ZFP-1

Overview
NameZFP-1 (AFD29622.1)
Smed IDSMED30023708
Length (bp)1035
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of ZFP-1 (SMED30023708) t-SNE clustered cells

Violin plots show distribution of expression levels for ZFP-1 (SMED30023708) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of ZFP-1 (SMED30023708) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for ZFP-1 (SMED30023708) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023708

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 29

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
zeta neoblastSMED30023708SMESG000066384.1 SMED30023708smed_20140614PMID:29906446
Zeng et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
X1 cellSMED30023708SMESG000066384.1 SmedASXL_001731SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023708SMESG000066384.1 SmedASXL_001731SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
Category 2 cellSMED30023708SMESG000066384.1 SMED30023708smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
neoblastSMED30023708SMESG000066384.1 SMED30023708smed_20140614PMID:29100657
Cheng et al., 2018
whole organism asexual adult fluorescence in situ hybridization evidence
X1 cellSMED30023708SMESG000066384.1 SMED30023708smed_20140614PMID:29100657
Cheng et al., 2018
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30023708SMESG000066384.1 dd_Smed_v4_8720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023708SMESG000066384.1 dd_Smed_v4_8720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023708SMESG000066384.1 dd_Smed_v4_8720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023708SMESG000066384.1 dd_Smed_v4_8720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023708SMESG000066384.1 dd_Smed_v4_8720_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30023708SMESG000066384.1 JQ425154smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
prepharyngeal regionSMED30023708SMESG000066384.1 JQ425154smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
parapharyngeal regionSMED30023708SMESG000066384.1 JQ425154smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
tail regionSMED30023708SMESG000066384.1 JQ425154smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023708SMESG000066384.1 JQ425154smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30023708SMESG000066384.1 JQ425154smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult fluorescence in situ hybridization evidence
zeta neoblastSMED30023708SMESG000066384.1 JQ425154smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023708SMESG000066384.1 SMED30023708smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
neoblastSMED30023708SMESG000066384.1 SMED30023708smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023708SMESG000066384.1 SMED30023708smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30023708SMESG000066384.1 JQ425154.1smed_ncbi_20200123PMID:29357350
de Sousa et al., 2018
whole organism asexual adult colorimetric in situ hybridization evidence
zeta neoblastSMED30023708SMESG000066384.1 dd_Smed_v4_8720_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023708SMESG000066384.1 SMED_10510_V2_2GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023708SMESG000066384.1 SMED_10510_V2_2GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023708SMESG000066384.1 SMED_10510_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023708SMESG000066384.1 SMED_10510_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023708SMESG000066384.1 SmWIOct06_032155GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023708SMESG000066384.1 SMED30023708smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of ZFP-1 vs. Ensembl Human
Match: ZNF341 (zinc finger protein 341 [Source:HGNC Symbol;Acc:HGNC:15992])

HSP 1 Score: 68.9366 bits (167), Expect = 4.054e-12
Identity = 35/83 (42.17%), Postives = 45/83 (54.22%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            F C  C+++FPC   L  H L  HGS   +KC +C   F +   L+ HA  H G KPYKC VC   + RKD L RH+  + P 
Sbjct:  566 FPCPHCQKVFPCERYLRRH-LPTHGSGGRFKCQVCKKFFRREHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPF 647          

HSP 2 Score: 49.6766 bits (117), Expect = 6.319e-6
Identity = 35/131 (26.72%), Postives = 50/131 (38.17%), Query Frame = 2
Query:  455 CNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHG-------SYKCHICNTSFTQRSNLQRHALRHVGFKPYKC---------------------------------GVCSKEYYRKDHLIRH 727
            C +  R+  P      R FKC  C++ F       EH L++H         YKC +C ++F ++  L+RH L H  FK YKC                                  +CSK + R+ HL  H
Sbjct:  577 CERYLRRHLPTHGSGGR-FKCQVCKKFF-----RREHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSTHTGCSKEFNRPDKLKAHILSHSGMKLHKCALCSKSFSRRAHLAEH 701          
BLAST of ZFP-1 vs. Ensembl Human
Match: ZNF341 (zinc finger protein 341 [Source:HGNC Symbol;Acc:HGNC:15992])

HSP 1 Score: 68.9366 bits (167), Expect = 4.385e-12
Identity = 35/83 (42.17%), Postives = 45/83 (54.22%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            F C  C+++FPC   L  H L  HGS   +KC +C   F +   L+ HA  H G KPYKC VC   + RKD L RH+  + P 
Sbjct:  559 FPCPHCQKVFPCERYLRRH-LPTHGSGGRFKCQVCKKFFRREHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPF 640          

HSP 2 Score: 49.6766 bits (117), Expect = 6.306e-6
Identity = 35/131 (26.72%), Postives = 50/131 (38.17%), Query Frame = 2
Query:  455 CNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHG-------SYKCHICNTSFTQRSNLQRHALRHVGFKPYKC---------------------------------GVCSKEYYRKDHLIRH 727
            C +  R+  P      R FKC  C++ F       EH L++H         YKC +C ++F ++  L+RH L H  FK YKC                                  +CSK + R+ HL  H
Sbjct:  570 CERYLRRHLPTHGSGGR-FKCQVCKKFF-----RREHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSTHTGCSKEFNRPDKLKAHILSHSGMKLHKCALCSKSFSRRAHLAEH 694          
BLAST of ZFP-1 vs. Ensembl Human
Match: ZNF287 (zinc finger protein 287 [Source:HGNC Symbol;Acc:HGNC:13502])

HSP 1 Score: 67.781 bits (164), Expect = 1.038e-11
Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +C+KCN+C + F   + L +H     G  SY C+IC  +F+Q +NL +H   H G KPYKC VC K + +  HL +H
Sbjct:  562 KCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKAFSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQH 638          

HSP 2 Score: 58.9214 bits (141), Expect = 5.863e-9
Identity = 36/101 (35.64%), Postives = 54/101 (53.47%), Query Frame = 2
Query:  449 NDCNKQKRKSTPVKLK------KSRCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            N C K+ RK  P  LK      K + ++C +C + F  +++L  H     G   Y+CH C  +F+QR++L  H   H G KPYKC  C K++ ++ HL  H
Sbjct:  371 NVCGKKFRKY-PSLLKHQSTHAKEKSYECEECGKEFRHISSLIAHQRMHTGEKPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIH 470          

HSP 3 Score: 55.8398 bits (133), Expect = 6.353e-8
Identity = 28/75 (37.33%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +KCN+C + F   ++L +H     G   YKC+ C+  F+QR+ L +H   H G KPY C +C K + +  +LI+H
Sbjct:  676 YKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLIQHQRIHTGEKPYACRICGKTFTQSTNLIQH 750          

HSP 4 Score: 54.299 bits (129), Expect = 2.047e-7
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            + CN C + F    NLT+H     G   YKC +C  +F+Q  +L +H   H G KP+KC +C K Y +  +L +H
Sbjct:  592 YICNICGKAFSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGANLTQH 666          

HSP 5 Score: 51.6026 bits (122), Expect = 1.288e-6
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            ++C+QC + F    +LT H  ++H     YKC  C   F+QR++L  H   H G KPYKC  C K +     LI H
Sbjct:  424 YECHQCGKAFSQRAHLTIHQ-RIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPYKCLECGKTFSHSSSLINH 498          

HSP 6 Score: 50.8322 bits (120), Expect = 2.798e-6
Identity = 27/75 (36.00%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +KC+ C + F    +LT+H    +G   +KC+IC  ++ Q +NL +H   H G KPYKC  C K +     L +H
Sbjct:  620 YKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGANLTQHQRIHTGEKPYKCNECGKAFIYSSSLNQH 694          

HSP 7 Score: 49.2914 bits (116), Expect = 7.707e-6
Identity = 28/76 (36.84%), Postives = 43/76 (56.58%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +KC +C + F   ++L  H  +VH     Y C+ C  +F+Q ++L +H   H G KPYKC  C K + +  +LIRH
Sbjct:  480 YKCLECGKTFSHSSSLINHQ-RVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNECWKVFSQSTYLIRH 554          
BLAST of ZFP-1 vs. Ensembl Human
Match: ZNF287 (zinc finger protein 287 [Source:HGNC Symbol;Acc:HGNC:13502])

HSP 1 Score: 67.781 bits (164), Expect = 1.038e-11
Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +C+KCN+C + F   + L +H     G  SY C+IC  +F+Q +NL +H   H G KPYKC VC K + +  HL +H
Sbjct:  562 KCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKAFSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQH 638          

HSP 2 Score: 58.9214 bits (141), Expect = 5.863e-9
Identity = 36/101 (35.64%), Postives = 54/101 (53.47%), Query Frame = 2
Query:  449 NDCNKQKRKSTPVKLK------KSRCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            N C K+ RK  P  LK      K + ++C +C + F  +++L  H     G   Y+CH C  +F+QR++L  H   H G KPYKC  C K++ ++ HL  H
Sbjct:  371 NVCGKKFRKY-PSLLKHQSTHAKEKSYECEECGKEFRHISSLIAHQRMHTGEKPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIH 470          

HSP 3 Score: 55.8398 bits (133), Expect = 6.353e-8
Identity = 28/75 (37.33%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +KCN+C + F   ++L +H     G   YKC+ C+  F+QR+ L +H   H G KPY C +C K + +  +LI+H
Sbjct:  676 YKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLIQHQRIHTGEKPYACRICGKTFTQSTNLIQH 750          

HSP 4 Score: 54.299 bits (129), Expect = 2.047e-7
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            + CN C + F    NLT+H     G   YKC +C  +F+Q  +L +H   H G KP+KC +C K Y +  +L +H
Sbjct:  592 YICNICGKAFSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGANLTQH 666          

HSP 5 Score: 51.6026 bits (122), Expect = 1.288e-6
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            ++C+QC + F    +LT H  ++H     YKC  C   F+QR++L  H   H G KPYKC  C K +     LI H
Sbjct:  424 YECHQCGKAFSQRAHLTIHQ-RIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPYKCLECGKTFSHSSSLINH 498          

HSP 6 Score: 50.8322 bits (120), Expect = 2.798e-6
Identity = 27/75 (36.00%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +KC+ C + F    +LT+H    +G   +KC+IC  ++ Q +NL +H   H G KPYKC  C K +     L +H
Sbjct:  620 YKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGANLTQHQRIHTGEKPYKCNECGKAFIYSSSLNQH 694          

HSP 7 Score: 49.2914 bits (116), Expect = 7.707e-6
Identity = 28/76 (36.84%), Postives = 43/76 (56.58%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +KC +C + F   ++L  H  +VH     Y C+ C  +F+Q ++L +H   H G KPYKC  C K + +  +LIRH
Sbjct:  480 YKCLECGKTFSHSSSLINHQ-RVHTGEKPYICNECGKTFSQSTHLLQHQKIHTGKKPYKCNECWKVFSQSTYLIRH 554          
BLAST of ZFP-1 vs. Ensembl Human
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 67.0106 bits (162), Expect = 1.537e-11
Identity = 44/123 (35.77%), Postives = 61/123 (49.59%), Query Frame = 2
Query:  398 PKSHSMSGFFPLQMTTMNDC----NKQKRKSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISF 736
            PK+ S +   P     MN      N    K+ P  LKK      ++CN C + F  L+NL  H L+VH     +KC  CN  FTQ ++LQ+H L H G KP++C VC K +    +L  H+  
Sbjct:  495 PKATSAAMAAPSSDEAMNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVH-LRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRL 616          

HSP 2 Score: 55.0694 bits (131), Expect = 1.318e-7
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKC  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KPY+C VC  ++ +  HL  H
Sbjct:  565 RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLH 641          
BLAST of ZFP-1 vs. Ensembl Celegans
Match: ztf-16 (Zinc finger putative Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:H2L008])

HSP 1 Score: 62.3882 bits (150), Expect = 1.614e-10
Identity = 22/47 (46.81%), Postives = 32/47 (68.09%), Query Frame = 2
Query:  587 YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            Y+C IC   F+Q++N+ RH +RH G KPY+C  C K ++RKD +  H
Sbjct:  133 YQCDICKMQFSQKANMHRHRMRHSGVKPYECRFCKKRFFRKDQMQEH 179          
BLAST of ZFP-1 vs. Ensembl Celegans
Match: pag-3 (Zinc finger protein PAG-3 [Source:UniProtKB/TrEMBL;Acc:G5EDE1])

HSP 1 Score: 61.2326 bits (147), Expect = 2.431e-10
Identity = 30/84 (35.71%), Postives = 46/84 (54.76%), Query Frame = 2
Query:  500 SRCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHP 745
            +R + C  C + F   +++ +HT    G   +KC +C  +F+Q SNL  H  +H GFKP+ C VC + + RK    RH   +HP
Sbjct:  179 TRPYPCEYCGKRFHQKSDMKKHTYIHTGEKPHKCTVCGKAFSQSSNLITHTRKHTGFKPFACDVCGRTFQRKVDRRRHRESHHP 262          

HSP 2 Score: 53.1434 bits (126), Expect = 1.196e-7
Identity = 34/112 (30.36%), Postives = 57/112 (50.89%), Query Frame = 2
Query:  482 PVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFI 808
            PV++K    F C +C ++F  +  L +H  QVH S   ++C  C  +F + S L  H L H   +PY C  C K +++K  + +H ++ H    P +  +   + S+S N I
Sbjct:  120 PVEIKP---FHCQKCTKLFSTIAALEQHQ-QVHVSDKQFECKQCGKTFKRSSTLSTHLLIHSDTRPYPCEYCGKRFHQKSDMKKH-TYIHTGEKPHKCTVCGKAFSQSSNLI 226          
BLAST of ZFP-1 vs. Ensembl Celegans
Match: ztf-16 (Zinc finger putative Transcription Factor family [Source:UniProtKB/TrEMBL;Acc:H2L008])

HSP 1 Score: 61.6178 bits (148), Expect = 2.750e-10
Identity = 22/47 (46.81%), Postives = 32/47 (68.09%), Query Frame = 2
Query:  587 YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            Y+C IC   F+Q++N+ RH +RH G KPY+C  C K ++RKD +  H
Sbjct:  133 YQCDICKMQFSQKANMHRHRMRHSGVKPYECRFCKKRFFRKDQMQEH 179          
BLAST of ZFP-1 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 59.3066 bits (142), Expect = 1.863e-9
Identity = 27/76 (35.53%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            + C  C + F  L+NL  H     G   +KC IC   FTQ ++LQ+H L H G +P++C +C K +    +L  H+
Sbjct:  508 YACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHL 583          

HSP 2 Score: 52.7582 bits (125), Expect = 2.698e-7
Identity = 27/78 (34.62%), Postives = 39/78 (50.00%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R  +C+ C + F   +NL  H L++H     Y C +C+  FTQ  +L+ H   H   +PY CG C K+Y     L  H
Sbjct:  562 RPHRCDICDKRFSSTSNLKTH-LRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTH 638          
BLAST of ZFP-1 vs. Ensembl Celegans
Match: blmp-1 (B lymphocyte-induced maturation protein 1 homolog [Source:UniProtKB/Swiss-Prot;Acc:Q93560])

HSP 1 Score: 59.3066 bits (142), Expect = 1.988e-9
Identity = 27/76 (35.53%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            + C  C + F  L+NL  H     G   +KC IC   FTQ ++LQ+H L H G +P++C +C K +    +L  H+
Sbjct:  508 YACKDCNKTFGQLSNLKVHVRTHTGERPFKCEICTKEFTQLAHLQKHHLVHTGERPHRCDICDKRFSSTSNLKTHL 583          

HSP 2 Score: 52.373 bits (124), Expect = 2.879e-7
Identity = 27/78 (34.62%), Postives = 39/78 (50.00%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R  +C+ C + F   +NL  H L++H     Y C +C+  FTQ  +L+ H   H   +PY CG C K+Y     L  H
Sbjct:  562 RPHRCDICDKRFSSTSNLKTH-LRLHNGQKPYTCDVCDAKFTQYVHLRLHKRLHANERPYSCGTCGKKYISPSGLRTH 638          
BLAST of ZFP-1 vs. Ensembl Fly
Match: CG12769 (gene:FBgn0033252 transcript:FBtr0088828)

HSP 1 Score: 67.0106 bits (162), Expect = 7.569e-12
Identity = 23/49 (46.94%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  587 YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHIS 733
            ++C +CN  F+  +N++RH +RH G KPY+C VC K ++RKDHL  H +
Sbjct:  185 FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFT 233          
BLAST of ZFP-1 vs. Ensembl Fly
Match: CG12769 (gene:FBgn0033252 transcript:FBtr0088827)

HSP 1 Score: 67.0106 bits (162), Expect = 7.757e-12
Identity = 23/49 (46.94%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  587 YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHIS 733
            ++C +CN  F+  +N++RH +RH G KPY+C VC K ++RKDHL  H +
Sbjct:  181 FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFT 229          
BLAST of ZFP-1 vs. Ensembl Fly
Match: CG12769 (gene:FBgn0033252 transcript:FBtr0339281)

HSP 1 Score: 67.0106 bits (162), Expect = 8.243e-12
Identity = 23/49 (46.94%), Postives = 35/49 (71.43%), Query Frame = 2
Query:  587 YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHIS 733
            ++C +CN  F+  +N++RH +RH G KPY+C VC K ++RKDHL  H +
Sbjct:  181 FECDVCNMKFSNGANMRRHKMRHTGVKPYECRVCQKRFFRKDHLAEHFT 229          
BLAST of ZFP-1 vs. Ensembl Fly
Match: Blimp-1 (gene:FBgn0035625 transcript:FBtr0331808)

HSP 1 Score: 63.929 bits (154), Expect = 7.961e-11
Identity = 36/103 (34.95%), Postives = 56/103 (54.37%), Query Frame = 2
Query:  449 NDCNKQKRKSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN 739
            N    +  +S P  LKK      ++CN C + F  L+NL  H L+ H     +KC++C  SFTQ ++LQ+H L H G KP++C +C K +    +L  H+  +
Sbjct:  854 NSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVH-LRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLH 955          

HSP 2 Score: 54.6842 bits (130), Expect = 7.420e-8
Identity = 30/77 (38.96%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKCN C + F  L +L +H L   G   ++C IC   F+  SNL+ H   H G KPY C +C +++ +  HL  H
Sbjct:  903 RPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLH 979          
BLAST of ZFP-1 vs. Ensembl Fly
Match: Blimp-1 (gene:FBgn0035625 transcript:FBtr0345593)

HSP 1 Score: 63.929 bits (154), Expect = 7.961e-11
Identity = 36/103 (34.95%), Postives = 56/103 (54.37%), Query Frame = 2
Query:  449 NDCNKQKRKSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN 739
            N    +  +S P  LKK      ++CN C + F  L+NL  H L+ H     +KC++C  SFTQ ++LQ+H L H G KP++C +C K +    +L  H+  +
Sbjct:  854 NSLASRGYRSLPYPLKKKDGKMHYECNVCCKTFGQLSNLKVH-LRTHSGERPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLH 955          

HSP 2 Score: 54.6842 bits (130), Expect = 7.420e-8
Identity = 30/77 (38.96%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKCN C + F  L +L +H L   G   ++C IC   F+  SNL+ H   H G KPY C +C +++ +  HL  H
Sbjct:  903 RPFKCNVCTKSFTQLAHLQKHHLVHTGEKPHQCDICKKRFSSTSNLKTHLRLHSGQKPYACDLCPQKFTQFVHLKLH 979          
BLAST of ZFP-1 vs. Ensembl Zebrafish
Match: prdm1a (PR domain containing 1a, with ZNF domain [Source:ZFIN;Acc:ZDB-GENE-030131-2193])

HSP 1 Score: 65.4698 bits (158), Expect = 3.517e-11
Identity = 41/107 (38.32%), Postives = 58/107 (54.21%), Query Frame = 2
Query:  452 DCNKQKRKSTPVK-----LKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN 739
            + +K KR ST  K     LKK      ++CN C + F  L+NL  H L+VH     +KC  CN  FTQ ++LQ+H L H G KP++C VC K +    +L  H+  +
Sbjct:  495 NLSKMKRGSTGYKSLDYPLKKQNGKIKYECNVCTKTFGQLSNLKVH-LRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLH 600          

HSP 2 Score: 54.299 bits (129), Expect = 1.457e-7
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKC  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KPY+C +C  ++ +  HL  H
Sbjct:  548 RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKICPAKFTQFVHLKLH 624          
BLAST of ZFP-1 vs. Ensembl Zebrafish
Match: ZBTB26 (si:ch211-236k19.4 [Source:ZFIN;Acc:ZDB-GENE-060526-122])

HSP 1 Score: 64.6994 bits (156), Expect = 4.303e-11
Identity = 27/75 (36.00%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  512 KCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISF 736
            +C +C ++F  L N   H L++H  + C +C  +FTQ+ NL RH   H G KP++C +C K + +K  L+ H++ 
Sbjct:  291 QCPKCARVFRQLENYANH-LKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFTQKCSLLDHLNL 364          

HSP 2 Score: 49.6766 bits (117), Expect = 2.960e-6
Identity = 29/87 (33.33%), Postives = 43/87 (49.43%), Query Frame = 2
Query:  491 LKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNH 742
            LK  + F C  C + F    NL  H ++VH     ++C IC  +FTQ+ +L  H   H G KP++C  C   +  K  L +H+   H
Sbjct:  309 LKMHKLFMCLLCGKTFTQKGNLHRH-MRVHAGIKPFQCKICGKTFTQKCSLLDHLNLHSGDKPHRCNYCDMVFAHKPVLRKHLKQIH 394          
BLAST of ZFP-1 vs. Ensembl Zebrafish
Match: ZBTB26 (si:ch211-236k19.4 [Source:ZFIN;Acc:ZDB-GENE-060526-122])

HSP 1 Score: 64.6994 bits (156), Expect = 4.303e-11
Identity = 27/75 (36.00%), Postives = 45/75 (60.00%), Query Frame = 2
Query:  512 KCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISF 736
            +C +C ++F  L N   H L++H  + C +C  +FTQ+ NL RH   H G KP++C +C K + +K  L+ H++ 
Sbjct:  291 QCPKCARVFRQLENYANH-LKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFTQKCSLLDHLNL 364          

HSP 2 Score: 49.6766 bits (117), Expect = 2.960e-6
Identity = 29/87 (33.33%), Postives = 43/87 (49.43%), Query Frame = 2
Query:  491 LKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNH 742
            LK  + F C  C + F    NL  H ++VH     ++C IC  +FTQ+ +L  H   H G KP++C  C   +  K  L +H+   H
Sbjct:  309 LKMHKLFMCLLCGKTFTQKGNLHRH-MRVHAGIKPFQCKICGKTFTQKCSLLDHLNLHSGDKPHRCNYCDMVFAHKPVLRKHLKQIH 394          
BLAST of ZFP-1 vs. Ensembl Zebrafish
Match: znf740a (zinc finger protein 740a [Source:ZFIN;Acc:ZDB-GENE-030131-5064])

HSP 1 Score: 56.225 bits (134), Expect = 4.080e-10
Identity = 26/62 (41.94%), Postives = 36/62 (58.06%), Query Frame = 2
Query:  587 YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENII 772
            Y C +C+  F QR +LQRH+L H G KPY C +C   ++++ HL RH S  H  + P    I
Sbjct:    7 YACSMCDRRFFQRYHLQRHSLTHTGVKPYACSICDMRFFQRYHLQRH-SLTHTEIKPFACTI 67          

HSP 2 Score: 46.2098 bits (108), Expect = 1.616e-6
Identity = 24/66 (36.36%), Postives = 36/66 (54.55%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEY 700
            + C+ C + F    +L  H+L   G   Y C IC+  F QR +LQRH+L H   KP+ C +C  ++
Sbjct:    7 YACSMCDRRFFQRYHLQRHSLTHTGVKPYACSICDMRFFQRYHLQRHSLTHTEIKPFACTICHIDF 72          
BLAST of ZFP-1 vs. Ensembl Zebrafish
Match: gfi1b (growth factor independent 1B transcription repressor [Source:ZFIN;Acc:ZDB-GENE-091118-129])

HSP 1 Score: 61.2326 bits (147), Expect = 4.570e-10
Identity = 31/85 (36.47%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  500 SRCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            +R + C  C + F   +++ +HT    G   +KC +C  +F+Q SNL  H+ +H GFKP+ C +CSK + RK  L RH    H +
Sbjct:  249 TRPYPCQYCGKRFHQKSDMKKHTYIHTGEKPHKCQVCGKAFSQSSNLITHSRKHTGFKPFGCEICSKGFQRKVDLRRHHESQHSL 333          
BLAST of ZFP-1 vs. Ensembl Xenopus
Match: chac2 (ChaC, cation transport regulator homolog 2 [Source:Xenbase;Acc:XB-GENE-5817326])

HSP 1 Score: 65.4698 bits (158), Expect = 4.911e-11
Identity = 38/100 (38.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  458 NKQKRKSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN 739
            N    K+ P  LKK      ++CN C + F  L+NL  H L+VH     +KC  CN  FTQ ++LQ+H L H G KP++C VC K +    +L  H+  +
Sbjct:  483 NMTGYKTLPYPLKKQNGKIKYECNVCSKTFGQLSNLKVH-LRVHSGERPFKCQTCNKGFTQLAHLQKHFLVHTGEKPHECQVCHKRFSSTSNLKTHLRLH 581          

HSP 2 Score: 52.7582 bits (125), Expect = 6.553e-7
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKC  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KPY+C +C  ++ +  HL  H
Sbjct:  529 RPFKCQTCNKGFTQLAHLQKHFLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKLCPAKFTQFVHLKLH 605          

HSP 3 Score: 49.6766 bits (117), Expect = 5.209e-6
Identity = 42/140 (30.00%), Postives = 64/140 (45.71%), Query Frame = 2
Query:  512 KCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENI-----------IQRLSSSESLNFIDSQEDSDA--KLENEFSS-FRPESDNS 880
            +C  C + F   +NL  H L++H     Y+C +C   FTQ  +L+ H   H   +P+KC  C K Y     L  H+  N P VSP+  +           I++   S+S + +D  ED D    +E E  +  R E D +
Sbjct:  560 ECQVCHKRFSSTSNLKTH-LRLHSGEKPYQCKLCPAKFTQFVHLKLHKRLHTRERPHKCIHCHKSYIHLCSLNFHMKGNCP-VSPRLGVSREDLNRMNEEIEKFDISDSADRLDDMEDMDMSPAVEKEIMTLLRREIDGA 697          
BLAST of ZFP-1 vs. Ensembl Xenopus
Match: chac2 (ChaC, cation transport regulator homolog 2 [Source:Xenbase;Acc:XB-GENE-5817326])

HSP 1 Score: 65.4698 bits (158), Expect = 5.031e-11
Identity = 38/100 (38.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  458 NKQKRKSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN 739
            N    K+ P  LKK      ++CN C + F  L+NL  H L+VH     +KC  CN  FTQ ++LQ+H L H G KP++C VC K +    +L  H+  +
Sbjct:  514 NMTGYKTLPYPLKKQNGKIKYECNVCSKTFGQLSNLKVH-LRVHSGERPFKCQTCNKGFTQLAHLQKHFLVHTGEKPHECQVCHKRFSSTSNLKTHLRLH 612          

HSP 2 Score: 52.7582 bits (125), Expect = 6.574e-7
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKC  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KPY+C +C  ++ +  HL  H
Sbjct:  560 RPFKCQTCNKGFTQLAHLQKHFLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKLCPAKFTQFVHLKLH 636          

HSP 3 Score: 49.6766 bits (117), Expect = 5.222e-6
Identity = 42/140 (30.00%), Postives = 64/140 (45.71%), Query Frame = 2
Query:  512 KCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENI-----------IQRLSSSESLNFIDSQEDSDA--KLENEFSS-FRPESDNS 880
            +C  C + F   +NL  H L++H     Y+C +C   FTQ  +L+ H   H   +P+KC  C K Y     L  H+  N P VSP+  +           I++   S+S + +D  ED D    +E E  +  R E D +
Sbjct:  591 ECQVCHKRFSSTSNLKTH-LRLHSGEKPYQCKLCPAKFTQFVHLKLHKRLHTRERPHKCIHCHKSYIHLCSLNFHMKGNCP-VSPRLGVSREDLNRMNEEIEKFDISDSADRLDDMEDMDMSPAVEKEIMTLLRREIDGA 728          
BLAST of ZFP-1 vs. Ensembl Xenopus
Match: slc3a2 (solute carrier family 3 (amino acid transporter heavy chain), member 2 [Source:Xenbase;Acc:XB-GENE-1009245])

HSP 1 Score: 63.1586 bits (152), Expect = 2.576e-10
Identity = 42/147 (28.57%), Postives = 67/147 (45.58%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDSQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENI 934
            R F+C+ C + F     L  H + VH     +KC +C  SF +  NL  H   H G+KP+KC  CS ++  K +L RH+   H ++         L S + +  +  Q+  D     E   +  ES   Y   EN  +N+ + E+ +
Sbjct:  523 RPFQCHICFKTFVQKQTLKTHMI-VHSPVKPFKCKVCGKSFNRMYNLLGHMHLHAGYKPFKCPYCSSKFNLKGNLSRHMKVKHGVMDIG------LDSQDPMMDLPDQDARDMDGHQEMEDYE-ESSYGYREAENTAENHVLTEQTM 661          

HSP 2 Score: 59.3066 bits (142), Expect = 4.887e-9
Identity = 28/90 (31.11%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  485 VKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            +K +  R F C +C   F  +++L +H+L   G   +KC +C   FT  +N++RH L H   +P++C +C K + +K  L  H+  + P+
Sbjct:  461 LKHQNVRPFVCKECGMEFSQIHHLKQHSLTHKGVKEFKCEVCGREFTLHANMKRHMLIHASVRPFQCHICFKTFVQKQTLKTHMIVHSPV 550          

HSP 3 Score: 54.299 bits (129), Expect = 1.699e-7
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  515 CNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYR----KDHLIRH 727
            C  C ++F   ++L  H L   G+  +KC +CN +FTQ S+L+RH L H   KPY C  C + +      K H ++H
Sbjct:  331 CPHCNKLFKQPSHLQTHLLTHQGTRPHKCEVCNKAFTQTSHLKRHMLLHTDIKPYSCRFCGRGFAYPSELKAHEVKH 407          

HSP 4 Score: 54.299 bits (129), Expect = 2.011e-7
Identity = 29/76 (38.16%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            ++C  C + +    NL  H L   G   + C  CN  F Q S+LQ H L H G +P+KC VC+K + +  HL RH+
Sbjct:  301 WQCRMCEKSYTSKYNLVTHILGHSGIKPHSCPHCNKLFKQPSHLQTHLLTHQGTRPHKCEVCNKAFTQTSHLKRHM 376          
BLAST of ZFP-1 vs. Ensembl Xenopus
Match: slc3a2 (solute carrier family 3 (amino acid transporter heavy chain), member 2 [Source:Xenbase;Acc:XB-GENE-1009245])

HSP 1 Score: 63.1586 bits (152), Expect = 2.923e-10
Identity = 42/147 (28.57%), Postives = 67/147 (45.58%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDSQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENI 934
            R F+C+ C + F     L  H + VH     +KC +C  SF +  NL  H   H G+KP+KC  CS ++  K +L RH+   H ++         L S + +  +  Q+  D     E   +  ES   Y   EN  +N+ + E+ +
Sbjct:  553 RPFQCHICFKTFVQKQTLKTHMI-VHSPVKPFKCKVCGKSFNRMYNLLGHMHLHAGYKPFKCPYCSSKFNLKGNLSRHMKVKHGVMDIG------LDSQDPMMDLPDQDARDMDGHQEMEDYE-ESSYGYREAENTAENHVLTEQTM 691          

HSP 2 Score: 59.3066 bits (142), Expect = 4.973e-9
Identity = 28/90 (31.11%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  485 VKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            +K +  R F C +C   F  +++L +H+L   G   +KC +C   FT  +N++RH L H   +P++C +C K + +K  L  H+  + P+
Sbjct:  491 LKHQNVRPFVCKECGMEFSQIHHLKQHSLTHKGVKEFKCEVCGREFTLHANMKRHMLIHASVRPFQCHICFKTFVQKQTLKTHMIVHSPV 580          

HSP 3 Score: 54.299 bits (129), Expect = 1.742e-7
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  515 CNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYR----KDHLIRH 727
            C  C ++F   ++L  H L   G+  +KC +CN +FTQ S+L+RH L H   KPY C  C + +      K H ++H
Sbjct:  361 CPHCNKLFKQPSHLQTHLLTHQGTRPHKCEVCNKAFTQTSHLKRHMLLHTDIKPYSCRFCGRGFAYPSELKAHEVKH 437          

HSP 4 Score: 54.299 bits (129), Expect = 2.007e-7
Identity = 29/76 (38.16%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            ++C  C + +    NL  H L   G   + C  CN  F Q S+LQ H L H G +P+KC VC+K + +  HL RH+
Sbjct:  331 WQCRMCEKSYTSKYNLVTHILGHSGIKPHSCPHCNKLFKQPSHLQTHLLTHQGTRPHKCEVCNKAFTQTSHLKRHM 406          
BLAST of ZFP-1 vs. Ensembl Xenopus
Match: slc3a2 (solute carrier family 3 (amino acid transporter heavy chain), member 2 [Source:Xenbase;Acc:XB-GENE-1009245])

HSP 1 Score: 62.7734 bits (151), Expect = 3.204e-10
Identity = 42/147 (28.57%), Postives = 67/147 (45.58%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDSQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENI 934
            R F+C+ C + F     L  H + VH     +KC +C  SF +  NL  H   H G+KP+KC  CS ++  K +L RH+   H ++         L S + +  +  Q+  D     E   +  ES   Y   EN  +N+ + E+ +
Sbjct:  542 RPFQCHICFKTFVQKQTLKTHMI-VHSPVKPFKCKVCGKSFNRMYNLLGHMHLHAGYKPFKCPYCSSKFNLKGNLSRHMKVKHGVMDIG------LDSQDPMMDLPDQDARDMDGHQEMEDYE-ESSYGYREAENTAENHVLTEQTM 680          

HSP 2 Score: 58.9214 bits (141), Expect = 5.908e-9
Identity = 28/90 (31.11%), Postives = 50/90 (55.56%), Query Frame = 2
Query:  485 VKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            +K +  R F C +C   F  +++L +H+L   G   +KC +C   FT  +N++RH L H   +P++C +C K + +K  L  H+  + P+
Sbjct:  480 LKHQNVRPFVCKECGMEFSQIHHLKQHSLTHKGVKEFKCEVCGREFTLHANMKRHMLIHASVRPFQCHICFKTFVQKQTLKTHMIVHSPV 569          

HSP 3 Score: 53.9138 bits (128), Expect = 2.086e-7
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  515 CNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYR----KDHLIRH 727
            C  C ++F   ++L  H L   G+  +KC +CN +FTQ S+L+RH L H   KPY C  C + +      K H ++H
Sbjct:  350 CPHCNKLFKQPSHLQTHLLTHQGTRPHKCEVCNKAFTQTSHLKRHMLLHTDIKPYSCRFCGRGFAYPSELKAHEVKH 426          

HSP 4 Score: 53.9138 bits (128), Expect = 2.447e-7
Identity = 29/76 (38.16%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            ++C  C + +    NL  H L   G   + C  CN  F Q S+LQ H L H G +P+KC VC+K + +  HL RH+
Sbjct:  320 WQCRMCEKSYTSKYNLVTHILGHSGIKPHSCPHCNKLFKQPSHLQTHLLTHQGTRPHKCEVCNKAFTQTSHLKRHM 395          
BLAST of ZFP-1 vs. Ensembl Mouse
Match: Zfp341 (zinc finger protein 341 [Source:MGI Symbol;Acc:MGI:2682937])

HSP 1 Score: 68.9366 bits (167), Expect = 2.955e-12
Identity = 44/116 (37.93%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  428 PLQMTTMNDCNKQKRK-STPVKLK-----KSRCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            P + +T+  C K   K STP  L+      +  F C  C+++FPC   L  H L  HGS   ++C IC   F +   L+ HA  H G KPYKC VC   + RKD L RH+  + P 
Sbjct:  530 PKKDSTVYKCVKCVNKYSTPEALEHHVQTATHSFPCPHCQKVFPCERYLRRH-LPTHGSGGRFRCQICKKFFRKEHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPF 644          

HSP 2 Score: 59.3066 bits (142), Expect = 4.128e-9
Identity = 36/104 (34.62%), Postives = 51/104 (49.04%), Query Frame = 2
Query:  455 CNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHG-------SYKCHICNTSFTQRSNLQRHALRHVGFKPYKC-----GVCSKEYYRKDHLIRHI 730
            C +  R+  P      R F+C  C++ F       EH L++H         YKC +C ++F ++  L+RH L H  FK YKC       CSKE+ R+D L  HI
Sbjct:  574 CERYLRRHLPTHGSGGR-FRCQICKKFF-----RKEHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSMHTGCSKEFNRQDKLKAHI 671          

HSP 3 Score: 54.299 bits (129), Expect = 1.259e-7
Identity = 43/140 (30.71%), Postives = 63/140 (45.00%), Query Frame = 2
Query:  347 PHVFQTLFTSRPILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKL-----KKSRCFKCNQCRQIFPCLNNLTEHTLQVH---GSYKCHI-----CNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            PH  +     R +  ++P +H   G F  Q+     C K  RK   +KL        + +KC+ C   F   + L  H L +H     YKC       C+  F ++  L+ H L H G K +KCG+CSK + R+ HL  H
Sbjct:  566 PHCQKVFPCERYLRRHLP-THGSGGRFRCQI-----CKKFFRKEHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHML-IHEPFKKYKCPFSMHTGCSKEFNRQDKLKAHILSHAGLKLHKCGLCSKSFSRRAHLAEH 698          
BLAST of ZFP-1 vs. Ensembl Mouse
Match: Zfp341 (zinc finger protein 341 [Source:MGI Symbol;Acc:MGI:2682937])

HSP 1 Score: 68.9366 bits (167), Expect = 3.083e-12
Identity = 44/116 (37.93%), Postives = 59/116 (50.86%), Query Frame = 2
Query:  428 PLQMTTMNDCNKQKRK-STPVKLK-----KSRCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            P + +T+  C K   K STP  L+      +  F C  C+++FPC   L  H L  HGS   ++C IC   F +   L+ HA  H G KPYKC VC   + RKD L RH+  + P 
Sbjct:  523 PKKDSTVYKCVKCVNKYSTPEALEHHVQTATHSFPCPHCQKVFPCERYLRRH-LPTHGSGGRFRCQICKKFFRKEHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPF 637          

HSP 2 Score: 58.9214 bits (141), Expect = 4.422e-9
Identity = 36/104 (34.62%), Postives = 51/104 (49.04%), Query Frame = 2
Query:  455 CNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHG-------SYKCHICNTSFTQRSNLQRHALRHVGFKPYKC-----GVCSKEYYRKDHLIRHI 730
            C +  R+  P      R F+C  C++ F       EH L++H         YKC +C ++F ++  L+RH L H  FK YKC       CSKE+ R+D L  HI
Sbjct:  567 CERYLRRHLPTHGSGGR-FRCQICKKFF-----RKEHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPFKKYKCPFSMHTGCSKEFNRQDKLKAHI 664          

HSP 3 Score: 54.6842 bits (130), Expect = 1.212e-7
Identity = 43/140 (30.71%), Postives = 63/140 (45.00%), Query Frame = 2
Query:  347 PHVFQTLFTSRPILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKL-----KKSRCFKCNQCRQIFPCLNNLTEHTLQVH---GSYKCHI-----CNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            PH  +     R +  ++P +H   G F  Q+     C K  RK   +KL        + +KC+ C   F   + L  H L +H     YKC       C+  F ++  L+ H L H G K +KCG+CSK + R+ HL  H
Sbjct:  559 PHCQKVFPCERYLRRHLP-THGSGGRFRCQI-----CKKFFRKEHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHML-IHEPFKKYKCPFSMHTGCSKEFNRQDKLKAHILSHAGLKLHKCGLCSKSFSRRAHLAEH 691          
BLAST of ZFP-1 vs. Ensembl Mouse
Match: Prdm1 (PR domain containing 1, with ZNF domain [Source:MGI Symbol;Acc:MGI:99655])

HSP 1 Score: 67.781 bits (164), Expect = 7.275e-12
Identity = 39/100 (39.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  449 NDCNKQKRKSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            N  N    K+ P  LKK      ++CN C + F  L+NL  H L+VH     +KC  CN  FTQ ++LQ+H L H G KP++C VC K +    +L  H+
Sbjct:  550 NKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVH-LRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHL 648          

HSP 2 Score: 55.0694 bits (131), Expect = 7.085e-8
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKC  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KPY+C VC  ++ +  HL  H
Sbjct:  599 RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLH 675          
BLAST of ZFP-1 vs. Ensembl Mouse
Match: Prdm1 (PR domain containing 1, with ZNF domain [Source:MGI Symbol;Acc:MGI:99655])

HSP 1 Score: 67.3958 bits (163), Expect = 8.305e-12
Identity = 39/100 (39.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  449 NDCNKQKRKSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            N  N    K+ P  LKK      ++CN C + F  L+NL  H L+VH     +KC  CN  FTQ ++LQ+H L H G KP++C VC K +    +L  H+
Sbjct:  565 NKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVH-LRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHL 663          

HSP 2 Score: 55.0694 bits (131), Expect = 7.578e-8
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKC  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KPY+C VC  ++ +  HL  H
Sbjct:  614 RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLH 690          
BLAST of ZFP-1 vs. Ensembl Mouse
Match: Prdm1 (PR domain containing 1, with ZNF domain [Source:MGI Symbol;Acc:MGI:99655])

HSP 1 Score: 67.3958 bits (163), Expect = 9.837e-12
Identity = 39/100 (39.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  449 NDCNKQKRKSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            N  N    K+ P  LKK      ++CN C + F  L+NL  H L+VH     +KC  CN  FTQ ++LQ+H L H G KP++C VC K +    +L  H+
Sbjct:  583 NKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVH-LRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHL 681          

HSP 2 Score: 55.0694 bits (131), Expect = 9.181e-8
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKC  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KPY+C VC  ++ +  HL  H
Sbjct:  632 RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLH 708          
BLAST of ZFP-1 vs. UniProt/SwissProt
Match: sp|Q9BYN7|ZN341_HUMAN (Zinc finger protein 341 OS=Homo sapiens OX=9606 GN=ZNF341 PE=1 SV=2)

HSP 1 Score: 68.9366 bits (167), Expect = 1.947e-11
Identity = 35/83 (42.17%), Postives = 45/83 (54.22%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            F C  C+++FPC   L  H L  HGS   +KC +C   F +   L+ HA  H G KPYKC VC   + RKD L RH+  + P 
Sbjct:  566 FPCPHCQKVFPCERYLRRH-LPTHGSGGRFKCQVCKKFFRREHYLKLHAHIHSGEKPYKCSVCESAFNRKDKLKRHMLIHEPF 647          
BLAST of ZFP-1 vs. UniProt/SwissProt
Match: sp|A2T812|ZN287_PONPY (Zinc finger protein 287 OS=Pongo pygmaeus OX=9600 GN=ZNF287 PE=3 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 4.436e-11
Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +C+KCN+C + F   + L +H     G  SY C+IC  +F+Q +NL +H   H G KPYKC VC K + +  HL +H
Sbjct:  562 KCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKAFSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQH 638          

HSP 2 Score: 59.3066 bits (142), Expect = 2.575e-8
Identity = 36/101 (35.64%), Postives = 54/101 (53.47%), Query Frame = 2
Query:  449 NDCNKQKRKSTPVKLK------KSRCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            N C K+ RK  P  LK      K + ++C +C + F  +++L  H     G   Y+CH C  +F+QR++L  H   H G KPYKC  C K++ ++ HL  H
Sbjct:  371 NVCGKKFRKY-PSLLKHQSTHAKEKSYECEECGKEFRHISSLIAHQRMHTGEKPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIH 470          

HSP 3 Score: 55.8398 bits (133), Expect = 2.792e-7
Identity = 28/75 (37.33%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +KCN+C + F   ++L +H     G   YKC+ C+  F+QR+ L +H   H G KPY C +C K + +  +LI+H
Sbjct:  676 YKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLIQHQRIHTGEKPYACRICGKTFTQSTNLIQH 750          

HSP 4 Score: 54.299 bits (129), Expect = 8.762e-7
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            + CN C + F    NLT+H     G   YKC +C  +F+Q  +L +H   H G KP+KC +C K Y +  +L +H
Sbjct:  592 YICNICGKAFSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGANLTQH 666          

HSP 5 Score: 51.9878 bits (123), Expect = 5.762e-6
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            ++C+QC + F    +LT H  ++H     YKC  C   F+QR++L  H   H G KPYKC  C K +     LI H
Sbjct:  424 YECHQCGKAFSQRAHLTIHQ-RIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPYKCLECGKTFSHSSSLINH 498          
BLAST of ZFP-1 vs. UniProt/SwissProt
Match: sp|Q9HBT7|ZN287_HUMAN (Zinc finger protein 287 OS=Homo sapiens OX=9606 GN=ZNF287 PE=2 SV=2)

HSP 1 Score: 67.781 bits (164), Expect = 4.987e-11
Identity = 32/77 (41.56%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +C+KCN+C + F   + L +H     G  SY C+IC  +F+Q +NL +H   H G KPYKC VC K + +  HL +H
Sbjct:  562 KCYKCNECGKAFAHSSTLIQHQTTHTGEKSYICNICGKAFSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQH 638          

HSP 2 Score: 58.9214 bits (141), Expect = 2.815e-8
Identity = 36/101 (35.64%), Postives = 54/101 (53.47%), Query Frame = 2
Query:  449 NDCNKQKRKSTPVKLK------KSRCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            N C K+ RK  P  LK      K + ++C +C + F  +++L  H     G   Y+CH C  +F+QR++L  H   H G KPYKC  C K++ ++ HL  H
Sbjct:  371 NVCGKKFRKY-PSLLKHQSTHAKEKSYECEECGKEFRHISSLIAHQRMHTGEKPYECHQCGKAFSQRAHLTIHQRIHTGEKPYKCDDCGKDFSQRAHLTIH 470          

HSP 3 Score: 55.8398 bits (133), Expect = 3.051e-7
Identity = 28/75 (37.33%), Postives = 44/75 (58.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +KCN+C + F   ++L +H     G   YKC+ C+  F+QR+ L +H   H G KPY C +C K + +  +LI+H
Sbjct:  676 YKCNECGKAFIYSSSLNQHQRTHTGERPYKCNECDKDFSQRTCLIQHQRIHTGEKPYACRICGKTFTQSTNLIQH 750          

HSP 4 Score: 54.299 bits (129), Expect = 9.831e-7
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            + CN C + F    NLT+H     G   YKC +C  +F+Q  +L +H   H G KP+KC +C K Y +  +L +H
Sbjct:  592 YICNICGKAFSQSANLTQHHRTHTGEKPYKCSVCGKAFSQSVHLTQHQRIHNGEKPFKCNICGKAYRQGANLTQH 666          

HSP 5 Score: 51.6026 bits (122), Expect = 6.183e-6
Identity = 29/76 (38.16%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            ++C+QC + F    +LT H  ++H     YKC  C   F+QR++L  H   H G KPYKC  C K +     LI H
Sbjct:  424 YECHQCGKAFSQRAHLTIHQ-RIHTGEKPYKCDDCGKDFSQRAHLTIHQRTHTGEKPYKCLECGKTFSHSSSLINH 498          
BLAST of ZFP-1 vs. UniProt/SwissProt
Match: sp|Q60636|PRDM1_MOUSE (PR domain zinc finger protein 1 OS=Mus musculus OX=10090 GN=Prdm1 PE=1 SV=1)

HSP 1 Score: 67.3958 bits (163), Expect = 6.881e-11
Identity = 39/100 (39.00%), Postives = 54/100 (54.00%), Query Frame = 2
Query:  449 NDCNKQKRKSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            N  N    K+ P  LKK      ++CN C + F  L+NL  H L+VH     +KC  CN  FTQ ++LQ+H L H G KP++C VC K +    +L  H+
Sbjct:  583 NKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVH-LRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHL 681          

HSP 2 Score: 55.0694 bits (131), Expect = 6.422e-7
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKC  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KPY+C VC  ++ +  HL  H
Sbjct:  632 RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLH 708          
BLAST of ZFP-1 vs. UniProt/SwissProt
Match: sp|O75626|PRDM1_HUMAN (PR domain zinc finger protein 1 OS=Homo sapiens OX=9606 GN=PRDM1 PE=1 SV=2)

HSP 1 Score: 67.0106 bits (162), Expect = 8.062e-11
Identity = 44/121 (36.36%), Postives = 61/121 (50.41%), Query Frame = 2
Query:  398 PKSHSMSGFFPLQMTTMNDC----NKQKRKSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            PK+ S +   P     MN      N    K+ P  LKK      ++CN C + F  L+NL  H L+VH     +KC  CN  FTQ ++LQ+H L H G KP++C VC K +    +L  H+
Sbjct:  531 PKATSAAMAAPSSDEAMNLIKNKRNMTGYKTLPYPLKKQNGKIKYECNVCAKTFGQLSNLKVH-LRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHL 650          

HSP 2 Score: 54.6842 bits (130), Expect = 6.883e-7
Identity = 29/77 (37.66%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKC  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KPY+C VC  ++ +  HL  H
Sbjct:  601 RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKVCPAKFTQFVHLKLH 677          
BLAST of ZFP-1 vs. TrEMBL
Match: H9CXV1 (ZFP-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 2
Query:   62 MNFMEQNNSLMKSFHQLLHSHWLNPLQVIPPVXXXXXXXXXXXXXXXXPGKSESSDQEEPLNLSLKYCDVQLSKSQNSPVPTNQFRLSSQIPLMIPHVFQTLFTSRPILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDSQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENIFLKVEPTDSMDVDILN 982
            MNFMEQNNSLMKSFHQLLHSHWLNPLQVIPPVSTRYSSYSSSTASFISPGKSESSDQEEPLNLSLKYCDVQLSKSQNSPVPTNQFRLSSQIPLMIPHVFQTLFTSRPILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDSQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENIFLKVEPTDSMDVDILN
Sbjct:    1 MNFMEQNNSLMKSFHQLLHSHWLNPLQVIPPVSTRYSSYSSSTASFISPGKSESSDQEEPLNLSLKYCDVQLSKSQNSPVPTNQFRLSSQIPLMIPHVFQTLFTSRPILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDSQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENIFLKVEPTDSMDVDILN 307          
BLAST of ZFP-1 vs. TrEMBL
Match: A0A0R3TQM7 (Uncharacterized protein OS=Rodentolepis nana OX=102285 GN=HNAJ_LOCUS9847 PE=4 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 6.018e-41
Identity = 71/119 (59.66%), Postives = 93/119 (78.15%), Query Frame = 2
Query:  467 KRKSTPVK--LKKSRCFKCNQCRQI-FPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDS 814
            K  STP +      + F CNQC  I FP L NL EHT+QVHGSY+CH+C+ +FTQRSNLQRHAL+HVGFKP++CG+C + YYRKDHL++HI  NHP V+P+ENI   LSSS+SL+++++
Sbjct:  193 KMTSTPKRRFTGGRKFFTCNQCNNIEFPSLQNLEEHTMQVHGSYRCHVCSRTFTQRSNLQRHALKHVGFKPFQCGICLQGYYRKDHLLKHIKVNHPAVNPRENIHVFLSSSQSLDYLNT 311          
BLAST of ZFP-1 vs. TrEMBL
Match: A0A183TS72 (Zinc finger protein Gfi-1b OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS19320 PE=4 SV=1)

HSP 1 Score: 154.836 bits (390), Expect = 1.528e-39
Identity = 77/167 (46.11%), Postives = 104/167 (62.28%), Query Frame = 2
Query:  500 SRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDSQEDS--------DAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENIF-LKVEPTDSMDVD 973
            SR F CNQCR  F  LN L +HTL  HGSYKCHIC   FTQRSNLQRHAL+H+GFKP++C VC K YYRKDHL+RH+   HP  +P+ENI+  L+SSESL+++D    S        D K+E++  + +  +      +E       + E  +   +VE  ++M+ D
Sbjct:  274 SRRFPCNQCRDEFFSLNALEQHTLAAHGSYKCHICKADFTQRSNLQRHALKHIGFKPFECRVCMKAYYRKDHLMRHMEMVHPGRAPRENIMVHLTSSESLDYLDRNRISGQLPIRSEDGKVEHDGETRKRRTGE----FEEQHTPTEVEERTVAETEVEAANTMEFD 436          
BLAST of ZFP-1 vs. TrEMBL
Match: A0A3P7NIJ0 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS5060 PE=4 SV=1)

HSP 1 Score: 155.221 bits (391), Expect = 1.951e-39
Identity = 74/150 (49.33%), Postives = 93/150 (62.00%), Query Frame = 2
Query:  443 TMNDCNKQKRKSTPVKLKK-------SRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFI---------DSQEDSDAKLEN 844
            T+   NK  R+  P            SR F CNQCR+ F  L++L EHT+  HG+Y+CHIC   FTQRSNLQRHAL+HVGFKP++C VC K YYRKDHL+RH+   HP  SP+ENI   L+SSESL+++         D   D D  L +
Sbjct:  231 TLQSPNKAVRRRGPPTAGSVARRPNISRRFPCNQCREEFSSLHSLEEHTMGAHGTYRCHICRARFTQRSNLQRHALKHVGFKPFECRVCRKAYYRKDHLMRHMEMGHPGYSPRENITVHLTSSESLDYLNRNMNGVVSDDTADEDVALAS 380          
BLAST of ZFP-1 vs. TrEMBL
Match: A0A0X3PAQ6 (Zinc finger E-box-binding homeobox 1 (Fragment) OS=Schistocephalus solidus OX=70667 GN=ZEB1 PE=4 SV=1)

HSP 1 Score: 156.377 bits (394), Expect = 2.605e-39
Identity = 73/146 (50.00%), Postives = 95/146 (65.07%), Query Frame = 2
Query:  443 TMNDCNKQKRKSTPVKLKK-------SRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFI----DSQEDSDAKLENE 847
            T+   NK  R+  P            SR F CNQCR+ F  L++L EHT+  HG+Y+CHIC   FTQRSNLQRHAL+HVGFKP++C VC K YYRKDHL+RH+   HP  SP+ENI   L+SSESL+++    +  E  D  ++N+
Sbjct:  322 TLQSPNKTIRRRGPSTAGSVARRPNISRRFPCNQCREEFSSLHSLEEHTMGTHGTYRCHICRARFTQRSNLQRHALKHVGFKPFECRVCRKAYYRKDHLMRHMEMGHPGYSPRENITVHLTSSESLDYLNRNMNGVEGDDPAVQND 467          
BLAST of ZFP-1 vs. Ensembl Cavefish
Match: prdm1a (PR/SET domain 1 [Source:NCBI gene;Acc:103047552])

HSP 1 Score: 65.4698 bits (158), Expect = 3.170e-11
Identity = 37/95 (38.95%), Postives = 53/95 (55.79%), Query Frame = 2
Query:  473 KSTPVKLKKSRC---FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN 739
            K+ P  LKK      ++CN C + F  L+NL  H L+VH     +KC  CN  FTQ ++LQ+H L H G KP++C VC K +    +L  H+  +
Sbjct:  497 KTLPYPLKKQNGKIKYECNVCSKTFGQLSNLKVH-LRVHSGERPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLH 590          

HSP 2 Score: 53.1434 bits (126), Expect = 2.597e-7
Identity = 28/77 (36.36%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            R FKC  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KPY+C +C  ++ +  HL  H
Sbjct:  538 RPFKCQTCNKGFTQLAHLQKHYLVHTGEKPHECQVCHKRFSSTSNLKTHLRLHSGEKPYQCKLCPAKFTQFVHLKLH 614          
BLAST of ZFP-1 vs. Ensembl Cavefish
Match: si:ch211-236k19.4 (zinc finger and BTB domain containing 26 [Source:HGNC Symbol;Acc:HGNC:23383])

HSP 1 Score: 64.6994 bits (156), Expect = 3.191e-11
Identity = 27/76 (35.53%), Postives = 46/76 (60.53%), Query Frame = 2
Query:  512 KCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN 739
            +C +C ++F  L N   H L++H  + C +C  +FTQ+ NL RH   H G KP++C +C K + +K  L+ H++ +
Sbjct:  259 QCPKCARVFRQLENYANH-LKMHKLFMCLLCGKTFTQKGNLHRHMRVHAGIKPFQCKICGKTFTQKCSLLDHLNLH 333          

HSP 2 Score: 50.0618 bits (118), Expect = 2.081e-6
Identity = 28/83 (33.73%), Postives = 42/83 (50.60%), Query Frame = 2
Query:  491 LKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            LK  + F C  C + F    NL  H ++VH     ++C IC  +FTQ+ +L  H   H G KP++C  C   +  K  L +H+
Sbjct:  277 LKMHKLFMCLLCGKTFTQKGNLHRH-MRVHAGIKPFQCKICGKTFTQKCSLLDHLNLHSGDKPHRCNYCDMVFAHKPVLRKHL 358          
BLAST of ZFP-1 vs. Ensembl Cavefish
Match: ENSAMXT00000046051.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:31212446:31242342:1 gene:ENSAMXG00000033001.1 transcript:ENSAMXT00000046051.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 1.627e-10
Identity = 31/85 (36.47%), Postives = 48/85 (56.47%), Query Frame = 2
Query:  494 KKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNH 742
            +K R FKC+ C + F   + L  H     G   +KC  C+ +F Q+S LQ H ++H G KPYKC VC+  + +K ++  H+  +H
Sbjct:  145 QKPRVFKCSSCDKAFAKPSQLERHVRTHTGERPFKCAQCDKAFNQKSALQVHTVKHTGQKPYKCEVCTISFTQKSNMKLHMKRSH 229          

HSP 2 Score: 50.447 bits (119), Expect = 1.032e-6
Identity = 28/88 (31.82%), Postives = 42/88 (47.73%), Query Frame = 2
Query:  497 KSRCFKCNQCRQIFPCLNNLTEHT-LQVHG---------SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            K RC  C  C + F    +L EH  + ++G          +KC  C+ +F + S L+RH   H G +P+KC  C K + +K  L  H 
Sbjct:  110 KERCHVCRVCNKAFKRATHLKEHEYVHLNGPTLSSQKPRVFKCSSCDKAFAKPSQLERHVRTHTGERPFKCAQCDKAFNQKSALQVHT 197          
BLAST of ZFP-1 vs. Ensembl Cavefish
Match: znf710b (zinc finger protein 710-like [Source:NCBI gene;Acc:103040070])

HSP 1 Score: 62.3882 bits (150), Expect = 2.863e-10
Identity = 45/156 (28.85%), Postives = 75/156 (48.08%), Query Frame = 2
Query:  494 KKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP------------KENIIQRLSSSESLNFIDSQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNS 916
            K  + FKC+ C + F    NL  H L +H S   ++CHIC  SF Q+  L+ H + H+  KP+KC VC K + R  +L+ H+   H    P            K N+ + +     ++   S +  DA  + E  +   E + ++ + EN D+N++
Sbjct:  543 KGIKGFKCDVCAREFTLSANLKRHML-IHASVRPFQCHICFKSFVQKQTLKTHMIVHLPVKPFKCKVCGKSFNRMYNLLGHMHL-HAGSKPFKCTYCSSRFNLKGNLSRHMKVKHGMDV--SPDGQDAPPDLEAHADYDEENFNFATSENIDNNDA 694          

HSP 2 Score: 56.6102 bits (135), Expect = 1.947e-8
Identity = 41/136 (30.15%), Postives = 60/136 (44.12%), Query Frame = 2
Query:  359 QTLFTSRPILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKLKKS-RCFKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            Q +F   P+    P+   +            D N Q  +S  V + +  + +KC  C + +    NL  H L  +G   + C  C   F Q S+LQ H L H G +P+KC VC K + +  HL RH+   H  V P
Sbjct:  300 QGMFWGEPVEGEAPRGRRIDRL---------DINIQINESYCVDVGEGLKRWKCRMCEKSYTSKYNLVTHILGHNGIKPHACPHCGKLFKQPSHLQTHLLTHQGTRPHKCTVCKKGFTQTSHLKRHM-LQHSDVKP 425          

HSP 3 Score: 52.7582 bits (125), Expect = 3.565e-7
Identity = 28/98 (28.57%), Postives = 50/98 (51.02%), Query Frame = 2
Query:  473 KSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPK 760
            ++  VK ++ RC  C+ C   FP   +L  H +   G  +++C  C+ +F  RS LQ H L+H   + + C  C  ++ +  H +R  S  H ++ P+
Sbjct:  442 RAHEVKHERGRCHVCSHCGMEFPTYAHLKRHQVSHQGPATFQCGQCSKAFVYRSQLQNHMLKHQTQRSFSCSQCGLQFLQL-HQLRQHSLTHKVLKPQ 538          

HSP 4 Score: 49.2914 bits (116), Expect = 3.967e-6
Identity = 26/73 (35.62%), Postives = 38/73 (52.05%), Query Frame = 2
Query:  515 CNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            C  C ++F   ++L  H L   G+  +KC +C   FTQ S+L+RH L+H   KPY C  C + +     L  H
Sbjct:  372 CPHCGKLFKQPSHLQTHLLTHQGTRPHKCTVCKKGFTQTSHLKRHMLQHSDVKPYSCRFCRRGFAYPSELRAH 444          
BLAST of ZFP-1 vs. Ensembl Cavefish
Match: znf341 (zinc finger protein 341 [Source:ZFIN;Acc:ZDB-GENE-080204-99])

HSP 1 Score: 62.3882 bits (150), Expect = 2.911e-10
Identity = 33/89 (37.08%), Postives = 44/89 (49.44%), Query Frame = 2
Query:  491 LKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            L  S  + C  C++IFPC      H L  HG+   +KC IC   F     L+ H   H G KPYKC +C   + RKD + RH+  + P 
Sbjct:  525 LTASHNYPCPHCQKIFPCERYFRRH-LSTHGAVSKFKCQICKKFFKTEHYLKLHTQIHSGEKPYKCSICEATFNRKDKVKRHMLIHEPF 612          

HSP 2 Score: 49.6766 bits (117), Expect = 3.446e-6
Identity = 30/109 (27.52%), Postives = 45/109 (41.28%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHAL---------------------------------RHVGFKPYKCGVCSKEYYRKDHLIRH 727
            FKC  C++ F   + L  HT Q+H     YKC IC  +F ++  ++RH L                                  H G KP+KC +C K + R+ H++ H
Sbjct:  559 FKCQICKKFFKTEHYLKLHT-QIHSGEKPYKCSICEATFNRKDKVKRHMLIHEPFKKYKCPFRTHVGCTKEFNRPDKLKAHILSHSGIKPFKCQLCQKSFSRRAHMLEH 666          
BLAST of ZFP-1 vs. Ensembl Sea Lamprey
Match: znf366 (zinc finger protein 366 [Source:ZFIN;Acc:ZDB-GENE-110408-46])

HSP 1 Score: 61.6178 bits (148), Expect = 5.151e-11
Identity = 29/79 (36.71%), Postives = 48/79 (60.76%), Query Frame = 2
Query:  515 CNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYR----KDHLIRHIS 733
            C QC ++F  L++L  H L   G+  ++CH+C  +FTQ S+L+RH ++H   +PY CGVC + +      + H  RH++
Sbjct:   55 CTQCGKLFKQLSHLNTHRLTHAGARPHRCHVCGRAFTQTSHLKRHLMQHSAVRPYNCGVCGRGFAYPSELRAHQSRHVA 133          

HSP 2 Score: 47.7506 bits (112), Expect = 1.777e-6
Identity = 28/85 (32.94%), Postives = 41/85 (48.24%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            ++C  C + +    NL  H L   G   + C  C   F Q S+L  H L H G +P++C VC + + +  HL RH+   H  V P
Sbjct:   25 WQCRLCEKSYTSKYNLVTHLLGHSGVKPHACTQCGKLFKQLSHLNTHRLTHAGARPHRCHVCGRAFTQTSHLKRHL-MQHSAVRP 108          

HSP 3 Score: 47.3654 bits (111), Expect = 2.498e-6
Identity = 26/81 (32.10%), Postives = 42/81 (51.85%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHP 745
            F C +C   F   ++L +H L   G   +KC +C   FT ++N++RH L H   + Y C +C K + +K  L  H+  + P
Sbjct:  194 FPCGECGMEFVQSHHLKQHMLIHKGIKEHKCSVCGRGFTLQANMKRHQLTHTNVRAYHCHLCHKAFTQKQTLKAHMIVHSP 274          
BLAST of ZFP-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003937.1 (pep scaffold:Pmarinus_7.0:GL485487:1616:4240:1 gene:ENSPMAG00000003606.1 transcript:ENSPMAT00000003937.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 1.241e-10
Identity = 34/94 (36.17%), Postives = 51/94 (54.26%), Query Frame = 2
Query:  476 STPVKLKK---SRCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN 739
            + P  LKK      ++CN C + F  L+NL  H L++H     +KC  C   FTQ ++LQ+H L H G KPY+C VC + +    +L  H+  +
Sbjct:    1 TVPYPLKKQNGKTIYECNICGKTFGQLSNLKVH-LRIHSGERPFKCQTCGKGFTQLAHLQKHHLVHTGEKPYQCQVCCRRFSSTSNLKTHLRLH 93          

HSP 2 Score: 49.6766 bits (117), Expect = 1.548e-7
Identity = 39/133 (29.32%), Postives = 61/133 (45.86%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN-----HPMVSPKENIIQRLSSSESLNFI-------DSQEDSDAKLENEFSSF 859
            R FKC  C + F  L +L +H L   G   Y+C +C   F+  SNL+ H   H G KP++C +C  ++ +  HL  H   +     H     + + I ++S S  LN          S++D  A++  E   F
Sbjct:   41 RPFKCQTCGKGFTQLAHLQKHHLVHTGEKPYQCQVCCRRFSSTSNLKTHLRLHSGEKPFQCKLCPAKFTQFIHLKLHRRLHARERPHRCADCQRSYIHQISLSLHLNGFCPSQQGPASEQDPLARVNQEIDIF 173          
BLAST of ZFP-1 vs. Ensembl Sea Lamprey
Match: PRDM1 (PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346])

HSP 1 Score: 59.6918 bits (143), Expect = 3.874e-10
Identity = 35/82 (42.68%), Postives = 48/82 (58.54%), Query Frame = 2
Query:  473 KSTPVKLKKSR---CFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEY 700
            +S P  L+K      ++CN CR+ F  L+NL  H L+VH     +KC  C   FTQ ++LQ+H L H G KPY+C VC K +
Sbjct:  410 RSLPYPLRKHNGKIIYECNVCRKTFGQLSNLKVH-LRVHSGERPFKCQTCGKGFTQLAHLQKHHL-HTGEKPYQCQVCHKRF 489          
BLAST of ZFP-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007831.1 (pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 gene:ENSPMAG00000007084.1 transcript:ENSPMAT00000007831.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 53.1434 bits (126), Expect = 1.991e-9
Identity = 28/74 (37.84%), Postives = 42/74 (56.76%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS-YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            FKC  C + F   + LT H L+ H   ++C +C  +F + S+LQ H   H G KP+KC VC K + +  +L +H
Sbjct:    6 FKCTVCEKAFAQSSYLTIH-LRTHTKPFRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKH 78          

HSP 2 Score: 52.7582 bits (125), Expect = 3.373e-9
Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            F+C  C + F   ++L  H     G   +KC +C  +F+Q SNL++H   H G KP+KC VC K +     L +H
Sbjct:   32 FRCPLCGKAFAKSSDLQSHQRTHTGEKPFKCSVCEKAFSQSSNLKKHQRTHTGEKPFKCTVCEKAFTESSPLRKH 106          
BLAST of ZFP-1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006002.1 (pep scaffold:Pmarinus_7.0:GL479218:16696:34135:-1 gene:ENSPMAG00000005404.1 transcript:ENSPMAT00000006002.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 55.0694 bits (131), Expect = 4.663e-9
Identity = 29/81 (35.80%), Postives = 45/81 (55.56%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYR----KDHLIRHIS 733
            F+C+ C + F   +N   HT    G   Y+C  C  +F++RSN++RH   H G KP+ C VC++ + R    K HL++H  
Sbjct:  145 FRCDVCSRAFAEYSNYRRHTRTHTGQRPYRCEACGRAFSKRSNMKRHQRSHKGEKPFGCDVCAQGFTRLCNLKVHLLKHAG 225          

HSP 2 Score: 52.373 bits (124), Expect = 3.242e-8
Identity = 27/76 (35.53%), Postives = 42/76 (55.26%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            ++C QC + F   + L  H +++H     Y+C  C  +F+Q S L+ H   H G KPY+CGVC + + +  H  RH
Sbjct:    5 YECRQCGREFVRSDALKAH-MRIHTGEKPYRCGACGRAFSQSSGLKTHQRVHTGEKPYRCGVCGRVFAQSSHCNRH 79          
BLAST of ZFP-1 vs. Ensembl Yeast
Match: ZAP1 (Zinc-regulated transcription factor; binds to zinc-responsive promoters to induce transcription of certain genes in presence of zinc, represses other genes in low zinc; regulates its own transcription; contains seven zinc-finger domains [Source:SGD;Acc:S000003592])

HSP 1 Score: 60.077 bits (144), Expect = 2.358e-10
Identity = 30/80 (37.50%), Postives = 42/80 (52.50%), Query Frame = 2
Query:  497 KSRCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            K + +KC  C++ F     L +HT    G   YKCHICN  F   S+L+ H   H G KP +C +C K +    +L +HI
Sbjct:  764 KYKPYKCKTCKRCFSSEETLVQHTRTHSGEKPYKCHICNKKFAISSSLKIHIRTHTGEKPLQCKICGKRFNESSNLSKHI 843          

HSP 2 Score: 47.3654 bits (111), Expect = 2.315e-6
Identity = 34/119 (28.57%), Postives = 55/119 (46.22%), Query Frame = 2
Query:  398 PKSHSMS-GFFPLQMTTMNDCNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVH-----GSYKC--HICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            P++H +S       MT+ ND +       P+K  +    + + C + F     L +H   VH       Y+C  H C+ +F QR  L RH   H  +KPYKC  C + +  ++ L++H 
Sbjct:  673 PQTHEVSKADGAPDMTSANDVSN----IPPIKQPEQVICQWDGCNKSFSSAQELNDHLEAVHLTRGKSEYQCLWHDCHRTFPQRQKLIRHLKVHSKYKPYKCKTCKRCFSSEETLVQHT 787          
BLAST of ZFP-1 vs. Ensembl Yeast
Match: AZF1 (Zinc-finger transcription factor; involved in diauxic shift; in the presence of glucose, activates transcription of genes involved in growth and carbon metabolism; in nonfermentable carbon sources, activates transcription of genes involved in maintenance of cell wall integrity; relocalizes to the cytosol in response to hypoxia [Source:SGD;Acc:S000005639])

HSP 1 Score: 57.7658 bits (138), Expect = 1.131e-9
Identity = 31/89 (34.83%), Postives = 44/89 (49.44%), Query Frame = 2
Query:  482 PVKLKKSRCFK---CNQCRQIFPCLNNLTEHTLQVHGSYK---CHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            P   + +R  K   C  C ++F    +L  H ++ H  YK   C  C   FTQ  NL+ H   H G KPY C +C K++ RK +L  H+
Sbjct:  581 PKGTQNTRAVKKHECPYCHRLFSQATHLEVH-VRSHIGYKPFVCDYCGKRFTQGGNLRTHERLHTGEKPYSCDICDKKFSRKGNLAAHL 668          
BLAST of ZFP-1 vs. Ensembl Yeast
Match: ADR1 (Carbon source-responsive zinc-finger transcription factor; required for transcription of the glucose-repressed gene ADH2, of peroxisomal protein genes, and of genes required for ethanol, glycerol, and fatty acid utilization [Source:SGD;Acc:S000002624])

HSP 1 Score: 52.373 bits (124), Expect = 6.576e-8
Identity = 20/48 (41.67%), Postives = 32/48 (66.67%), Query Frame = 2
Query:  584 SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            S+ C +C  +F ++ +L+RH   H   KPY CG+C++ + R+D LIRH
Sbjct:  103 SFVCEVCTRAFARQEHLKRHYRSHTNEKPYPCGLCNRCFTRRDLLIRH 150          
BLAST of ZFP-1 vs. Ensembl Yeast
Match: PZF1 (Transcription factor IIIA (TFIIIA); essential DNA binding protein required for transcription of 5S rRNA by RNA polymerase III; not involved in transcription of other RNAP III genes; nine conserved zinc fingers; may also bind 5S rRNA [Source:SGD;Acc:S000006390])

HSP 1 Score: 49.6766 bits (117), Expect = 3.432e-7
Identity = 28/87 (32.18%), Postives = 45/87 (51.72%), Query Frame = 2
Query:  518 NQCRQIFPCLNNLTEHTLQVHG---SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH-ISFNHPMVSPKEN 766
            + C + F   + LTEH L VH    +++C  C  SF ++S+L+RH   H   KP++C  C K    +  L RH ++     + P+E 
Sbjct:   54 DGCDKAFTRPSILTEHQLSVHQGLRAFQCDKCAKSFVKKSHLERHLYTHSDTKPFQCSYCGKGVTTRQQLKRHEVTHTKSFICPEEG 140          
BLAST of ZFP-1 vs. Ensembl Yeast
Match: TDA9 (Transcription factor that regulates acetate production; green fluorescent protein (GFP)-fusion protein localizes to the nucleus; null mutant is sensitive to expression of the top1-T722A allele; not an essential gene; TDA9 has a paralog, RSF2, that arose from the whole genome duplication [Source:SGD;Acc:S000004546])

HSP 1 Score: 49.2914 bits (116), Expect = 6.181e-7
Identity = 21/61 (34.43%), Postives = 34/61 (55.74%), Query Frame = 2
Query:  587 YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENI 769
            + CHIC   F ++ +L+RH   H   KP+ C  C + + R+D ++RH    H  +  KE+I
Sbjct:   61 FLCHICTRGFVRQEHLKRHQRAHTNEKPFLCVFCGRCFARRDLVLRHQHKLHSALVSKESI 121          
BLAST of ZFP-1 vs. Ensembl Nematostella
Match: EDO45593 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RSM2])

HSP 1 Score: 57.7658 bits (138), Expect = 6.177e-11
Identity = 29/78 (37.18%), Postives = 44/78 (56.41%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISF 736
            F C+ C++ F    NL  H   VHG  S++C  C  SF ++   +RH  ++   K YKC  C++E+YRKD+L  H+  
Sbjct:    3 FVCDICKKEFSLKTNLARHKRSVHGNQSFQCEKCEKSFNRKDTFKRHMRKYNQEKEYKCLHCAREFYRKDNLNEHLKL 80          
BLAST of ZFP-1 vs. Ensembl Nematostella
Match: EDO48254 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RJF5])

HSP 1 Score: 60.077 bits (144), Expect = 1.041e-10
Identity = 42/114 (36.84%), Postives = 57/114 (50.00%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKD----HLIRHIS----FNHPMVSPKENIIQRLSSSESLNFIDSQE 820
            FKC +C + F   + L  H L   G+  ++C IC   FTQ  +L+RH LRH G KP+ C  C K+Y R D    HL+ H       NH +V    N      S  S+ F D++E
Sbjct:   15 FKCKKCEKEFSFSSRLKRHLLVHTGARPFECPICFRRFTQAVDLKRHMLRHSGQKPHVCQYCGKQYTRGDRLKVHLLSHTEGGPLANHALVPKPYNC-----SRCSMTFEDAEE 123          

HSP 2 Score: 48.521 bits (114), Expect = 8.521e-7
Identity = 24/77 (31.17%), Postives = 42/77 (54.55%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHG---SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            + C++C   F     L  HT +  G   +Y+C  C+++FT+ ++L+ H L+H G K +KC  C K ++    L  H+
Sbjct:  109 YNCSRCSMTFEDAEELYVHTCRYEGKAKAYRCDECHSTFTKSTSLKSHLLKHTGEKKFKCAHCPKTFFSSSSLKIHV 185          
BLAST of ZFP-1 vs. Ensembl Nematostella
Match: EDO48956 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI19])

HSP 1 Score: 59.3066 bits (142), Expect = 2.198e-10
Identity = 32/76 (42.11%), Postives = 44/76 (57.89%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            FKC  C + F   N L  H L   G+  YKC  C  +FTQ ++L+RH+  H G +PYKC VCSK +  +  L+ H+
Sbjct:  115 FKCETCGKAFTHRNTLARHQLIHSGTRPYKCEECGKTFTQTNDLKRHSRIHTGIRPYKCHVCSKSFTVEFTLVCHL 190          

HSP 2 Score: 58.5362 bits (140), Expect = 3.998e-10
Identity = 29/75 (38.67%), Postives = 43/75 (57.33%), Query Frame = 2
Query:  512 KCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            KC  C + F  L +L  H L   G   YKCH+C  +F+Q+ +LQ H+  H G KPYKC +C + +  +  L+ H+
Sbjct:   32 KCETCGKEFTLLKHLQRHHLVHTGEKPYKCHLCGRAFSQQGSLQAHSRTHTGIKPYKCQICGRAFALQSPLMSHM 106          

HSP 3 Score: 49.6766 bits (117), Expect = 3.917e-7
Identity = 28/76 (36.84%), Postives = 41/76 (53.95%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            +KC  C + F   + L  H ++ H +   +KC  C  +FT R+ L RH L H G +PYKC  C K + + + L RH
Sbjct:   87 YKCQICGRAFALQSPLMSH-MKTHSNEKNFKCETCGKAFTHRNTLARHQLIHSGTRPYKCEECGKTFTQTNDLKRH 161          

HSP 4 Score: 48.1358 bits (113), Expect = 1.367e-6
Identity = 32/90 (35.56%), Postives = 43/90 (47.78%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVH-------GSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            FKC  C + F     +  +TLQ H         +KC  C   FT   +LQRH L H G KPYKC +C + + ++  L  H S  H  + P
Sbjct:    3 FKCPTCDKAF-----IRNYTLQCHMLIHKNVKEHKCETCGKEFTLLKHLQRHHLVHTGEKPYKCHLCGRAFSQQGSLQAH-SRTHTGIKP 86          

HSP 5 Score: 45.8246 bits (107), Expect = 6.957e-6
Identity = 25/67 (37.31%), Postives = 36/67 (53.73%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEY 700
            +KC +C + F   N+L  H+ ++H     YKCH+C+ SFT    L  H   H G +PY C  C K +
Sbjct:  143 YKCEECGKTFTQTNDLKRHS-RIHTGIRPYKCHVCSKSFTVEFTLVCHLRTHTGERPYVCDHCGKTF 208          
BLAST of ZFP-1 vs. Ensembl Nematostella
Match: EDO39235 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SAQ2])

HSP 1 Score: 55.8398 bits (133), Expect = 2.390e-10
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            F C+ C++ F    NL  H   VHG  S++C  C  S  ++   +RH  ++   K YKC  C++E+YRKD+L +H+
Sbjct:    3 FVCDICKKEFSLKTNLARHKRSVHGNQSFQCEKCEQSLNRKDTFKRHMKKYNQEKEYKCLHCAREFYRKDNLNQHL 78          
BLAST of ZFP-1 vs. Ensembl Nematostella
Match: EDO28113 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T7D6])

HSP 1 Score: 55.4546 bits (132), Expect = 2.689e-10
Identity = 28/76 (36.84%), Postives = 44/76 (57.89%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHG--SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            F C+ C++ F    NL  H   VHG  S++C  C  S  ++   +RH  ++   K YKC  C++E+YRKD+L +H+
Sbjct:    3 FLCDICKKEFSLKTNLARHKRSVHGNQSFQCEKCEQSLNRKDTFKRHMKKYNQEKEYKCLHCAREFYRKDNLNQHL 78          
BLAST of ZFP-1 vs. Ensembl Medaka
Match: znf341 (zinc finger protein 341 [Source:NCBI gene;Acc:101174502])

HSP 1 Score: 68.5514 bits (166), Expect = 2.848e-12
Identity = 34/88 (38.64%), Postives = 45/88 (51.14%), Query Frame = 2
Query:  491 LKKSRCFKCNQCRQIFPCLNNLTEH--TLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPM 748
            L  S  F C  C+++FPC      H  T  V G +KC IC  +F     L+ HA  H G KPYKC +C   + RKD + RH+  + P 
Sbjct:  535 LTASHSFPCPHCQKVFPCERYFRRHLPTHGVGGRFKCQICKKAFKTEHYLKLHARIHSGEKPYKCSLCDATFNRKDKVKRHMLIHEPF 622          

HSP 2 Score: 49.2914 bits (116), Expect = 4.966e-6
Identity = 33/131 (25.19%), Postives = 51/131 (38.93%), Query Frame = 2
Query:  455 CNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS-------YKCHICNTSFTQRSNLQRHAL---------------------------------RHVGFKPYKCGVCSKEYYRKDHLIRH 727
            C +  R+  P      R FKC  C++ F      TEH L++H         YKC +C+ +F ++  ++RH L                                  H G KP+KC  C K + R+ H++ H
Sbjct:  552 CERYFRRHLPTHGVGGR-FKCQICKKAFK-----TEHYLKLHARIHSGEKPYKCSLCDATFNRKDKVKRHMLIHEPFKKYKCPFRTHVGCTKEFNRPDKLKAHILSHSGIKPFKCLFCQKTFSRRAHMLEH 676          
BLAST of ZFP-1 vs. Ensembl Medaka
Match: ENSORLT00000037362.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101169270])

HSP 1 Score: 66.6254 bits (161), Expect = 9.381e-12
Identity = 33/76 (43.42%), Postives = 42/76 (55.26%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVH---GSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            F C+ C + F   NNL  H L VH    ++ CH+C   FT+  +L+RH   H G KPY CG C K + R  HL RH
Sbjct:  259 FSCSVCGKPFSLENNLKRH-LMVHRDQKAFSCHVCGEGFTESGSLKRHRRIHTGEKPYVCGDCGKAFSRGTHLQRH 333          

HSP 2 Score: 55.0694 bits (131), Expect = 4.425e-8
Identity = 27/82 (32.93%), Postives = 44/82 (53.66%), Query Frame = 2
Query:  494 KKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            +  + F C+ C + F    +L  H  ++H     Y C  C  +F++ ++LQRH   H G KP++CGVC  ++ +K H  RH 
Sbjct:  282 RDQKAFSCHVCGEGFTESGSLKRH-RRIHTGEKPYVCGDCGKAFSRGTHLQRHKRVHTGEKPFQCGVCGLKFSQKTHFERHA 362          

HSP 3 Score: 51.9878 bits (123), Expect = 4.052e-7
Identity = 29/77 (37.66%), Postives = 43/77 (55.84%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGSYK---CHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            F+C  C + F     L EH L++H   K   C +C  +FTQ S+L+ H   H G KP+ C VC K +  +++L RH+
Sbjct:  203 FECGFCSKRFRQQVVLKEH-LRIHTGEKPFVCDVCGKTFTQNSSLKSHRPVHTGEKPFSCSVCGKPFSLENNLKRHL 278          

HSP 4 Score: 51.6026 bits (122), Expect = 5.787e-7
Identity = 20/49 (40.82%), Postives = 33/49 (67.35%), Query Frame = 2
Query:  584 SYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            SY C++C  +FT+R +L++H   H G KP++CG CSK + ++  L  H+
Sbjct:  174 SYGCNVCGRTFTRRQSLKKHLTMHTGEKPFECGFCSKRFRQQVVLKEHL 222          

HSP 5 Score: 51.2174 bits (121), Expect = 7.230e-7
Identity = 24/76 (31.58%), Postives = 40/76 (52.63%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            + C  C + F    +L  H  +VH     ++C +C   F+Q+++ +RHA  H G KP+ C  C + + R+  L RH
Sbjct:  315 YVCGDCGKAFSRGTHLQRHK-RVHTGEKPFQCGVCGLKFSQKTHFERHARVHSGEKPFSCASCGQRFNRQSSLKRH 389          
BLAST of ZFP-1 vs. Ensembl Medaka
Match: prdm1b (PR domain zinc finger protein 1-like [Source:NCBI gene;Acc:101173518])

HSP 1 Score: 65.4698 bits (158), Expect = 2.611e-11
Identity = 33/80 (41.25%), Postives = 50/80 (62.50%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN 739
            ++CN C++IF  L+NL  H L+VH     +KC  CN +FTQ ++LQ+H L H G KP++C VC K +    +L  H+  +
Sbjct:  531 YECNICKKIFGQLSNLKVH-LRVHSGERPFKCQTCNKNFTQLAHLQKHYLVHTGEKPHECKVCHKRFSSTSNLKTHLRLH 609          
BLAST of ZFP-1 vs. Ensembl Medaka
Match: ENSORLT00000038558.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 64.6994 bits (156), Expect = 3.521e-11
Identity = 34/85 (40.00%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C+ C   F    +L  HTL   G   Y C +C+  F QR  L+RH+L H G KPY C +C K ++++ HL RH S  H  V P
Sbjct:  310 YACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKP 393          

HSP 2 Score: 63.1586 bits (152), Expect = 1.423e-10
Identity = 33/85 (38.82%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C  C + F    +L  H+L   G   Y C +C+  F QR +L RH+L H G KPY C +C K ++++ HL RH S  H  V P
Sbjct:  366 YACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKP 449          

HSP 3 Score: 60.8474 bits (146), Expect = 6.443e-10
Identity = 32/85 (37.65%), Postives = 45/85 (52.94%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C+ C   F    +L  HTL   G   Y C +C+  F QR +L RH+L H G KPY C +C   ++++ HL RH +  H  V P
Sbjct:  226 YACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARH-TLTHTGVKP 309          

HSP 4 Score: 60.077 bits (144), Expect = 1.444e-9
Identity = 31/85 (36.47%), Postives = 44/85 (51.76%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C+ C   F    +L  H+L   G   Y C +C+  F QR +L RH L H G KPY C +C   ++++ HL RH +  H  V P
Sbjct:  254 YACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARH-TLTHTGVKP 337          

HSP 5 Score: 59.3066 bits (142), Expect = 1.959e-9
Identity = 32/85 (37.65%), Postives = 42/85 (49.41%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C  C   F    +L  H L   G   Y C +C+  F QR +L RH L H G KPY C +C   ++++ HL RH S  H  V P
Sbjct:  198 YACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARH-SLTHTGVKP 281          

HSP 6 Score: 58.151 bits (139), Expect = 5.016e-9
Identity = 31/85 (36.47%), Postives = 44/85 (51.76%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C  C   F    +L  H+L   G   Y C +C+  F QR +L+RH L H G KPY C +C   ++++ HL RH +  H  V P
Sbjct:  170 YACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARH-TLTHTGVKP 253          

HSP 7 Score: 56.9954 bits (136), Expect = 1.329e-8
Identity = 28/75 (37.33%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            + C  C   F    +L  H+L   G   Y C +C+  F QR +L RH+L H+G KPY C +C   + +++HL RH
Sbjct:  394 YACTMCDMKFFQRYHLARHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACSMCDMRFIQRNHLERH 468          
BLAST of ZFP-1 vs. Ensembl Medaka
Match: ENSORLT00000046979.1 (gastrula zinc finger protein XlCGF57.1 [Source:NCBI gene;Acc:101163567])

HSP 1 Score: 64.6994 bits (156), Expect = 3.651e-11
Identity = 34/85 (40.00%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C+ C   F    +L  HTL   G   Y C +C+  F QR  L+RH+L H G KPY C +C K ++++ HL RH S  H  V P
Sbjct:  310 YACSMCDMRFFQRYHLARHTLTHTGVKPYACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKP 393          

HSP 2 Score: 62.003 bits (149), Expect = 3.374e-10
Identity = 33/85 (38.82%), Postives = 45/85 (52.94%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C  C   F     L  H+L   G   Y C +C+  F QR +L RH+L H+G KPY C +C K ++++ HL RH S  H  V P
Sbjct:  338 YACTMCDMRFIQRYQLERHSLTHTGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDKRFFQRYHLARH-SLTHMGVKP 421          

HSP 3 Score: 60.8474 bits (146), Expect = 6.738e-10
Identity = 32/85 (37.65%), Postives = 45/85 (52.94%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C+ C   F    +L  HTL   G   Y C +C+  F QR +L RH+L H G KPY C +C   ++++ HL RH +  H  V P
Sbjct:  226 YACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARH-TLTHTGVKP 309          

HSP 4 Score: 59.6918 bits (143), Expect = 1.511e-9
Identity = 31/85 (36.47%), Postives = 44/85 (51.76%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C+ C   F    +L  H+L   G   Y C +C+  F QR +L RH L H G KPY C +C   ++++ HL RH +  H  V P
Sbjct:  254 YACSMCDMRFFQRYHLARHSLTHTGVKPYACSMCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARH-TLTHTGVKP 337          

HSP 5 Score: 59.6918 bits (143), Expect = 1.623e-9
Identity = 31/85 (36.47%), Postives = 46/85 (54.12%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C  C + F    +L  H+L   G   Y C +C+  F QR +L RH+L H+G KP+ C +C   + ++ HL+RH S  H  V P
Sbjct:  366 YACTMCDKRFFQRYHLARHSLTHMGVKPYACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRH-SLTHTGVKP 449          

HSP 6 Score: 59.3066 bits (142), Expect = 2.049e-9
Identity = 32/85 (37.65%), Postives = 42/85 (49.41%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C  C   F    +L  H L   G   Y C +C+  F QR +L RH L H G KPY C +C   ++++ HL RH S  H  V P
Sbjct:  198 YACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARHTLTHTGVKPYACSMCDMRFFQRYHLARH-SLTHTGVKP 281          

HSP 7 Score: 58.151 bits (139), Expect = 5.199e-9
Identity = 31/85 (36.47%), Postives = 44/85 (51.76%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSP 757
            + C  C   F    +L  H+L   G   Y C +C+  F QR +L+RH L H G KPY C +C   ++++ HL RH +  H  V P
Sbjct:  170 YACAVCDMRFIQRYHLERHSLIHTGVKPYACTMCDMRFFQRYHLERHKLTHTGVKPYACSLCDMRFFQRYHLARH-TLTHTGVKP 253          

HSP 8 Score: 56.225 bits (134), Expect = 2.353e-8
Identity = 27/75 (36.00%), Postives = 41/75 (54.67%), Query Frame = 2
Query:  509 FKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRH 727
            + C  C + F    +L  H+L   G   + C +C+  F QR +L RH+L H G KPY C +C   + +++HL RH
Sbjct:  394 YACTMCDKRFFQRYHLARHSLTHMGVKPFACTMCDMRFVQRYHLVRHSLTHTGVKPYACSMCDMRFIQRNHLERH 468          
BLAST of ZFP-1 vs. Planmine SMEST
Match: SMESG000066384.1 (SMESG000066384.1)

HSP 1 Score: 591.652 bits (1524), Expect = 0.000e+0
Identity = 307/307 (100.00%), Postives = 307/307 (100.00%), Query Frame = 2
Query:   62 MNFMEQNNSLMKSFHQLLHSHWLNPLQVIPPVXXXXXXXXXXXXXXXXPGKSESSDQEEPLNLSLKYCDVQLSKSQNSPVPTNQFRLSSQIPLMIPHVFQTLFTSRPILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDSQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENIFLKVEPTDSMDVDILN 982
            MNFMEQNNSLMKSFHQLLHSHWLNPLQVIPPVSTRYSSYSSSTASFISPGKSESSDQEEPLNLSLKYCDVQLSKSQNSPVPTNQFRLSSQIPLMIPHVFQTLFTSRPILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDSQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENIFLKVEPTDSMDVDILN
Sbjct:    1 MNFMEQNNSLMKSFHQLLHSHWLNPLQVIPPVSTRYSSYSSSTASFISPGKSESSDQEEPLNLSLKYCDVQLSKSQNSPVPTNQFRLSSQIPLMIPHVFQTLFTSRPILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDSQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENIFLKVEPTDSMDVDILN 307          
BLAST of ZFP-1 vs. Planmine SMEST
Match: SMESG000026829.1 (SMESG000026829.1)

HSP 1 Score: 135.961 bits (341), Expect = 9.218e-36
Identity = 64/118 (54.24%), Postives = 83/118 (70.34%), Query Frame = 2
Query:  494 KKSRCFKCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFIDS-QEDSDAKLEN 844
            K S+ F CNQC+  F  LN L +HT   H +++C  C+ +FTQRSNLQRH+L+HVGFKP+ C VCSK YYRKDHL+RHI  +HP   PK NI  +LSSSE L +++  Q +   +LEN
Sbjct:  264 KSSKVFNCNQCKLQFNSLNALCKHTFSDHRAFRCTFCSANFTQRSNLQRHSLKHVGFKPFICNVCSKAYYRKDHLVRHIEVSHPGSDPKSNITVKLSSSECLEYLERMQNNRLLELEN 381          
BLAST of ZFP-1 vs. Planmine SMEST
Match: SMESG000064097.1 (SMESG000064097.1)

HSP 1 Score: 61.6178 bits (148), Expect = 2.689e-10
Identity = 28/79 (35.44%), Postives = 46/79 (58.23%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS---YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            R FKCNQC + F   + L  H L++H     Y+C IC  +F  ++ LQ H   H G +P+ C +C K + ++ H+++H+
Sbjct:  207 RPFKCNQCDRAFAQKSGLEAH-LKLHTGERPYECQICGRAFKLKAQLQTHERVHSGERPFGCKICGKLFRQQCHVVQHL 284          
BLAST of ZFP-1 vs. Planmine SMEST
Match: SMESG000005754.1 (SMESG000005754.1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.156e-9
Identity = 31/86 (36.05%), Postives = 46/86 (53.49%), Query Frame = 2
Query:  479 TPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            T +K      + C+ C++IF  L+NL  H     G   + C  C   FTQ ++LQ+H L H G KP++C VCSK +    +L  H+
Sbjct:  377 TLIKTDGKSKYNCSVCKKIFGQLSNLKVHQRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHM 462          

HSP 2 Score: 50.8322 bits (120), Expect = 8.371e-7
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN---HPMVSPKEN 766
            R F C  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KP+KC  C  ++ +  HL  H+  +    P + P+ N
Sbjct:  413 RPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCN 505          
BLAST of ZFP-1 vs. Planmine SMEST
Match: SMESG000005754.1 (SMESG000005754.1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.408e-9
Identity = 31/86 (36.05%), Postives = 46/86 (53.49%), Query Frame = 2
Query:  479 TPVKLKKSRCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHI 730
            T +K      + C+ C++IF  L+NL  H     G   + C  C   FTQ ++LQ+H L H G KP++C VCSK +    +L  H+
Sbjct:  350 TLIKTDGKSKYNCSVCKKIFGQLSNLKVHQRTHTGERPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHM 435          

HSP 2 Score: 50.447 bits (119), Expect = 1.078e-6
Identity = 30/93 (32.26%), Postives = 47/93 (50.54%), Query Frame = 2
Query:  503 RCFKCNQCRQIFPCLNNLTEHTLQVHGS--YKCHICNTSFTQRSNLQRHALRHVGFKPYKCGVCSKEYYRKDHLIRHISFN---HPMVSPKEN 766
            R F C  C + F  L +L +H L   G   ++C +C+  F+  SNL+ H   H G KP+KC  C  ++ +  HL  H+  +    P + P+ N
Sbjct:  386 RPFVCQTCGKGFTQLAHLQKHNLVHTGEKPHECSVCSKRFSSTSNLKTHMRLHRGEKPFKCEFCKTKFTQLVHLQLHLRLHTNERPFICPRCN 478          
The following BLAST results are available for this feature:
BLAST of ZFP-1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ZNF3414.054e-1242.17zinc finger protein 341 [Source:HGNC Symbol;Acc:HG... [more]
ZNF3414.385e-1242.17zinc finger protein 341 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2871.038e-1141.56zinc finger protein 287 [Source:HGNC Symbol;Acc:HG... [more]
ZNF2871.038e-1141.56zinc finger protein 287 [Source:HGNC Symbol;Acc:HG... [more]
PRDM11.537e-1135.77PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
back to top
BLAST of ZFP-1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ztf-161.614e-1046.81Zinc finger putative Transcription Factor family ... [more]
pag-32.431e-1035.71Zinc finger protein PAG-3 [Source:UniProtKB/TrEMB... [more]
ztf-162.750e-1046.81Zinc finger putative Transcription Factor family ... [more]
blmp-11.863e-935.53B lymphocyte-induced maturation protein 1 homolog ... [more]
blmp-11.988e-935.53B lymphocyte-induced maturation protein 1 homolog ... [more]
back to top
BLAST of ZFP-1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CG127697.569e-1246.94gene:FBgn0033252 transcript:FBtr0088828[more]
CG127697.757e-1246.94gene:FBgn0033252 transcript:FBtr0088827[more]
CG127698.243e-1246.94gene:FBgn0033252 transcript:FBtr0339281[more]
Blimp-17.961e-1134.95gene:FBgn0035625 transcript:FBtr0331808[more]
Blimp-17.961e-1134.95gene:FBgn0035625 transcript:FBtr0345593[more]
back to top
BLAST of ZFP-1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdm1a3.517e-1138.32PR domain containing 1a, with ZNF domain [Source:Z... [more]
ZBTB264.303e-1136.00si:ch211-236k19.4 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
ZBTB264.303e-1136.00si:ch211-236k19.4 [Source:ZFIN;Acc:ZDB-GENE-060526... [more]
znf740a4.080e-1041.94zinc finger protein 740a [Source:ZFIN;Acc:ZDB-GENE... [more]
gfi1b4.570e-1036.47growth factor independent 1B transcription repress... [more]
back to top
BLAST of ZFP-1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chac24.911e-1138.00ChaC, cation transport regulator homolog 2 [Source... [more]
chac25.031e-1138.00ChaC, cation transport regulator homolog 2 [Source... [more]
slc3a22.576e-1028.57solute carrier family 3 (amino acid transporter he... [more]
slc3a22.923e-1028.57solute carrier family 3 (amino acid transporter he... [more]
slc3a23.204e-1028.57solute carrier family 3 (amino acid transporter he... [more]
back to top
BLAST of ZFP-1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Zfp3412.955e-1237.93zinc finger protein 341 [Source:MGI Symbol;Acc:MGI... [more]
Zfp3413.083e-1237.93zinc finger protein 341 [Source:MGI Symbol;Acc:MGI... [more]
Prdm17.275e-1239.00PR domain containing 1, with ZNF domain [Source:MG... [more]
Prdm18.305e-1239.00PR domain containing 1, with ZNF domain [Source:MG... [more]
Prdm19.837e-1239.00PR domain containing 1, with ZNF domain [Source:MG... [more]
back to top
BLAST of ZFP-1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9BYN7|ZN341_HUMAN1.947e-1142.17Zinc finger protein 341 OS=Homo sapiens OX=9606 GN... [more]
sp|A2T812|ZN287_PONPY4.436e-1141.56Zinc finger protein 287 OS=Pongo pygmaeus OX=9600 ... [more]
sp|Q9HBT7|ZN287_HUMAN4.987e-1141.56Zinc finger protein 287 OS=Homo sapiens OX=9606 GN... [more]
sp|Q60636|PRDM1_MOUSE6.881e-1139.00PR domain zinc finger protein 1 OS=Mus musculus OX... [more]
sp|O75626|PRDM1_HUMAN8.062e-1136.36PR domain zinc finger protein 1 OS=Homo sapiens OX... [more]
back to top
BLAST of ZFP-1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXV10.000e+0100.00ZFP-1 OS=Schmidtea mediterranea OX=79327 PE=2 SV=1[more]
A0A0R3TQM76.018e-4159.66Uncharacterized protein OS=Rodentolepis nana OX=10... [more]
A0A183TS721.528e-3946.11Zinc finger protein Gfi-1b OS=Schistocephalus soli... [more]
A0A3P7NIJ01.951e-3949.33Uncharacterized protein OS=Dibothriocephalus latus... [more]
A0A0X3PAQ62.605e-3950.00Zinc finger E-box-binding homeobox 1 (Fragment) OS... [more]
back to top
BLAST of ZFP-1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
prdm1a3.170e-1138.95PR/SET domain 1 [Source:NCBI gene;Acc:103047552][more]
si:ch211-236k19.43.191e-1135.53zinc finger and BTB domain containing 26 [Source:H... [more]
ENSAMXT00000046051.11.627e-1036.47pep primary_assembly:Astyanax_mexicanus-2.0:9:3121... [more]
znf710b2.863e-1028.85zinc finger protein 710-like [Source:NCBI gene;Acc... [more]
znf3412.911e-1037.08zinc finger protein 341 [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of ZFP-1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf3665.151e-1136.71zinc finger protein 366 [Source:ZFIN;Acc:ZDB-GENE-... [more]
ENSPMAT00000003937.11.241e-1036.17pep scaffold:Pmarinus_7.0:GL485487:1616:4240:1 gen... [more]
PRDM13.874e-1042.68PR/SET domain 1 [Source:HGNC Symbol;Acc:HGNC:9346][more]
ENSPMAT00000007831.11.991e-937.84pep scaffold:Pmarinus_7.0:GL477655:47469:47963:1 g... [more]
ENSPMAT00000006002.14.663e-935.80pep scaffold:Pmarinus_7.0:GL479218:16696:34135:-1 ... [more]
back to top
BLAST of ZFP-1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
ZAP12.358e-1037.50Zinc-regulated transcription factor; binds to zinc... [more]
AZF11.131e-934.83Zinc-finger transcription factor; involved in diau... [more]
ADR16.576e-841.67Carbon source-responsive zinc-finger transcription... [more]
PZF13.432e-732.18Transcription factor IIIA (TFIIIA); essential DNA ... [more]
TDA96.181e-734.43Transcription factor that regulates acetate produc... [more]
back to top
BLAST of ZFP-1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO455936.177e-1137.18Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO482541.041e-1036.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489562.198e-1042.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO392352.390e-1036.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO281132.689e-1036.84Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of ZFP-1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
znf3412.848e-1238.64zinc finger protein 341 [Source:NCBI gene;Acc:1011... [more]
ENSORLT00000037362.19.381e-1243.42gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
prdm1b2.611e-1141.25PR domain zinc finger protein 1-like [Source:NCBI ... [more]
ENSORLT00000038558.13.521e-1140.00gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
ENSORLT00000046979.13.651e-1140.00gastrula zinc finger protein XlCGF57.1 [Source:NCB... [more]
back to top
BLAST of ZFP-1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000066384.10.000e+0100.00SMESG000066384.1[more]
SMESG000026829.19.218e-3654.24SMESG000026829.1[more]
SMESG000064097.12.689e-1035.44SMESG000064097.1[more]
SMESG000005754.11.156e-936.05SMESG000005754.1[more]
SMESG000005754.11.408e-936.05SMESG000005754.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30023708
GenBankAFD29622.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023708 ID=SMED30023708|Name=ZFP-1|organism=Schmidtea mediterranea sexual|type=transcript|length=1035bp
TTTTGACGGTGATTTTATTGAAATAAAAATTTGCGAATAAACGAAAAATT
TTGAATATTAGATGAATTTCATGGAACAAAATAATTCATTGATGAAATCA
TTTCATCAACTACTCCATTCTCATTGGTTAAATCCATTACAAGTAATTCC
TCCAGTCTCAACTCGATACTCATCATACTCATCCAGTACAGCCAGTTTTA
TTTCACCAGGAAAAAGTGAATCATCTGACCAAGAAGAACCACTGAATTTA
TCCCTAAAATATTGTGATGTCCAGCTTTCAAAAAGCCAAAATAGTCCAGT
ACCCACGAATCAATTTAGATTATCATCACAAATTCCATTGATGATACCTC
ATGTTTTTCAAACTTTATTTACATCCAGACCAATTCTCCCAAATATTCCT
AAATCCCACAGTATGTCTGGGTTTTTCCCATTACAAATGACTACAATGAA
CGACTGTAATAAACAGAAGCGAAAATCAACACCAGTAAAATTGAAAAAAT
CACGTTGTTTTAAGTGTAATCAGTGTCGACAAATTTTCCCGTGCCTGAAC
AATTTGACAGAACATACTCTTCAAGTACATGGCAGTTATAAGTGTCACAT
TTGCAACACCAGCTTCACTCAAAGATCAAATCTACAGAGGCATGCGCTGA
GGCATGTTGGATTCAAGCCATACAAATGTGGAGTTTGCTCTAAAGAATAT
TACAGAAAAGACCATTTAATCAGACATATTTCATTTAATCATCCAATGGT
TAGTCCAAAAGAAAACATTATTCAAAGATTGTCATCATCAGAAAGTTTAA
ATTTTATAGACAGTCAAGAAGACAGTGATGCAAAATTAGAAAATGAATTT
TCATCTTTCAGACCAGAATCTGACAATTCATATCACTCCTATGAAAATAA
CGACGACAATAACTCCATTGCAGAAGAGAATATTTTTCTAAAAGTCGAGC
CAACTGACTCCATGGACGTAGATATTTTAAATTAAACCTATTTGACTCAC
AATGCTTTGTATAATTGTTTTGTAAAAATGTATTT
back to top

protein sequence of SMED30023708-orf-1

>SMED30023708-orf-1 ID=SMED30023708-orf-1|Name=SMED30023708-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=308bp
MNFMEQNNSLMKSFHQLLHSHWLNPLQVIPPVSTRYSSYSSSTASFISPG
KSESSDQEEPLNLSLKYCDVQLSKSQNSPVPTNQFRLSSQIPLMIPHVFQ
TLFTSRPILPNIPKSHSMSGFFPLQMTTMNDCNKQKRKSTPVKLKKSRCF
KCNQCRQIFPCLNNLTEHTLQVHGSYKCHICNTSFTQRSNLQRHALRHVG
FKPYKCGVCSKEYYRKDHLIRHISFNHPMVSPKENIIQRLSSSESLNFID
SQEDSDAKLENEFSSFRPESDNSYHSYENNDDNNSIAEENIFLKVEPTDS
MDVDILN*
back to top
Aliases
The feature 'ZFP-1' has the following synonyms
Synonym
ZFP-1
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000026gut
PLANA:0000028Category 2 cell
PLANA:0000418head
PLANA:0000419prepharyngeal region
PLANA:0000420parapharyngeal region
PLANA:0000421tail
PLANA:0000429neoblast
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0002142parenchyma
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036236Znf_C2H2_sf
IPR015880Znf_C2H2-like
IPR013087Znf_C2H2_type
IPR007087Znf_C2H2
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
GO:0046872metal ion binding
GO:0003700transcription factor activity, sequence-specific DNA binding
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0006351transcription, DNA-templated
GO:0006355regulation of transcription, DNA-templated
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR013087Zinc finger C2H2-typeSMARTSM00355c2h2final6coord: 204..227
e-value: 0.035
score: 23.2
coord: 150..173
e-value: 0.24
score: 20.5
coord: 176..198
e-value: 8.1E-4
score: 28.7
IPR013087Zinc finger C2H2-typePFAMPF00096zf-C2H2coord: 176..198
e-value: 3.1E-6
score: 27.3
coord: 204..227
e-value: 3.5E-4
score: 20.8
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 178..198
IPR013087Zinc finger C2H2-typePROSITEPS00028ZINC_FINGER_C2H2_1coord: 206..227
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 204..232
score: 10.575
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 176..203
score: 13.713
IPR013087Zinc finger C2H2-typePROSITEPS50157ZINC_FINGER_C2H2_2coord: 150..178
score: 9.556
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 175..203
e-value: 1.3E-9
score: 39.7
NoneNo IPR availableGENE3DG3DSA:3.30.160.60coord: 204..230
e-value: 8.6E-8
score: 33.9
NoneNo IPR availablePANTHERPTHR24406:SF8LD15405Pcoord: 126..224
NoneNo IPR availablePANTHERPTHR24406FAMILY NOT NAMEDcoord: 126..224
NoneNo IPR availablePANTHERPTHR24406:SF8LD15405Pcoord: 176..246
NoneNo IPR availablePANTHERPTHR24406FAMILY NOT NAMEDcoord: 176..246
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 175..223
IPR036236Zinc finger C2H2 superfamilySUPERFAMILYSSF57667beta-beta-alpha zinc fingerscoord: 148..186