Retrovirus-related Pol polyprotein from transposon

Overview
NameRetrovirus-related Pol polyprotein from transposon
Smed IDSMED30023707
Length (bp)599
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Retrovirus-related Pol polyprotein from transposon (SMED30023707) t-SNE clustered cells

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from transposon (SMED30023707) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Retrovirus-related Pol polyprotein from transposon (SMED30023707) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Retrovirus-related Pol polyprotein from transposon (SMED30023707) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023707

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023707 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023707 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023707 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023707 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023707 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023707 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023707 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
enteric muscle cellSMED30023707 dd_Smed_v4_12993_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: FO704673.1 (pep chromosome:GRCz11:12:14545475:14551077:-1 gene:ENSDARG00000112601.1 transcript:ENSDART00000188717.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:FO704673.1)

HSP 1 Score: 56.9954 bits (136), Expect = 2.835e-9
Identity = 39/104 (37.50%), Postives = 57/104 (54.81%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNLDEDCE--KAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQID-DSGRENVIAYGSHAMS 337
            FLG  N+Y +FI++Y+  S    P   + K K + L  + E  K+F + K     APILK P   + F++E DAS   IGAVLSQ   + G+ +  AY S  ++
Sbjct:  736 FLGFANFYRRFIRNYSLISA---PLTSLLKGKPSKLKWNPETVKSFEKLKTSFTTAPILKHPNPELPFVVEVDASDYGIGAVLSQRHGNPGKLHPCAYFSRKLT 836          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: CU929458.1 (pep chromosome:GRCz11:11:43363075:43368382:1 gene:ENSDARG00000114395.1 transcript:ENSDART00000179934.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CU929458.1)

HSP 1 Score: 55.8398 bits (133), Expect = 6.624e-9
Identity = 31/89 (34.83%), Postives = 46/89 (51.69%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNS------KKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQ 283
            FLG  N+Y +FI+ ++  +       KR   K+ W         +  +AF + K +   APIL+ P   + FI+E DAS   +GAVLSQ
Sbjct:  749 FLGFANFYRRFIRGFSSIAAPLTAMTKRNSHKLSWSS-------EARQAFCDLKTQFTTAPILRHPNPDLPFIVEVDASNTGVGAVLSQ 830          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: BX890543.1 (pep chromosome:GRCz11:14:42224893:42231293:-1 gene:ENSDARG00000114583.1 transcript:ENSDART00000185486.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX890543.1)

HSP 1 Score: 55.4546 bits (132), Expect = 8.602e-9
Identity = 34/106 (32.08%), Postives = 60/106 (56.60%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSK--KRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQ---IDDSGRENVIAYGSHAMS 337
            FLG  N+Y +FI+++ + +     +    +W +     + D ++AF E K + ++AP+L +P     FI+E DAS   +GAVLSQ   +D  G+ +  A+ SH ++
Sbjct:  746 FLGFANFYRRFIRNFGQIAAPLTALTSPKVWFK----WNSDAQEAFDELKSRFVSAPVLSIPDPEQQFIVEVDASDVGVGAVLSQRSCLD--GKVHPCAFFSHRLN 845          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: CR354395.2 (pep chromosome:GRCz11:12:13553730:13556536:-1 gene:ENSDARG00000101547.2 transcript:ENSDART00000166396.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CR354395.2)

HSP 1 Score: 55.4546 bits (132), Expect = 9.004e-9
Identity = 31/89 (34.83%), Postives = 46/89 (51.69%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNS------KKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQ 283
            FLG  N+Y +FI+ ++  +       KR   K+ W         +  +AF + K +   APIL+ P   + FI+E DAS   +GAVLSQ
Sbjct:  407 FLGFANFYRRFIRGFSSIAAPLTAMTKRNSHKLSWSS-------EARQAFSDLKTQFTTAPILRHPNPDLPFIVEVDASNTGVGAVLSQ 488          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Match: BX571665.1 (pep chromosome:GRCz11:17:35431724:35437222:1 gene:ENSDARG00000111789.1 transcript:ENSDART00000190293.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:BX571665.1)

HSP 1 Score: 55.4546 bits (132), Expect = 9.556e-9
Identity = 31/89 (34.83%), Postives = 46/89 (51.69%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNS------KKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQ 283
            FLG  N+Y +FI+ ++  +       KR   K+ W         +  +AF + K +   APIL+ P   + FI+E DAS   +GAVLSQ
Sbjct:  742 FLGFANFYRRFIRGFSSIAAPLTAMTKRNSHKLSWSS-------EARQAFSDLKTQFTTAPILRHPNPDLPFIVEVDASNTGVGAVLSQ 823          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: ENSXETT00000024810.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:KV464121.1:1437:3201:1 gene:ENSXETG00000014958.1 transcript:ENSXETT00000024810.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.7221 bits (195), Expect = 4.282e-17
Identity = 43/103 (41.75%), Postives = 55/103 (53.40%), Query Frame = 2
Query:   32 VFLGLTNYYMKFIKDYTKNSK-------KRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAY 319
             FLG   YY +FI +Y+  +K       KR PR + W         +C  A    K  L+NAP+L  P FS  FI+ TDAS   IGAVLSQ+D+ G E+ I Y
Sbjct:  118 AFLGTAGYYRRFIPNYSAIAKPLTDLTSKRRPRVVTWT-------PECATAMSALKSALVNAPVLYAPDFSRGFIVHTDASTYGIGAVLSQVDEKGGEHPIIY 213          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: anxa6 (annexin A6 [Source:Xenbase;Acc:XB-GENE-989741])

HSP 1 Score: 72.0182 bits (175), Expect = 2.941e-14
Identity = 41/107 (38.32%), Postives = 59/107 (55.14%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSK-------KRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAM 334
            FLG + YY KFI +Y+  +K       ++  R I+W         +CE A    K  L ++P+L  P FS  FIL+TDAS   +GAVLSQ++  G E+ +AY S  +
Sbjct:  569 FLGTSGYYRKFIPNYSTVAKPLTDLTSRQRSRTIVWT-------PECESAMNALKQALASSPVLAAPDFSRRFILQTDASNFGLGAVLSQVNTYGEEHPVAYLSRKL 668          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: ENSXETT00000011934.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:3:51966053:51967075:1 gene:ENSXETG00000005538.1 transcript:ENSXETT00000011934.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.526e-9
Identity = 32/101 (31.68%), Postives = 52/101 (51.49%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMS 337
            FLG+  YY +F+ ++   +          K        + E+AF+  K  L   P+L  P F   F+++TDAS   +GAVLSQ+ + G E+ +AY S  ++
Sbjct:   43 FLGIVGYYRRFVPNFASLASPLTDLTKGSKAGAITWTPEAEEAFLNLKASLCRYPVLIAPNFKKEFLVQTDASEVGLGAVLSQVVN-GEEHPVAYLSRKLT 142          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Match: ENSXETT00000031144.1 (pep primary_assembly:Xenopus_tropicalis_v9.1:8:63282574:63284044:1 gene:ENSXETG00000009810.1 transcript:ENSXETT00000031144.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 48.9062 bits (115), Expect = 1.973e-6
Identity = 32/116 (27.59%), Postives = 53/116 (45.69%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKK--RIPRKIMWKQKETNLD----------EDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQK 346
            FLG   YY +F++ Y++ +     + R      + T  D            CE AF++ K +L  AP+L        ++L  DAS++ +G VL Q    G   V AY S +++  +
Sbjct:   49 FLGFCGYYRRFVEGYSRVAHPLNELLRLSNVHGEGTKRDAKAPFGDKWTSACEGAFVQLKKRLTEAPVLAYADAHRPYVLHVDASYEGLGGVLHQRYPEGLRPV-AYLSRSLAPSE 163          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|Q8I7P9|POL5_DROME (Retrovirus-related Pol polyprotein from transposon opus OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 70.4774 bits (171), Expect = 4.449e-13
Identity = 47/111 (42.34%), Postives = 64/111 (57.66%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKK--RIPRKIMWKQKET-------NLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSK 340
            FLG+T+YY KFI+DY K +K    + R +    K +        LDE   ++F + K  L ++ IL  P F+  F L TDAS   IGAVLSQ DD GR+  IAY S +++K
Sbjct:  361 FLGMTSYYRKFIQDYAKVAKPLTNLTRGLYANIKSSQSSKVPITLDETALQSFNDLKSILCSSEILAFPCFTKPFHLTTDASNWAIGAVLSQ-DDQGRDRPIAYISRSLNK 470          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|P10394|POL4_DROME (Retrovirus-related Pol polyprotein from transposon 412 OS=Drosophila melanogaster OX=7227 GN=POL PE=4 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 8.988e-13
Identity = 41/109 (37.61%), Postives = 60/109 (55.05%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDY-------TKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSK 340
            F+   NYY +FIK++       T+  KK +P    W        ++C+KAFI  K +LIN  +L+ P FS  F + TDAS    GAVL+Q + +G +  +AY S A +K
Sbjct:  553 FVAFCNYYRRFIKNFADYSRHITRLCKKNVP--FEWT-------DECQKAFIHLKSQLINPTLLQYPDFSKEFCITTDASKQACGAVLTQ-NHNGHQLPVAYASRAFTK 651          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|P20825|POL2_DROME (Retrovirus-related Pol polyprotein from transposon 297 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 6.404e-8
Identity = 39/87 (44.83%), Postives = 49/87 (56.32%), Query Frame = 2
Query:   32 VFLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNLDE---DCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQ 283
             FLGLT YY KFI +Y   +K   P     K K T +D    +  +AF + K  +I  PIL+LP F   F+L TDAS   +GAVLSQ
Sbjct:  443 AFLGLTGYYRKFIPNYADIAK---PMTSCLK-KRTKIDTQKLEYIEAFEKLKALIIRDPILQLPDFEKKFVLTTDASNLALGAVLSQ 525          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|Q99315|YG31B_YEAST (Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=TY3B-G PE=1 SV=3)

HSP 1 Score: 51.9878 bits (123), Expect = 9.408e-7
Identity = 39/109 (35.78%), Postives = 59/109 (54.13%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKR---IPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGR-ENVIAYGSHAM-SKQK 346
            FLG+ NYY +FI + +K ++     I  K  W +K+       +KA  + KD L N+P+L        + L TDAS D IGAVL ++D+  +   V+ Y S ++ S QK
Sbjct:  827 FLGMINYYRRFIPNCSKIAQPIQLFICDKSQWTEKQ-------DKAIDKLKDALCNSPVLVPFNNKANYRLTTDASKDGIGAVLEEVDNKNKLVGVVGYFSKSLESAQK 928          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Match: sp|P04323|POL3_DROME (Retrovirus-related Pol polyprotein from transposon 17.6 OS=Drosophila melanogaster OX=7227 GN=pol PE=4 SV=1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.879e-6
Identity = 33/84 (39.29%), Postives = 47/84 (55.95%), Query Frame = 2
Query:   32 VFLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQ 283
             FLGLT YY KFI ++  +  K + + +    K    + + + AF + K  +   PILK+P F+  F L TDAS   +GAVLSQ
Sbjct:  444 AFLGLTGYYRKFIPNFA-DIAKPMTKCLKKNMKIDTTNPEYDSAFKKLKYLISEDPILKVPDFTKKFTLTTDASDVALGAVLSQ 526          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A5S6QWV2 (Uncharacterized protein OS=Trichuris muris OX=70415 PE=4 SV=1)

HSP 1 Score: 95.9005 bits (237), Expect = 2.783e-19
Identity = 47/102 (46.08%), Postives = 69/102 (67.65%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSK 340
            F+GL +YY KF+K++   +      +++ K K  + D+DCE+AF E K +L+ APILK P F+  F+L+ DAS D +GAVLSQ+ D G E+ IAY S A++K
Sbjct:  427 FIGLASYYRKFVKNFASIAAPL--HRLLQKDKRWSWDDDCERAFQEMKRRLLTAPILKFPDFNKTFVLDVDASNDGLGAVLSQVHDDG-EHPIAYASRALTK 525          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A2G8JLM8 (RT_RNaseH_2 domain-containing protein OS=Stichopus japonicus OX=307972 GN=BSL78_26534 PE=4 SV=1)

HSP 1 Score: 87.4261 bits (215), Expect = 3.525e-18
Identity = 48/115 (41.74%), Postives = 68/115 (59.13%), Query Frame = 2
Query:   23 N*GVFLGLTNYYMKFIKDYTKNSK-------KRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQK 346
            N   FLGLT YY KF+ ++ K +K       K +P  + W       D+ CE+AF   KDKL + PIL  P F+  F+++TDAS   IGAVLSQ D  G+E+ +AY S  +S+++
Sbjct:   13 NVRAFLGLTGYYRKFVPNFAKLAKPLTDLTRKDLPNAVHW-------DQACEQAFQSLKDKLTSQPILYAPDFNKTFVVQTDASNFGIGAVLSQTDKDGKEHPVAYISRKLSERE 120          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: W4L7E6 (RT_RNaseH_2 domain-containing protein OS=Candidatus Entotheonella gemina OX=1429439 GN=ETSY2_50775 PE=4 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 4.033e-18
Identity = 49/108 (45.37%), Postives = 61/108 (56.48%), Query Frame = 2
Query:   32 VFLGLTNYYMKFIKDY-------TKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAM 334
             FLGLT YY KFI DY       T  +KK  P ++ W          CEKAF   KDKL +AP+L+ P F   FIL+TDAS   +GAVLSQ DD G +  +A+ S  +
Sbjct:   15 AFLGLTGYYRKFIADYAELAVELTDLTKKDAPSRVRWTAA-------CEKAFQALKDKLCSAPVLRSPNFDKQFILQTDASDRGVGAVLSQYDDDGTDYPVAFFSRKL 115          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A1X7SIY1 (RT_RNaseH domain-containing protein OS=Amphimedon queenslandica OX=400682 PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 9.988e-18
Identity = 47/105 (44.76%), Postives = 60/105 (57.14%), Query Frame = 2
Query:   32 VFLGLTNYYMKFIKDY-------TKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGS 325
             FLGL  YY KFI ++       T  +KK  P  + W       D  C  AFI  K+ L  AP+L  P F+  FIL+TDAS   +GAVLSQ+DDSG+E+ +AY S
Sbjct:    4 AFLGLAGYYRKFIPNFASIAVALTDCTKKAAPTTVQW-------DTHCNTAFITLKELLCRAPVLNSPDFNRPFILQTDASDRGVGAVLSQLDDSGQEHPVAYFS 101          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Match: A0A147BBG1 (Putative transposon ty3-i gag-pol polyprotein (Fragment) OS=Ixodes ricinus OX=34613 PE=4 SV=1)

HSP 1 Score: 88.9669 bits (219), Expect = 5.600e-17
Identity = 45/102 (44.12%), Postives = 66/102 (64.71%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSK 340
            FLGL +YY KF+ ++   +      K++ KQ +    + C+ +F E K +L N+P+L  P F + FIL+TDAS + IGAVLSQ+ D G+E VIAYGS  ++K
Sbjct:  476 FLGLASYYRKFVANFAGIAAPL--HKLLEKQVQFVWTQQCQDSFEELKQRLTNSPVLAFPNFDLPFILDTDASENGIGAVLSQVQD-GKERVIAYGSRTLTK 574          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000039384.1 (pep primary_assembly:Astyanax_mexicanus-2.0:25:21146036:21149703:-1 gene:ENSAMXG00000035834.1 transcript:ENSAMXT00000039384.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 79.337 bits (194), Expect = 4.896e-17
Identity = 47/115 (40.87%), Postives = 68/115 (59.13%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQKMVIEYAREKQD 379
            F+GL +YY +F+  + + +  R   K+  K       ++C+ AF   KDKL++APIL  P     FIL+TDAS   IGA+LSQ  D G E V+AY S A+S+Q+    YA  K++
Sbjct:   85 FVGLASYYRRFVSGFAELA--RPLHKLTEKGVSFKWTQECQTAFQTLKDKLVSAPILTFPDPGQTFILDTDASDVAIGAILSQKID-GFEKVVAYASRALSRQEK--NYATTKKE 194          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000039316.1 (pep primary_assembly:Astyanax_mexicanus-2.0:15:30933509:30934681:1 gene:ENSAMXG00000029182.1 transcript:ENSAMXT00000039316.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.5666 bits (192), Expect = 6.378e-17
Identity = 44/104 (42.31%), Postives = 63/104 (60.58%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQK 346
            F+GL +YY +F+  + + +  R   K+  K       ++C+ AF   KDKL++APIL  P     FIL+TDAS   IGA+LSQ  D G E V+AY S A+S+Q+
Sbjct:   97 FVGLASYYRRFVSGFAELA--RPLHKLTEKGVSFKWTQECQTAFQTLKDKLVSAPILTFPDPGQTFILDTDASDVAIGAILSQKID-GFEKVVAYASRALSRQE 197          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000051425.1 (pep primary_assembly:Astyanax_mexicanus-2.0:24:673219:676197:-1 gene:ENSAMXG00000029629.1 transcript:ENSAMXT00000051425.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 2.175e-15
Identity = 42/105 (40.00%), Postives = 62/105 (59.05%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQK-ETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQK 346
            F+GL +YY +FI+ +   +    P   + K   +    ++ E+AF E K +L NAPIL  P  S  FI++TDAS   +GAVLSQ+ D G E+VIAY S  + + +
Sbjct:   45 FVGLASYYRRFIRGFAYVAA---PLHALTKPSVKFRWSDEAERAFEELKSRLCNAPILAFPKVSESFIVDTDASDHGLGAVLSQVQD-GSEHVIAYYSRRLDRAE 145          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000044431.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000182.1:892613:897532:1 gene:ENSAMXG00000038169.1 transcript:ENSAMXT00000044431.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 72.4034 bits (176), Expect = 1.291e-14
Identity = 43/108 (39.81%), Postives = 61/108 (56.48%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDY-------TKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMS 337
            FLGL  YY +F+ ++       T  +KKR P ++ W         D EKAF + K+ L +AP+L+ P FS  FI+ TDAS   +GAVLSQ  D G E+ I + S  ++
Sbjct: 1001 FLGLAGYYRRFVPNFSSIAVPLTDMTKKRQPEEVQWST-------DAEKAFTQLKEALTSAPVLRNPDFSQPFIVHTDASEIGLGAVLSQEVD-GMEHPILFLSKKLN 1100          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Match: ENSAMXT00000030446.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000181.1:474500:475675:-1 gene:ENSAMXG00000036877.1 transcript:ENSAMXT00000030446.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 71.633 bits (174), Expect = 1.652e-14
Identity = 42/105 (40.00%), Postives = 61/105 (58.10%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKET-NLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQK 346
            F+GL +YY +FI+ +   +    P   + +   T    ++ E+AF E K +L NAP+L  P  S  FI++TDAS   +GAVLSQ+ D G E VIAY S  + K +
Sbjct:   97 FVGLASYYRRFIRGFADVAA---PLHNLTRPGVTFRWSDEAERAFGELKRRLCNAPVLAYPNMSESFIVDTDASDRGLGAVLSQVQD-GSERVIAYYSRRLDKAE 197          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000036827.1 (pep primary_assembly:ASM223467v1:16:28613823:28617539:1 gene:ENSORLG00000023550.1 transcript:ENSORLT00000036827.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 69.3218 bits (168), Expect = 1.373e-13
Identity = 43/107 (40.19%), Postives = 62/107 (57.94%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKK--RIPRK---IMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSK 340
            FLGL +YY +F++ ++  +     + RK    +W Q       +CE+AF   K  L N+PIL  P   + FIL+TDAS   +GAVLSQ+  +G E V+AY S  +SK
Sbjct:  506 FLGLASYYRRFVRGFSCIAAPLFHLQRKDCDFVWTQ-------ECEQAFSSLKKALTNSPILTPPDPKLPFILDTDASDVGMGAVLSQMGSAG-ERVVAYFSKTLSK 604          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000040305.1 (pep primary_assembly:ASM223467v1:1:25459511:25466649:-1 gene:ENSORLG00000028409.1 transcript:ENSORLT00000040305.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.9366 bits (167), Expect = 1.808e-13
Identity = 39/101 (38.61%), Postives = 61/101 (60.40%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMS 337
            F+GL +YY +F+ D+   +  R   ++  K    +   +C++AF E K++L +APIL  P  S   +L+TDAS   +GAVLSQ+   G E V+AYGS  ++
Sbjct: 1065 FVGLASYYRRFVADFA--TIARPLHELTKKYARFDWTTECQEAFEELKERLTSAPILGYPLDSGELLLDTDASDWGVGAVLSQV-QGGEERVLAYGSRRLT 1162          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000045600.1 (pep primary_assembly:ASM223467v1:4:26167161:26171153:-1 gene:ENSORLG00000023514.1 transcript:ENSORLT00000045600.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 67.0106 bits (162), Expect = 8.507e-13
Identity = 42/111 (37.84%), Postives = 59/111 (53.15%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTK-----NS--KKRIPRKIMWKQKETNLDE----DCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAM 334
            FLG  +YY +FI  + K     NS   + +P     K  +  +DE    +CEK+F E K  LI AP+L    F   F+LE DAS   +GAVLSQ +  GR   +A+ S ++
Sbjct:  573 FLGFASYYRRFIAGFAKIASPLNSLVARLLPPGRKGKTPKKPVDEFWDAECEKSFQELKTALITAPVLAYANFQKPFVLEVDASHGGLGAVLSQ-EHEGRRRPVAFASRSL 682          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000044989.1 (pep primary_assembly:ASM223467v1:1:17572028:17576089:-1 gene:ENSORLG00000028051.1 transcript:ENSORLT00000044989.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.855 bits (159), Expect = 2.400e-12
Identity = 45/135 (33.33%), Postives = 67/135 (49.63%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTK-------------NSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQKMVIEYAREKQDNRFNYAK 400
            FLG  +YY +F++ +++             N       K ++K   T    +C+ +F E K++L +AP+L    FS+ FILETDAS   +GAVL QI D G + VIAY S  +           EK D  ++  K
Sbjct:  505 FLGFCSYYRRFLQGFSQLAGPLHDAVNTCLNQSNMSRSKNLFKSVWT---AECQDSFEELKERLTSAPLLGYANFSLPFILETDASSLGLGAVLYQIQD-GEKRVIAYASRRLR--------GAEKNDRNYSSMK 627          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Match: ENSORLT00000037716.1 (pep primary_assembly:ASM223467v1:20:9739400:9742664:-1 gene:ENSORLG00000027308.1 transcript:ENSORLT00000037716.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 65.0846 bits (157), Expect = 3.246e-12
Identity = 38/113 (33.63%), Postives = 58/113 (51.33%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTK-------------NSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAM 334
            FLGL  YY +F+  +                +K+   ++I+W         DC+ +F   K+ L  APIL    F+  F++ TDAS   +GAVL+Q+ + GRE VIAY S ++
Sbjct:  352 FLGLAGYYRRFVAGFANIARPLNSLLVGIPATKRSGTQRIVWT-------PDCKASFDALKEALTQAPILAYADFNKPFVVYTDASHHGLGAVLAQVQE-GRERVIAYASRSL 456          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000029259.1 (SMESG000029259.1)

HSP 1 Score: 112.079 bits (279), Expect = 1.628e-28
Identity = 61/105 (58.10%), Postives = 69/105 (65.71%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKE-TNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQK 346
            FLG+ NYY +FIKDY K  K R    I  K  E     E CEKAF E K+ LI AP+L  P F   FIL+TDASFD IGAVLSQ D+ G E+VIAYGSHAMS  +
Sbjct: 2961 FLGICNYYRRFIKDYAK--KARALESICGKNNEKIRWTEMCEKAFGEMKEALITAPVLVFPDFRKEFILDTDASFDTIGAVLSQKDEKGHEHVIAYGSHAMSSHE 3063          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000061863.1 (SMESG000061863.1)

HSP 1 Score: 105.145 bits (261), Expect = 5.640e-28
Identity = 54/76 (71.05%), Postives = 61/76 (80.26%), Query Frame = 2
Query:  122 KQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQKM 349
            K+K+    ED EKAFIE  DKLINAPILK   F   FIL+T+ SFDRIGAVL Q+DDSGRENVIAYGSHAMSKQ++
Sbjct:  117 KEKKLIWTEDGEKAFIEHSDKLINAPILKFSDFLRPFILDTNDSFDRIGAVLFQVDDSGRENVIAYGSHAMSKQEV 192          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000031172.1 (SMESG000031172.1)

HSP 1 Score: 99.3673 bits (246), Expect = 2.715e-24
Identity = 55/108 (50.93%), Postives = 70/108 (64.81%), Query Frame = 2
Query:   32 VFLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNL--DEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQKM 349
            +FL +TNYY +F K+YT+ +K   P +I+       L   + CE AF   K+KL+ APIL    FS  FIL+TDASFDRI AVLSQ D +G E +IAYGSHAMS   +
Sbjct:  386 IFLSMTNYYRRFNKNYTEYTK---PLEILCGSNSNKLIVTDICESAFQSLKEKLMKAPILAYLDFSKEFILDTDASFDRIKAVLSQEDKNGNEKLIAYGSHAMSAHDL 490          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000016546.1 (SMESG000016546.1)

HSP 1 Score: 97.8265 bits (242), Expect = 1.042e-23
Identity = 51/110 (46.36%), Postives = 69/110 (62.73%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKK------RIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQK 346
            F G+ NYY +FIKDY K ++       +   K++W        E+CEKAF + K  L  +P+L  P F+  FI++TD+SFD IG VLSQ D++G E VIAYGSHAMS  +
Sbjct:  347 FPGICNYYRRFIKDYAKKTRTLEELCGKYNVKLIWA-------ENCEKAFEDMKKALTESPVLGYPDFTRDFIIDTDSSFDTIGDVLSQKDNNGYEKVIAYGSHAMSTHE 449          
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Match: SMESG000041138.1 (SMESG000041138.1)

HSP 1 Score: 89.7373 bits (221), Expect = 3.624e-21
Identity = 48/104 (46.15%), Postives = 61/104 (58.65%), Query Frame = 2
Query:   35 FLGLTNYYMKFIKDYTKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILKLPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQK 346
            FLGL+NYY +F+KDY K     I   I W        E+C K+F + KD L   PIL  P     FIL+TDASF+ IGAVL+QI + G E VI YGS  ++  +
Sbjct:  157 FLGLSNYYRRFVKDYAK-----IAAPIKW-------SENCGKSFSQPKDALTQTPILDFPRIDRKFILDTDASFEAIGAVLNQIKEDGSEIVITYGSRHLTAHE 248          
The following BLAST results are available for this feature:
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FO704673.12.835e-937.50pep chromosome:GRCz11:12:14545475:14551077:-1 gene... [more]
CU929458.16.624e-934.83pep chromosome:GRCz11:11:43363075:43368382:1 gene:... [more]
BX890543.18.602e-932.08pep chromosome:GRCz11:14:42224893:42231293:-1 gene... [more]
CR354395.29.004e-934.83pep chromosome:GRCz11:12:13553730:13556536:-1 gene... [more]
BX571665.19.556e-934.83pep chromosome:GRCz11:17:35431724:35437222:1 gene:... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000024810.14.282e-1741.75pep primary_assembly:Xenopus_tropicalis_v9.1:KV464... [more]
anxa62.941e-1438.32annexin A6 [Source:Xenbase;Acc:XB-GENE-989741][more]
ENSXETT00000011934.11.526e-931.68pep primary_assembly:Xenopus_tropicalis_v9.1:3:519... [more]
ENSXETT00000031144.11.973e-627.59pep primary_assembly:Xenopus_tropicalis_v9.1:8:632... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8I7P9|POL5_DROME4.449e-1342.34Retrovirus-related Pol polyprotein from transposon... [more]
sp|P10394|POL4_DROME8.988e-1337.61Retrovirus-related Pol polyprotein from transposon... [more]
sp|P20825|POL2_DROME6.404e-844.83Retrovirus-related Pol polyprotein from transposon... [more]
sp|Q99315|YG31B_YEAST9.408e-735.78Transposon Ty3-G Gag-Pol polyprotein OS=Saccharomy... [more]
sp|P04323|POL3_DROME1.879e-639.29Retrovirus-related Pol polyprotein from transposon... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5S6QWV22.783e-1946.08Uncharacterized protein OS=Trichuris muris OX=7041... [more]
A0A2G8JLM83.525e-1841.74RT_RNaseH_2 domain-containing protein OS=Stichopus... [more]
W4L7E64.033e-1845.37RT_RNaseH_2 domain-containing protein OS=Candidatu... [more]
A0A1X7SIY19.988e-1844.76RT_RNaseH domain-containing protein OS=Amphimedon ... [more]
A0A147BBG15.600e-1744.12Putative transposon ty3-i gag-pol polyprotein (Fra... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039384.14.896e-1740.87pep primary_assembly:Astyanax_mexicanus-2.0:25:211... [more]
ENSAMXT00000039316.16.378e-1742.31pep primary_assembly:Astyanax_mexicanus-2.0:15:309... [more]
ENSAMXT00000051425.12.175e-1540.00pep primary_assembly:Astyanax_mexicanus-2.0:24:673... [more]
ENSAMXT00000044431.11.291e-1439.81pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000030446.11.652e-1440.00pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000036827.11.373e-1340.19pep primary_assembly:ASM223467v1:16:28613823:28617... [more]
ENSORLT00000040305.11.808e-1338.61pep primary_assembly:ASM223467v1:1:25459511:254666... [more]
ENSORLT00000045600.18.507e-1337.84pep primary_assembly:ASM223467v1:4:26167161:261711... [more]
ENSORLT00000044989.12.400e-1233.33pep primary_assembly:ASM223467v1:1:17572028:175760... [more]
ENSORLT00000037716.13.246e-1233.63pep primary_assembly:ASM223467v1:20:9739400:974266... [more]
back to top
BLAST of Retrovirus-related Pol polyprotein from transposon vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000029259.11.628e-2858.10SMESG000029259.1[more]
SMESG000061863.15.640e-2871.05SMESG000061863.1[more]
SMESG000031172.12.715e-2450.93SMESG000031172.1[more]
SMESG000016546.11.042e-2346.36SMESG000016546.1[more]
SMESG000041138.13.624e-2146.15SMESG000041138.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023707 ID=SMED30023707|Name=Retrovirus-related Pol polyprotein from transposon|organism=Schmidtea mediterranea sexual|type=transcript|length=599bp
GAGAGACCTAAGTGTATAAATAAATTAAGGAGTTTTTTTAGGACTAACTA
ACTATTATATGAAATTCATAAAAGATTATACAAAGAATTCCAAAAAAAGA
ATTCCAAGAAAAATTATGTGGAAGCAAAAAGAAACTAATTTGGATGAAGA
CTGCGAGAAAGCATTTATTGAATTTAAAGATAAATTAATAAACGCACCTA
TTTTGAAGCTTCCAGGTTTCTCAATGTTATTTATTTTAGAAACCGATGCT
AGTTTTGATCGTATTGGTGCGGTTTTATCTCAAATTGACGATTCTGGGAG
AGAAAATGTTATTGCATATGGATCACATGCTATGTCTAAACAGAAAATGG
TTATTGAATATGCCAGAGAGAAACAAGACAATCGATTCAATTACGCAAAG
GAAATTTAAAATAGGAGATTGCGTTTTAATTAAAAGCAATACGAATAACA
AAGAAGATTTTGGACCTTGAAATCCACTTATAAGCACAAAATTCAGACAA
AAATTATGTTCACAGATATTAATCAATTTTTCAGTCAACAGTTATCAAGA
ATTTGAGAACGGAGATGACGGGCAATCATTCCAATGTATGTGGCATTGC
back to top

protein sequence of SMED30023707-orf-1

>SMED30023707-orf-1 ID=SMED30023707-orf-1|Name=SMED30023707-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MKFIKDYTKNSKKRIPRKIMWKQKETNLDEDCEKAFIEFKDKLINAPILK
LPGFSMLFILETDASFDRIGAVLSQIDDSGRENVIAYGSHAMSKQKMVIE
YAREKQDNRFNYAKEI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0003104enteric muscle cell
PLANA:0003116parenchymal cell
Vocabulary: molecular function
TermDefinition
GO:0003676nucleic acid binding
Vocabulary: biological process
TermDefinition
GO:0015074DNA integration