.49%), Postives = 233/319 (73.04%), Query Frame = 3
Query:  141 DSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKSILSKQEPA 1097
            DS+R+AAF+IG+ L+ F+A RNT+T   Q+FWGASG+ WQS FD  Y+  G  D     +G++++T  VYW + LLL+  D  N P+FL +YK+QPD    + R ++ K + +V FNQ  +GIPF+ L+   +  R   F G LPT QWV+LE+ V VL EEV FYY+HRLLHHP  YK IHK+HHEWTA +G++ +YAHPIE+++SN++P  VGPL+MGSH+ T W+WFCLA+ +T  +H GYHFP LPSPEAHDFHHLKFVNNFGVLGVLD LHGTD LFR S A++RH ++L+L+P R+L PDD K     +Q  A
Sbjct:   11 DSLRRAAFVIGSSLVAFVAARNTVTDLAQRFWGASGDFWQSTFDTAYSFFGGTDASASLWGSIVITMTVYWSFNLLLILLDTFNWPEFLMRYKVQPDKNAPVDRRQLAKAIALVLFNQTVVGIPFSLLAYQAFRLRGGVFHGELPTLQWVILEIGVCVLAEEVFFYYSHRLLHHPSIYKHIHKIHHEWTAPIGIISLYAHPIEHVLSNLLPPCVGPLIMGSHLGTVWVWFCLALISTSIAHCGYHFPLLPSPEAHDFHHLKFVNNFGVLGVLDSLHGTDRLFRASKAYQRHFLLLSLVPVRELHPDDEKAGDKRRQAEA 329          
BLAST of Fatty acid hydroxylase domain-containing protein vs. TrEMBL
Match: A0A267EGG2 (Fatty acid hydroxylase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007777g1 PE=3 SV=1)

HSP 1 Score: 362.844 bits (930), Expect = 1.754e-120
Identity = 177/319 (55.49%), Postives = 233/319 (73.04%), Query Frame = 3
Query:  141 DSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKSILSKQEPA 1097
            DS+R+AAF+IG+ L+ F+A RNT+T   Q+FWGASG+ WQS FD  Y+  G  D     +G++++T  VYW + LLL+  D  N P+FL +YK+QPD    + R ++ K + +V FNQ  +GIPF+ L+   +  R   F G LPT QWV+LE+ V VL EEV FYY+HRLLHHP  YK IHK+HHEWTA +G++ +YAHPIE+++SN++P  VGPL+MGSH+ T W+WFCLA+ +T  +H GYHFP LPSPEAHDFHHLKFVNNFGVLGVLD LHGTD LFR S A++RH ++L+L+P R+L PDD K     +Q  A
Sbjct:    6 DSLRRAAFVIGSSLVAFVAARNTVTDLAQRFWGASGDFWQSTFDTAYSFFGGTDASASLWGSIVITMTVYWSFNLLLILLDTFNWPEFLMRYKVQPDKNAPVDRRQLAKAIALVLFNQTVVGIPFSLLAYQAFRLRGGVFHGELPTLQWVILEIGVCVLAEEVFFYYSHRLLHHPSIYKHIHKIHHEWTAPIGIISLYAHPIEHVLSNLLPPCVGPLIMGSHLGTVWVWFCLALISTSIAHCGYHFPLLPSPEAHDFHHLKFVNNFGVLGVLDSLHGTDRLFRASKAYQRHFLLLSLVPVRELHPDDEKAGDKRRQAEA 324          
BLAST of Fatty acid hydroxylase domain-containing protein vs. TrEMBL
Match: A0A267H438 (Fatty acid hydroxylase domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig004974g3 PE=3 SV=1)

HSP 1 Score: 363.229 bits (931), Expect = 3.285e-120
Identity = 177/314 (56.37%), Postives = 231/314 (73.57%), Query Frame = 3
Query:  126 KTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGK 1067
            + +  DS +K AF++GT LI F+A RNT T  LQ+FWGASG  WQ  FD  YA  G+DD     FGTL +T VVYW + L L+  D+ N P+FL +YK+QPD    I +  + K +  V FN+F +  PF  L   +Y WR  +FSG LPTFQWV+LE+ VF L EEV FYY+HR+LHHP  Y+ +HK+HHEWTA +G++ +YAHPIE+++SN++P  +GPL+MGSH+ T W+WFCLA+ +T  SH GYHFP LPSPEAHDFHHLKFVNNFGVLG+LD LHGTD LFR+S A++RH ++L+L+P R+L+PD  K
Sbjct:   20 RRQWIDSAKKTAFVLGTSLIVFVAARNTATDLLQRFWGASGNYWQQAFDWTYAAFGSDDRCAWLFGTLAITGVVYWAFNLFLMLLDVFNWPKFLLKYKVQPDKNAPIDKRMLAKAVATVLFNEFVVAPPFMLLMFALYSWRGVAFSGELPTFQWVILEIAVFSLTEEVFFYYSHRMLHHPRIYRYVHKIHHEWTAPIGIISLYAHPIEHVLSNLLPPCMGPLIMGSHLGTIWLWFCLALVSTSISHCGYHFPLLPSPEAHDFHHLKFVNNFGVLGILDSLHGTDRLFRSSRAYQRHFLLLSLVPVRELYPDGDK 333          
BLAST of Fatty acid hydroxylase domain-containing protein vs. TrEMBL
Match: A0A1I8H960 (Fatty acid hydroxylase domain-containing protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig007777g3 PE=3 SV=1)

HSP 1 Score: 353.984 bits (907), Expect = 4.950e-117
Identity = 177/319 (55.49%), Postives = 231/319 (72.41%), Query Frame = 3
Query:  141 DSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKSILSKQEPA 1097
            DS+R+AAF+IG+ L+ F+A RNT+T   Q+FWGASG+ WQS FD  Y+  G  D     +G++++T  VYW   LLL+  D  N P+FL +YK+QPD    + R ++ K + +V FNQ  +GIPF+ L+   +  R   F G LPT QWV+LE+ V VL EEV FYY+HRLLHHP  YK IHK+HHEWTA +G++ +YAHPIE+++SN++P  VGPL+MGSH+ T W+WFCLA+ +T  +H GYHFP LPSPEAHDFHHLKFVNNFGVLGVLD LHGTD LFR S A++RH ++L+L+P R L PDD K     +Q  A
Sbjct:   11 DSLRRAAFVIGSSLVAFVAARNTVTDLAQRFWGASGDFWQSTFDNAYSFFGGTDASASLWGSIVITMTVYWSLNLLLILLDTFNWPEFLMRYKVQPDKNAPVDRRQLAKAIALVLFNQTVVGIPFSLLAYQAFRLRGGVFHGELPTLQWVILEIGVCVLAEEVFFYYSHRLLHHPSIYKHIHKIHHEWTAPIGIISLYAHPIEHVLSNLLPPCVGPLIMGSHLGTVWVWFCLALISTSIAHCGYHFPLLPSPEAHDFHHLKFVNNFGVLGVLDSLHGTDRLFRASKAYQRHFLLLSLVPVRDLHPDDEKAGDKRRQAEA 329          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Cavefish
Match: faxdc2 (fatty acid hydroxylase domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2907])

HSP 1 Score: 311.997 bits (798), Expect = 8.252e-104
Identity = 155/319 (48.59%), Postives = 218/319 (68.34%), Query Frame = 3
Query:  117 KESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKS 1073
            +ES   L+DS++KAAF+IG+ L   +A RN++TWHLQ+FWGASG+ WQ+ + K Y     ++  + F GT+L+    +W +   L+  D+   P F+ +Y+IQ D  + + ++K+   +K V FNQ  + +P   L+  +  WR       LPTF WVLLEL +  LLEE+LFYY+HRL HHP FYK IHK+HHEWTA +G+V +YAHP+E++ SN++P  +GP+L+GSH+AT  +WF +A+  T  SH GYH P LPSPE HDFHHLKF   +GVLGVLDRLHGTD+ FR + A++RH ++L+  P  +  PD  KKS
Sbjct:   17 QESSGGLWDSVKKAAFVIGSGLFFLVAFRNSVTWHLQRFWGASGDFWQTQWTKVYTAFNGNEVALFFVGTMLVPTFFFWLFNAFLMLVDVTGKPNFITRYRIQTDKNNPVDQEKLRHAVKTVLFNQLFLSMPLVILTFAVMQWRGEPCRPELPTFHWVLLELAICGLLEEILFYYSHRLFHHPAFYKHIHKIHHEWTAPIGVVSLYAHPVEHVFSNMLPALIGPVLLGSHLATTSLWFTIALLVTTVSHCGYHLPLLPSPEFHDFHHLKFNQCYGVLGVLDRLHGTDDKFRQTKAYERHTLLLSFTPLTESIPDPTKKS 335          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Cavefish
Match: faxdc2 (fatty acid hydroxylase domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2907])

HSP 1 Score: 301.597 bits (771), Expect = 7.355e-99
Identity = 156/343 (45.48%), Postives = 218/343 (63.56%), Query Frame = 3
Query:  117 KESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPR------------------------DKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKS 1073
            +ES   L+DS++KAAF+IG+ L   +A RN++TWHLQ+FWGASG+ WQ+ + K Y     ++  + F GT+L+    +W +   L+  D+   P F+ +Y+IQ D  + + R                        +K+   +K V FNQ  + +P   L+  +  WR       LPTF WVLLEL +  LLEE+LFYY+HRL HHP FYK IHK+HHEWTA +G+V +YAHP+E++ SN++P  +GP+L+GSH+AT  +WF +A+  T  SH GYH P LPSPE HDFHHLKF   +GVLGVLDRLHGTD+ FR + A++RH ++L+  P  +  PD  KKS
Sbjct:   59 QESSGGLWDSVKKAAFVIGSGLFFLVAFRNSVTWHLQRFWGASGDFWQTQWTKVYTAFNGNEVALFFVGTMLVPTFFFWLFNAFLMLVDVTGKPNFITRYRIQTDKNNPVARYSTQQHCSCENRQAGYFSAKQVDQEKLRHAVKTVLFNQLFLSMPLVILTFAVMQWRGEPCRPELPTFHWVLLELAICGLLEEILFYYSHRLFHHPAFYKHIHKIHHEWTAPIGVVSLYAHPVEHVFSNMLPALIGPVLLGSHLATTSLWFTIALLVTTVSHCGYHLPLLPSPEFHDFHHLKFNQCYGVLGVLDRLHGTDDKFRQTKAYERHTLLLSFTPLTESIPDPTKKS 401          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Cavefish
Match: msmo1 (methylsterol monooxygenase 1 [Source:NCBI gene;Acc:406662])

HSP 1 Score: 67.0106 bits (162), Expect = 4.295e-12
Identity = 68/249 (27.31%), Postives = 109/249 (43.78%), Query Frame = 3
Query:  303 FYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIP-------FTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPL-LMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP--------SPEAHDFHHLKFVNNFG-VLGVLDRLHGTDNLFRNST 998
            F +  +G+L++  +VY+ + L    F  +    F+++YKIQ     ++     N+  +  SFN FCI +P       FT    + Y W        +P + ++L +     ++E+   Y+ HR LHH   YK IHK+HH++T +                      +G L    +H+    +       NT++ HSGY  P  P            HDFHH+ FV N+G      DRL  TD+ F + T
Sbjct:   46 FQIATWGSLIVHELVYFLFCLPGFLFQFM---PFMQKYKIQ-----QVGDWLTNQ--RCSSFNHFCIQLPMICGTYYFTEFFGIPYDWES------MPRWPYLLAQCFGCAVIEDTWHYFLHRALHHRRVYKYIHKVHHDFTVTQDF------------------DLGSLSCCMTHVLLRSLELTDRRPNTIDVHSGYDIPLNPLHLIPFYAGARFHDFHHMNFVGNYGSTFTWWDRLFNTDSQFNSYT 260          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Cavefish
Match: ch25h (cholesterol 25-hydroxylase [Source:NCBI gene;Acc:494109])

HSP 1 Score: 50.447 bits (119), Expect = 1.053e-6
Identity = 65/255 (25.49%), Postives = 108/255 (42.35%), Query Frame = 3
Query:  258 QSIFD--KFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTP-QFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHH--PLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP----------SPEAHDFHHLKFVNNFG-VLGVLDRLHGT 974
            Q+I+D  + Y T+    F+   F        VY  + L  +  DL+++    +++YKIQ      +    +   L +  +N      P   LS L + WR   +    P     ++  +V  LL     Y+   LLHH  P  Y+  HK+HH+ T++  L   Y+   E L   +   A+ P+++G H  T  ++  L +  ++  H GY+ P+                HD HH KF  N+       D+L GT
Sbjct:   12 QNIWDCIRQYETLMRSPFFPALFSL-----TVYLIFCLPFVVLDLLSSRVALVRRYKIQQK---NVTLSMMWSCLALSLYNHAVYIFP---LSVLHWYWRPVVYPLEAPGVL-QVIWGLVSCLLLFDFQYFIWHLLHHKVPWLYRTFHKVHHKHTSTFALTTEYSGAWETLSLGLFA-AMNPMVLGCHPMTEMLFHILNMWLSVEDHCGYNLPWATHRLVPFGLYGGAPHHDLHHQKFKANYAPYFTHWDKLFGT 253          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Cavefish
Match: ch25hl1.2 (cholesterol 25-hydroxylase like 1, tandem duplicate 2 [Source:NCBI gene;Acc:798384])

HSP 1 Score: 49.2914 bits (116), Expect = 3.131e-6
Identity = 40/130 (30.77%), Postives = 57/130 (43.85%), Query Frame = 3
Query:  636 YYTHRLLHHPL--FYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPS----------PEAHDFHHLKFVNNFGV-LGVLDRLHGTDNLF 986
            Y+   LLHH +   Y   H +HHE++A   L        E LV+      + P+L+  H+ T W +    +  ++  H GY FP+  S          P  HD HH K   NF      LD+L GT + F
Sbjct:  129 YFIWHLLHHRVRWLYVTFHAIHHEYSAPFSLATQCLGGWE-LVTVGFWTTINPVLLRCHLLTTWAFMVTHVYVSVEDHCGYDFPWSTSRLIPFGVYGGPSKHDVHHQKPNTNFAPHFSHLDKLFGTHSDF 257          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Sea Lamprey
Match: faxdc2 (fatty acid hydroxylase domain containing 2 [Source:ZFIN;Acc:ZDB-GENE-040426-2907])

HSP 1 Score: 206.838 bits (525), Expect = 3.268e-65
Identity = 114/207 (55.07%), Postives = 144/207 (69.57%), Query Frame = 3
Query:  456 KVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLV---SNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGK 1067
            K+   +  V  NQ  I  P   ++ +I +WR  +    LPTF WVLLEL+VF L+EEV+FYY+HRL HHP  YKR HK HHEWTA +GLV +YAHP+E+ V   SN++P  +GP+LMGSH AT  +WF +A+ +T  +H GYH P LPSPE HDFHHLKF   +GVLGVLDRLHGTD  FR + A++RHIM+L L P  +  PD  K
Sbjct:    5 KLRNAIFTVLANQLFISFPMVLIAYVISLWRGGTCGPELPTFHWVLLELLVFGLIEEVMFYYSHRLFHHPALYKRFHKQHHEWTAPIGLVSLYAHPLEHFVGQLSNMLPPVMGPVLMGSHAATIMLWFTMALLSTSVAHCGYHLPLLPSPEFHDFHHLKFNQCYGVLGVLDRLHGTDAAFRRTKAYERHIMLLGLTPLSESIPDTPK 211          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Sea Lamprey
Match: msmo1 (methylsterol monooxygenase 1 [Source:NCBI gene;Acc:406662])

HSP 1 Score: 92.8189 bits (229), Expect = 1.479e-21
Identity = 76/268 (28.36%), Postives = 124/268 (46.27%), Query Frame = 3
Query:  252 LWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIP-------FTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTL-----NSHSGYHFPFLP--------SPEAHDFHHLKFVNNFG-VLGVLDRLHGTDNLFRN 992
            +W  + ++F        F V  +G+LL+  +VY+ + L    F  I     +K+YKIQ D  + +  +K  K  K + FN F I +P       FT   +  Y W        +P +  V+ + +   ++E+   Y+ HRLLHH   +K IHK+HH++ +  G+   YAHP E ++   +   +G ++  +H+   W W    +  T+        SGY  P  P            HDFHH+ FV N+       DRL GTD+ ++ 
Sbjct:   36 VWSHMLERF------TKFQVATWGSLLVHELVYFSFCLPGFIFQFIPA---MKKYKIQADKPETM--EKQWKCFKTLLFNHFFIQLPMICGTYYFTEFFSTPYEW------DAMPRWHVVIAQCLGCAVVEDTWHYFLHRLLHHKSIFKYIHKVHHQFQSPFGMQAEYAHPAETVILG-MGFFIGIMIFCNHLVLLWAWVTFRLLETILALPSPCGSGYEIPLNPLHMIPFYAGARFHDFHHMNFVGNYASTFTWWDRLLGTDSQYKE 285          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002800.1 (pep scaffold:Pmarinus_7.0:GL476598:1777321:1781254:-1 gene:ENSPMAG00000002557.1 transcript:ENSPMAT00000002800.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 73.9442 bits (180), Expect = 5.989e-17
Identity = 35/78 (44.87%), Postives = 51/78 (65.38%), Query Frame = 3
Query:   78 LVKMKFEINKEVVKESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYV 311
            L+ +K  +  E       +++DS++KAAF++GT L+ F A RNT+TWHLQQFWGASG+ WQS +  FY     + F +
Sbjct:    1 LICVKGYMKNEFKSGKSGQVWDSVQKAAFVLGTGLLVFAAARNTITWHLQQFWGASGDFWQSQWALFYNAYEEEPFKI 78          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Sea Lamprey
Match: sc5d (sterol-C5-desaturase [Source:ZFIN;Acc:ZDB-GENE-040912-56])

HSP 1 Score: 47.7506 bits (112), Expect = 2.216e-6
Identity = 39/131 (29.77%), Postives = 59/131 (45.04%), Query Frame = 3
Query:  636 YYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSG-YHFP-----FLPSPEAHDFHHLKFVNNFGVLGVL-DRLHGTDNLFRNSTAFK 1007
            Y+ HR+LHH   YK +HK HH+W           HPI+  + + +P  + P L   H       +      T++ H G Y  P      +     H  HHL F  N+G    L DRL G+   +++ +AF+
Sbjct:  135 YWIHRVLHHKSIYKTLHKPHHKWKVPTPFASHAFHPIDGFMQS-LPYHIYPFLFPLHKGVYLGLYIFVNIWTVSIHDGDYRVPQILRDVINGSAHHTDHHLYFECNYGQYFTLWDRLAGS---YKHPSAFE 261          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Sea Lamprey
Match: ch25hl1.2 (cholesterol 25-hydroxylase like 1, tandem duplicate 2 [Source:NCBI gene;Acc:798384])

HSP 1 Score: 46.595 bits (109), Expect = 4.474e-6
Identity = 35/126 (27.78%), Postives = 55/126 (43.65%), Query Frame = 3
Query:  636 YYTHRLLHHPL--FYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFP-----FLP-----SPEAHDFHHLKFVNNFGV-LGVLDRLHGT 974
            Y+   ++HH     YK  H +HHE+ +       Y    E  V       + P+L+  H+ T W++    +  ++  H GY FP     +LP         HD HH K ++NF      +D+L GT
Sbjct:  141 YFVWHMVHHKFRWLYKTFHAVHHEFMSPFSWSTQYLGCWELFVVGAW-TTIDPVLLQCHLLTTWIFMAFHVYTSVEQHCGYDFPWSTRHWLPLGLFGGSLHHDMHHQKPMSNFAPHFSHMDKLFGT 265          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Yeast
Match: ERG25 (C-4 methyl sterol oxidase; catalyzes the first of three steps required to remove two C-4 methyl groups from an intermediate in ergosterol biosynthesis; mutants accumulate the sterol intermediate 4,4-dimethylzymosterol; human MSMO1 functionally complements the growth defect caused by repression of ERG25 expression [Source:SGD;Acc:S000003292])

HSP 1 Score: 75.485 bits (184), Expect = 1.241e-15
Identity = 77/259 (29.73%), Postives = 115/259 (44.40%), Query Frame = 3
Query:  222 LQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVN-KLLKIVSFNQFCI-GIPFTYLSTLIYMWRECSFSG-----PLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLV----SNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHF--------PFLPSPEAHDFHHLKFVNNFG 941
            ++++W A           +Y+ M ND    G    LL   +    Y    L + +I+   + +++K+QP    KIP  K     LK V  + F +  IP      +      C   G     P P+ + + LE+ +F +LE+   Y+ HRL H+ +FYK IHK HH + A  GL   YAHP E L     +  +PI         H+ T  +W  L +   ++SHSGY F        PF    E HD HH  F+ N+ 
Sbjct:   36 MEKYWAA-----------WYSYMNNDVLATGLMFFLLHEFM----YFFRCLPWFIIDQIPYFRRWKLQPT---KIPSAKEQLYCLKSVLLSHFLVEAIPIWTFHPM------CEKLGITVEVPFPSLKTMALEIGLFFVLEDTWHYWAHRLFHYGVFYKYIHKQHHRYAAPFGLSAEYAHPAETLSLGFGTVGMPILYVMYTGKLHLFTLCVWITLRLFQAVDSHSGYDFPWSLNKIMPFWAGAEHHDLHHHYFIGNYA 270          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Yeast
Match: ERG3 (C-5 sterol desaturase; glycoprotein that catalyzes the introduction of a C-5(6) double bond into episterol, a precursor in ergosterol biosynthesis; transcriptionally down-regulated when ergosterol is in excess; mutants are viable, but cannot grow on non-fermentable carbon sources; substrate of HRD ubiquitin ligase; mutation is functionally complemented by human SC5D [Source:SGD;Acc:S000004046])

HSP 1 Score: 48.521 bits (114), Expect = 9.271e-7
Identity = 35/117 (29.91%), Postives = 52/117 (44.44%), Query Frame = 3
Query:  636 YYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHF---PFLPSPEAHDFHHLKFVNNFGVLGVL-DRLHGT 974
            Y  HR LH P  Y+ +HK HH+W           HP++  + + I   + PL++  H  +  + F      T+  H G +    P +     H  HHL F  N+G    L DRL G+
Sbjct:  197 YLAHRWLHWPRVYRALHKPHHKWLVCTPFASHSFHPVDGFLQS-ISYHIYPLILPLHKVSYLILFTFVNFWTVMIHDGQYLSNNPAVNGTACHTVHHLYFNYNYGQFTTLWDRLGGS 312          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Nematostella
Match: EDO44495 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVR3])

HSP 1 Score: 335.88 bits (860), Expect = 2.580e-113
Identity = 170/324 (52.47%), Postives = 219/324 (67.59%), Query Frame = 3
Query:  117 KESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKSILSKQ 1088
            KE    + +S++K AF++GT LI F A RN++TWH+++FWGASG+ WQ+ +       G++D  V   GT L T  V+W      L  D+   P++  +YKIQ      + + K+ + +K+V FNQ  +G+  T     +Y WR CS    LP+F WVL E+  F L+EE  FYY+HRL HHP  YK IHK HHEWTA +G+V +YAHP+E+LVSN+ PI +GPLLMGSHIATAW+WF +A+  T  SHSGYHFPFLPSPEAHDFHHLKF  N+GVLGVLDRLHGTD  FRNS A+ RHIMM+ L P  + FPD  KK    K+
Sbjct:   26 KEKAKSVIESLKKTAFVLGTALICFAAARNSITWHVERFWGASGDFWQTRWRWILDLFGHNDVAVIVLGTTLETFFVFWFVNAFFLFIDITGRPKWALKYKIQDGQNMPVDKKKLIRAIKVVLFNQLVVGVGLTAALIPVYRWRGCSIDENLPSFHWVLFEIACFTLVEEFGFYYSHRLAHHPKIYKYIHKQHHEWTAPIGIVSIYAHPLEHLVSNLCPIVLGPLLMGSHIATAWLWFSIALTTTNISHSGYHFPFLPSPEAHDFHHLKFNQNYGVLGVLDRLHGTDIQFRNSVAYDRHIMMIGLTPLTEAFPDRPKKGCSPKK 349          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Nematostella
Match: EDO44003 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXC0])

HSP 1 Score: 60.8474 bits (146), Expect = 2.685e-10
Identity = 43/121 (35.54%), Postives = 55/121 (45.45%), Query Frame = 3
Query:  636 YYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSN---VIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFL----PSPEAHDFHHLKFVNNFGVLG-VLDRLHGT 974
            YY HR+LH P FYK  HK HH + A         HP+E+LV     VIP  V P+  G  +      +   + +    HSG + P L    P    HD HH  F  NFG    + D+ H T
Sbjct:  201 YYYHRMLHWPFFYKNFHKWHHRYKAPTAFSATAMHPVEFLVFQFFIVIPAFVVPINAGVFVGILLYLYYYGMKD----HSGINRPALWPWQPPTLFHDDHHKYFHVNFGFNSLIFDKFHNT 317          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Medaka
Match: faxdc2 (fatty acid hydroxylase domain containing 2 [Source:NCBI gene;Acc:101170205])

HSP 1 Score: 284.263 bits (726), Expect = 5.199e-93
Identity = 143/318 (44.97%), Postives = 205/318 (64.47%), Query Frame = 3
Query:  117 KESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKK 1070
            +E+   L+DS++KAA +IG+ ++   A  N++TWHLQ+FWGASG+ WQ+++ K Y      +  + F GT+    V +W    LLL  D      F+ +Y+IQ +  + +   K+ + LK V FN   I  P       +  WR       LPTF W L+EL VF ++EE+LFYY+HRL HHP  YK  HK HHEWTA +G++ +YAHP+E+++SN +P+ +GP+L+GSH++T  MW+C+A+ +T  SH GYH PFLPSPE HDFHHLKF   +GV GVLDRLHGTD  F+ +  ++RH+++ +L P     PD  KK
Sbjct:   23 QEASGGLWDSVKKAAVVIGSGILFLAAFGNSVTWHLQKFWGASGDFWQNLWTKLYLAFEGHEAALFFMGTMFAPTVAFWVSNGLLLLVDTTGKLSFITRYRIQMNKNEPVDPVKLRQALKTVIFNHVFISGPMAVGVYYLMTWRGNPCGPELPTFHWGLMELGVFSIIEEILFYYSHRLFHHPSLYKHFHKQHHEWTAPIGVISIYAHPLEHVISNTLPVMIGPVLLGSHLSTTCMWYCVALISTTISHCGYHLPFLPSPEFHDFHHLKFNQCYGVFGVLDRLHGTDAKFKQTKQYERHMLLTSLTPLTHSIPDHPKK 340          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Medaka
Match: msmo1 (methylsterol monooxygenase 1 [Source:NCBI gene;Acc:105354476])

HSP 1 Score: 102.064 bits (253), Expect = 3.339e-24
Identity = 74/246 (30.08%), Postives = 121/246 (49.19%), Query Frame = 3
Query:  303 FYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIP-------FTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLP--------SPEAHDFHHLKFVNNFG-VLGVLDRLHGTDNLFRN 992
            F +  +G+L++  +VY+   +L L   L     F+++YKIQ D  + +  +K  +  K++ FN FCI  P       FT   ++ Y W        +P + ++L +     ++E+   Y+ HRLLHH   YK IHK+HHE+T+  G+   YAHP E ++       +G ++  +H+   W W    +  T++ HSGY  P  P            HDFHH+ FV N+       D+L  TD+ +  
Sbjct:   47 FQIATWGSLIVHELVYF---VLCLPGFLFQFVPFMQKYKIQQDKPETM--EKQWRCFKMLLFNHFCIQFPLICGTYYFTEFFSIPYDWDS------MPRWPYLLAQCFGCAVVEDTWHYFLHRLLHHRRIYKYIHKVHHEFTSPFGMQAEYAHPAETIILGA-GFFIGIMIFCNHVFLLWAWVTFRLLETIDVHSGYDIPLNPLHLIPFYAGARFHDFHHMNFVGNYASTFTWWDKLLNTDSQYNK 280          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Medaka
Match: ch25h (cholesterol 25-hydroxylase [Source:NCBI gene;Acc:101164274])

HSP 1 Score: 53.5286 bits (127), Expect = 1.125e-7
Identity = 59/204 (28.92%), Postives = 84/204 (41.18%), Query Frame = 3
Query:  402 FLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHH--PLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPF-----LP-----SPEAHDFHHLKFVNNFG-VLGVLDRLHGT 974
             ++ +K+QP +   +    V   L +  +N      P T L   +        + PLP      L  V+  LL      +   LLHH  P  Y+  HK+HH +T++  L   Y+   E L   +   AV P L+G H  T   +F L I  ++  H GY  P+     +P         HD HHLK   NF       DRL GT
Sbjct:   50 LVRSFKLQPQS--SVSWTAVRSCLALTLYNHLVFIFPLTVLHWYLRPEHLPEEAPPLPRL----LAQVLVCLLLFDFQSFVWHLLHHKVPWLYRNFHKVHHTYTSTSALTAEYSSAWETLSLGLF-AAVSPELLGCHPLTKLTFFTLNIWLSVEDHCGYDLPWSTHRLVPFGLYGGAPHHDLHHLKSKFNFAPYFTHWDRLAGT 246          
BLAST of Fatty acid hydroxylase domain-containing protein vs. Planmine SMEST
Match: SMESG000019318.1 (SMESG000019318.1)

HSP 1 Score: 667.922 bits (1722), Expect = 0.000e+0
Identity = 341/341 (100.00%), Postives = 341/341 (100.00%), Query Frame = 3
Query:   87 MKFEINKEVVKESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWXXXXXXXXXXXXXXXXYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKSILSKQEPAQMQS 1109
            MKFEINKEVVKESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWVLLELVVFVLLEEVLFYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKSILSKQEPAQMQS
Sbjct:    1 MKFEINKEVVKESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFWGASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDLINTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLIYMWRECSFSGPLPTFQWVLLELVVFVLLEEVLFYYTHRLLHHPLFYKRIHKLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCLAIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLFRNSTAFKRHIMMLTLIPPRQLFPDDGKKSILSKQEPAQMQS 341          
The following BLAST results are available for this feature:
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAXDC24.864e-9446.39fatty acid hydroxylase domain containing 2 [Source... [more]
FAXDC21.311e-9347.57fatty acid hydroxylase domain containing 2 [Source... [more]
MSMO14.900e-2631.00methylsterol monooxygenase 1 [Source:HGNC Symbol;A... [more]
FAXDC22.856e-2233.56fatty acid hydroxylase domain containing 2 [Source... [more]
MSMO14.004e-2037.31methylsterol monooxygenase 1 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
drd-13.666e-6140.07Dietary restriction down regulated [Source:UniPro... [more]
drd-13.206e-4840.45Dietary restriction down regulated [Source:UniPro... [more]
F49E12.101.254e-4535.45pep chromosome:WBcel235:II:8391088:8392281:1 gene:... [more]
F35C8.55.750e-929.61Cholesterol 25-hydroxylase-like protein [Source:U... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
CG19988.068e-10653.70gene:FBgn0030485 transcript:FBtr0073787[more]
CG19988.068e-10653.70gene:FBgn0030485 transcript:FBtr0343148[more]
CG19981.808e-9954.58gene:FBgn0030485 transcript:FBtr0301560[more]
CG111628.705e-5139.76gene:FBgn0030509 transcript:FBtr0073811[more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
faxdc23.526e-10248.29fatty acid hydroxylase domain containing 2 [Source... [more]
faxdc25.390e-10248.74fatty acid hydroxylase domain containing 2 [Source... [more]
msmo14.089e-2630.89methylsterol monooxygenase 1 [Source:NCBI gene;Acc... [more]
msmo14.089e-2630.89methylsterol monooxygenase 1 [Source:NCBI gene;Acc... [more]
msmo15.917e-2630.89methylsterol monooxygenase 1 [Source:NCBI gene;Acc... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FAXDC21.141e-10349.84fatty acid hydroxylase domain containing 2 [Source... [more]
FAXDC25.676e-10349.84fatty acid hydroxylase domain containing 2 [Source... [more]
nudt222.304e-2429.27nudix hydrolase 22 [Source:Xenbase;Acc:XB-GENE-596... [more]
CH25H5.146e-732.73cholesterol 25-hydroxylase [Source:NCBI gene;Acc:1... [more]
SC5D5.759e-729.77sterol-C5-desaturase [Source:NCBI gene;Acc:1004908... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gm122486.695e-8241.94predicted gene 12248 [Source:MGI Symbol;Acc:MGI:36... [more]
Gm122482.520e-8141.75predicted gene 12248 [Source:MGI Symbol;Acc:MGI:36... [more]
Gm122481.874e-7642.81predicted gene 12248 [Source:MGI Symbol;Acc:MGI:36... [more]
Msmo11.090e-2330.71methylsterol monoxygenase 1 [Source:MGI Symbol;Acc... [more]
Sc5d3.840e-629.77sterol-C5-desaturase [Source:MGI Symbol;Acc:MGI:13... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q96IV6|FXDC2_HUMAN2.336e-9346.39Fatty acid hydroxylase domain-containing protein 2... [more]
sp|Q9GKT2|FXDC2_MACFA1.325e-9146.15Fatty acid hydroxylase domain-containing protein 2... [more]
sp|Q69L93|GLO18_ORYSJ6.726e-2632.80Very-long-chain aldehyde decarbonylase GL1-8 OS=Or... [more]
sp|B8B6I2|GLO18_ORYSI6.726e-2632.80Very-long-chain aldehyde decarbonylase GL1-8 OS=Or... [more]
sp|Q4R4Q4|MSMO1_MACFA1.079e-2530.80Methylsterol monooxygenase 1 OS=Macaca fasciculari... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267G4U07.236e-12155.45Fatty acid hydroxylase domain-containing protein (... [more]
A0A1I8HYV71.288e-12055.49Fatty acid hydroxylase domain-containing protein O... [more]
A0A267EGG21.754e-12055.49Fatty acid hydroxylase domain-containing protein (... [more]
A0A267H4383.285e-12056.37Fatty acid hydroxylase domain-containing protein (... [more]
A0A1I8H9604.950e-11755.49Fatty acid hydroxylase domain-containing protein O... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
faxdc28.252e-10448.59fatty acid hydroxylase domain containing 2 [Source... [more]
faxdc27.355e-9945.48fatty acid hydroxylase domain containing 2 [Source... [more]
msmo14.295e-1227.31methylsterol monooxygenase 1 [Source:NCBI gene;Acc... [more]
ch25h1.053e-625.49cholesterol 25-hydroxylase [Source:NCBI gene;Acc:4... [more]
ch25hl1.23.131e-630.77cholesterol 25-hydroxylase like 1, tandem duplicat... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
faxdc23.268e-6555.07fatty acid hydroxylase domain containing 2 [Source... [more]
msmo11.479e-2128.36methylsterol monooxygenase 1 [Source:NCBI gene;Acc... [more]
ENSPMAT00000002800.15.989e-1744.87pep scaffold:Pmarinus_7.0:GL476598:1777321:1781254... [more]
sc5d2.216e-629.77sterol-C5-desaturase [Source:ZFIN;Acc:ZDB-GENE-040... [more]
ch25hl1.24.474e-627.78cholesterol 25-hydroxylase like 1, tandem duplicat... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
ERG251.241e-1529.73C-4 methyl sterol oxidase; catalyzes the first of ... [more]
ERG39.271e-729.91C-5 sterol desaturase; glycoprotein that catalyzes... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO444952.580e-11352.47Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO440032.685e-1035.54Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
faxdc25.199e-9344.97fatty acid hydroxylase domain containing 2 [Source... [more]
msmo13.339e-2430.08methylsterol monooxygenase 1 [Source:NCBI gene;Acc... [more]
ch25h1.125e-728.92cholesterol 25-hydroxylase [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Fatty acid hydroxylase domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000019318.10.000e+0100.00SMESG000019318.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023727 ID=SMED30023727|Name=Fatty acid hydroxylase domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1259bp
TTTAAGGTCATTAATATTTGTAGTATTATATTGATTTAAAAAATTTAATT
TCACCATATTTTCAAAACTAGTCAAAATTAGTAAAAATGAAATTTGAGAT
AAATAAAGAAGTAGTAAAAGAATCAAAAACTCGATTGTTTGACTCTATTA
GAAAAGCTGCCTTTATAATTGGCACTTTTTTAATTGGATTTATAGCTACA
AGAAATACTCTAACATGGCATTTACAACAGTTTTGGGGTGCATCGGGAGA
GTTATGGCAGTCAATTTTTGATAAATTTTACGCAACGATGGGCAATGATG
ATTTTTATGTTGGATTTTTTGGTACATTATTATTGACAAATGTTGTATAT
TGGGGTTATGGATTACTGTTACTAAGCTTTGATTTAATTAATACTCCCCA
GTTTCTCAAGCAATACAAAATACAGCCCGATGCCTTTGACAAGATTCCTC
GCGATAAAGTAAATAAATTATTAAAAATAGTATCTTTCAATCAATTTTGT
ATCGGAATACCATTTACTTATCTTTCCACTCTTATTTATATGTGGCGAGA
ATGTTCATTCAGCGGTCCTTTACCGACATTTCAATGGGTTTTATTGGAGT
TGGTTGTATTTGTGCTCTTGGAAGAAGTTCTGTTCTATTATACACATAGG
TTATTACATCATCCATTATTCTACAAACGCATTCATAAATTGCATCATGA
ATGGACAGCCTCGGTTGGTCTAGTCGGAGTTTATGCTCATCCGATTGAAT
ATTTGGTATCAAACGTTATTCCAATTGCTGTCGGTCCATTGTTGATGGGA
TCTCATATTGCGACTGCATGGATGTGGTTTTGTCTGGCCATTGCTAATAC
GCTTAATTCTCACAGCGGTTACCATTTCCCCTTTCTCCCATCTCCAGAAG
CCCACGATTTCCATCATTTAAAGTTTGTAAACAATTTCGGAGTTCTTGGT
GTACTGGATCGACTTCATGGAACTGATAATTTATTCCGCAACAGCACAGC
ATTCAAGAGACACATCATGATGCTAACTCTCATTCCTCCTCGTCAACTTT
TTCCAGATGACGGTAAAAAATCAATTTTAAGCAAACAGGAGCCCGCTCAA
ATGCAATCCTAAACGTGCTTGAATTTTTCATTATTAAAATGGTTTCATTT
TCCTGAAAGAAACAACATTTATCATCATTACATTGAGTAATTATTGAGTT
GGAATTTTATTAGTTTATTTCATGATATAATTTAATAAATATATGTCAGC
ATTCAAGAG
back to top

protein sequence of SMED30023727-orf-1

>SMED30023727-orf-1 ID=SMED30023727-orf-1|Name=SMED30023727-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
MKFEINKEVVKESKTRLFDSIRKAAFIIGTFLIGFIATRNTLTWHLQQFW
GASGELWQSIFDKFYATMGNDDFYVGFFGTLLLTNVVYWGYGLLLLSFDL
INTPQFLKQYKIQPDAFDKIPRDKVNKLLKIVSFNQFCIGIPFTYLSTLI
YMWRECSFSGPLPTFQWVLLELVVFVLLEEVLFYYTHRLLHHPLFYKRIH
KLHHEWTASVGLVGVYAHPIEYLVSNVIPIAVGPLLMGSHIATAWMWFCL
AIANTLNSHSGYHFPFLPSPEAHDFHHLKFVNNFGVLGVLDRLHGTDNLF
RNSTAFKRHIMMLTLIPPRQLFPDDGKKSILSKQEPAQMQS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0008610lipid biosynthetic process
GO:0055114oxidation-reduction process
GO:0006633fatty acid biosynthetic process
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0005506iron ion binding
GO:0016491oxidoreductase activity
GO:0004497monooxygenase activity
Vocabulary: INTERPRO
TermDefinition
IPR006694Fatty_acid_hydroxylase
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR006694Fatty acid hydroxylasePFAMPF04116FA_hydroxylasecoord: 173..296
e-value: 5.1E-23
score: 81.9
NoneNo IPR availablePANTHERPTHR11863STEROL DESATURASEcoord: 22..324
NoneNo IPR availablePANTHERPTHR11863:SF26FATTY ACID HYDROXYLASE DOMAIN-CONTAINING PROTEIN 2coord: 22..324
NoneNo IPR availableTMHMMTMhelixcoord: 73..95
NoneNo IPR availableTMHMMTMhelixcoord: 230..252
NoneNo IPR availableTMHMMTMhelixcoord: 21..43
NoneNo IPR availableTMHMMTMhelixcoord: 206..225
NoneNo IPR availableTMHMMTMhelixcoord: 163..185
NoneNo IPR availableTMHMMTMhelixcoord: 131..153