sperm-tail PG-rich repeat-containing protein 2

Overview
Namesperm-tail PG-rich repeat-containing protein 2
Smed IDSMED30023691
Length (bp)1937
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of sperm-tail PG-rich repeat-containing protein 2 (SMED30023691) t-SNE clustered cells

Violin plots show distribution of expression levels for sperm-tail PG-rich repeat-containing protein 2 (SMED30023691) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of sperm-tail PG-rich repeat-containing protein 2 (SMED30023691) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for sperm-tail PG-rich repeat-containing protein 2 (SMED30023691) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023691

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023691SMESG000034428.1 SmedASXL_012602SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
pharynxSMED30023691SMESG000034428.1 dd_Smed_v4_9462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
neuronSMED30023691SMESG000034428.1 dd_Smed_v4_9462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30023691SMESG000034428.1 dd_Smed_v4_9462_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023691SMESG000034428.1 dd_Smed_v6_9462_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
reproductive organSMED30023691SMESG000034428.1 Contig27574newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30023691SMESG000034428.1 Contig27574uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30023691SMESG000034428.1 PL08004A1F06ncbi_smed_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
epidermisSMED30023691SMESG000034428.1 dd_Smed_v4_9462_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
dorsal region of the epidermisSMED30023691SMESG000034428.1 dd_Smed_v4_9462_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ventral epidermisSMED30023691SMESG000034428.1 dd_Smed_v4_9462_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult colorimetric in situ hybridization evidence
ventral epidermisSMED30023691SMESG000034428.1 dd_Smed_v4_9462_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
ciliated epithelial cellSMED30023691SMESG000034428.1 dd_Smed_v4_9462_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Human
Match: STPG2 (sperm tail PG-rich repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:28712])

HSP 1 Score: 175.637 bits (444), Expect = 1.060e-47
Identity = 156/535 (29.16%), Postives = 217/535 (40.56%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRD--FNLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDI-DIPGPQVYNLSEAT---REKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQP---KQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSL--PGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEI 1632
            MYDRAPR         T   +GPGSYQ        +   APF SL +R+  F +A                                     I+  +PGPG Y V +  K     S+  T+T    +        PSIP+   ++GY     G +IK  PP  D +LGPA+Y P+   +  T KYKG  +  + + R +     GPGPGQYD    +    T YY++    +  Q     FI  L    +                                     + +RF       P PG+YN+PRTAL SLKK +G+K  PFG +A RFT+ +   ++PGP  YN+   T     +       KK  FGS+  R      + A   PGP+ YQ     Q    S     +++ +A+  +R    +      +P    YDV  ++  SQ K  Y  PR+  AKR+H SFLS   R        C++     PGPA+Y+     +     F    KRF    E TPGP  YEI
Sbjct:    1 MYDRAPRLLKLAEGGSTEAHVGPGSYQVPFLKQQATGSNAPFLSLTARESTFTIASS-----------------------------------IEKAVPGPGHYNVSEAQKI----SRSPTLTRSVDV--------PSIPSCGKSYGYHINDDGSIIKCFPPACDSTLGPAYYKPQFDVSNATLKYKGIHFG-NSSGRQELPKKSGPGPGQYDIVQKK----TSYYENVNIKRDQQQNYCSFIPRLYEIIVLQE----------------------------------KKKRFLPMKSITPAPGTYNEPRTALKSLKKTSGLKNIPFGQSAVRFTQDIRTEEMPGPGFYNVLNNTIIASVRNICSKKQKKSAFGSSVPRTFFSVQKEACATPGPADYQEFWHSQGVGISDELPNLTNKYAAFLSRAKRTMKVPDMVIPAPGSYDVHKSYEMSQVKHKYMPPRSLVAKRKHASFLSATPR--------CLEKVTDGPGPAAYNPVLRKSCPIPLFVKASKRFEESKEITPGPATYEI 441          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Human
Match: STPG2 (sperm tail PG-rich repeat containing 2 [Source:HGNC Symbol;Acc:HGNC:28712])

HSP 1 Score: 60.077 bits (144), Expect = 7.889e-10
Identity = 52/172 (30.23%), Postives = 73/172 (42.44%), Query Frame = 1
Query: 1159 GSTSIRDVDLGNRNANDIPGPSHYQP---KQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSL--PGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIK-----PRG 1644
            GS+  R      + A   PGP+ YQ     Q    S     +++ +A+  +R    +      +P    YDV  ++  SQ K  Y  PR+  AKR+H SFLS   R        C++     PGPA+Y+     +     F    KRF    E TPGP  YE+      PRG
Sbjct:    1 GSSVPRTFFSVQKEACATPGPADYQEFWHSQGVGISDELPNLTNKYAAFLSRAKRTMKVPDMVIPAPGSYDVHKSYEMSQVKHKYMPPRSLVAKRKHASFLSATPR--------CLEKVTDGPGPAAYNPVLRKSCPIPLFVKASKRFEESKEITPGPATYEMNNTEESPRG 164          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Zebrafish
Match: stpg2 (pep chromosome:GRCz11:5:6954162:7005117:1 gene:ENSDARG00000061060.6 transcript:ENSDART00000086666.6 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:stpg2)

HSP 1 Score: 231.491 bits (589), Expect = 1.827e-67
Identity = 181/560 (32.32%), Postives = 254/560 (45.36%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFN-LAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCV-EDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFT-EKVDIDIPGPQVYN-----LSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITLGAKCYLGNRDL 1716
            MYDRAPR FT  +   T  EIGPG+Y    ++      YAPF SL+ RD   L    A   PGP QY+S    N +LGG+S+ N   RF  + SD+PGPG Y V  D +      +K   IT +  +        PSIP+   AFGYEE  QG L K   P RD SLGPAFY P  +E   + KYKG  +     RR    G+  PGPG Y+   D+ +        RE    ++L IPR+ + +  +  K  +PGP  Y      E     +       + PPF  QAQRF    D+ P  G+Y+DPR AL  LKK   + ++PFG TA RF  E      PGP  YN     L++ + +K S +  ++K  FGS + R + L ++     PGP+ Y+         L +  +  F SL       +IQ   + P+   Y    +F+  Q    ++ PR    K +   F   +SR      +     S+P   S + K+    +   ++YR   F     E P    + + P       +  FN+TL        R L
Sbjct:    1 MYDRAPR-FTQLTLSSTTSEIGPGTYNINRSLGGDRGSYAPFLSLSIRDSGFLGSASALHSPGPGQYNSDITRNHVLGGNSLQNRSKRFDDVLSDVPGPGAYNVTNDVLPARKITAKSPKITSK-AVRPSLSPAAPSIPSPGQAFGYEEDAQGVLHKHKVPSRDHSLGPAFYSPAPEELWSSQKYKGVQFGKMSGRREQLKGADEPGPGHYELQEDQTVQYENVNVKREQRSRSELSIPRYHELVPLQEEKKGVPGPGQYYIKSQFETSSNTH----RPAQSPPFLSQAQRFSPVKDETPPVGAYDDPRCALEILKKGRALNKNPFGQTAVRFLPENRSKATPGPGAYNMFGYGLAQESLKKAS-LQSSRKAAFGSVAQRRIFLPSKEEMSTPGPTQYKVSSSPTLKDL-KIQTLEFKSLKFNQNVSIIQS--NTPEPVSYSNYRSFHHFQCDGRFSRPRNTSRKFKKSLFTQASSRIFFLEKI--FHTSIPKYCSVNIKSLKELQFILYFYR--CFKKPESEVPKTSMFHLSPVIMDTVLKGTFNVTLHNPLMSSTRSL 546          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Xenopus
Match: lhfpl2 (LHFPL tetraspan subfamily member 2 [Source:Xenbase;Acc:XB-GENE-958342])

HSP 1 Score: 189.889 bits (481), Expect = 9.252e-53
Identity = 141/417 (33.81%), Postives = 203/417 (48.68%), Query Frame = 1
Query:  424 RNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEK---IEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDID-IPGPQVYNL------SEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKF----DLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEI 1632
            +N +  + E+  PSIP    AFGYEE   G L+KQ PP+RD +LGPA+Y P       T KYKG  +     +R ++   +GPGPG+Y+   D  L         E  K     IPR+ + +  +  K  +PGP +Y  + L       + E   K   +   PF  Q++RF       P PG+YN+ RTA  SLKK++ + ++PFG TA RF +   +   PGP  YN+      SEA  +  S     KKG FGS++ R+     ++A   PGP+ Y      + S +   +S     +++ D+   ++       D P    Y+V  +F  +  K  Y  PRT  AKR+H SFLS+  R       D V+  +PGP +YD K    T       RE+RF    E TPGPG YE+
Sbjct:   39 QNHVKKQHEQCIPSIPIPGKAFGYEETADGFLVKQLPPERDDTLGPAYYQPIHNVAYATLKYKGSHFGKYTGKRLEYQWPEGPGPGEYE--IDHALHYENVNSKMEDKKKYMPFIPRYHEVIALQEEKKGVPGPGNYDIARL-------FGERLTKSANVSQAPFLSQSKRFLPLKSITPAPGTYNEQRTAFESLKKISSLAQTPFGQTAARFAQNSRLHKSPGPGSYNVLRYSFTSEALSK--SDWESNKKGAFGSSAAREFPSSKKDALWTPGPADY------HVSLVLLYLSEFILFISSSDFKMNLKLNVIHFQDAPPPGYYNVCESFEAAHAKGKYRPPRTMQAKRKHTSFLSSTPRTFVLP--DAVE--VPGPGAYDLKIKSGTALTLAVSREERFKEPKEVTPGPGAYEV 434          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Xenopus
Match: lhfpl2 (LHFPL tetraspan subfamily member 2 [Source:Xenbase;Acc:XB-GENE-958342])

HSP 1 Score: 143.28 bits (360), Expect = 8.349e-37
Identity = 114/375 (30.40%), Postives = 167/375 (44.53%), Query Frame = 1
Query:  346 PGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDID-IPGPQVYNLSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASR 1467
            PGPGQY + + IK +   S   T    N  +   E+  PSIP    AFGYEE   G L+KQ PP+RD +LGPA+Y P       T KYKG  +     +R ++   +GPGPG+Y+   D  L         E  K     IPR+ + +   A+++                                   + +RF       P PG+YN+ RTA  SLKK++ + ++PFG TA RF +   +   PG +  N          +    KKG FGS++ R+     ++A   PGP+ Y    +  A+  Y  +  + +S    +    +    D P    Y+V  +F  +  K  Y  PRT  AKR+H SFLS+  R
Sbjct:   36 PGPGQYNILE-IKTFGKISCGPTRQKLN-FLEGHEQCIPSIPIPGKAFGYEETADGFLVKQLPPERDDTLGPAYYQPIHNVAYATLKYKGSHFGKYTGKRLEYQWPEGPGPGEYE--IDHALHYENVNSKMEDKKKYMPFIPRYHEVI---ALQE-----------------------------------EKKRFLPLKSITPAPGTYNEQRTAFESLKKISSLAQTPFGQTAARFAQNSRLHKSPGMKKLNT--------IFSDFNKKGAFGSSAAREFPSSKKDALWTPGPADYHVMPLPLATNKYYFILFISSSDFKMNLKLNVIHFQDAPPPGYYNVCESFEAAHAKGKYRPPRTMQAKRKHTSFLSSTPR 360          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Mouse
Match: Stpg2 (sperm tail PG rich repeat containing 2 [Source:MGI Symbol;Acc:MGI:2685863])

HSP 1 Score: 209.149 bits (531), Expect = 4.030e-59
Identity = 182/571 (31.87%), Postives = 257/571 (45.01%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFN--LAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQY--------CVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASY----------MHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDID-IPGPQVY----NLSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPK----QMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEE-TPGPGQYEIKPRGTSCAERCEFNITL 1683
            MYDRAPR     +   T   +GPG+YQ        +  YAPF SL+S+     ++ D  Q +PGPA Y+  Q    I GG S+ N + RFK + SD PGPG Y        C+  + K           T R   + +  ++ PSIP++  + GY       ++++ PP  D ++GPA+Y P+      + KYKG  +  +   R +F    GPGPGQYD    R L        RE        +PR  + +  +  K  +PGP  Y            S L+  P  ++  E E            RF       P PG+YN+ RTA    KK  G+   PF  +A RFTE      +PGP  Y    N+ +A  +KP  +    K GFGS+  R +    + A   PGPS YQ +    ++ N +K     S+ F  L+  +  P ++ K  LP   +YDV  +++ SQ K  Y  PRT  AK+RH SFLS A R   G   D      PGPA+Y      +     F    KRF     E +PGP  YE+ P       +  +N+TL
Sbjct:    1 MYDRAPRWLDCANRGSTEEHVGPGTYQVPFPKQQATGCYAPFLSLSSKTSACVVSSDAGQAVPGPAHYNVSQAQYNIRGGRSLQNREKRFKKLISDGPGPGSYNWPYLGTLCITTRQK-----------TPRTPAVSRNIDI-PSIPSSGKSHGYHLNDDDTIMRRTPPPSDNTIGPAYYNPQFDYPKASLKYKGVNFG-NATGRQEFLKYSGPGPGQYDIIQKRKLHCENINIKREQEHNYYTYVPRLYEAIILQEEKKGVPGPGKYNIKSEFDMIKSMSALVNSPSFIFFSETE------------RFEPIKSCTPAPGTYNEIRTAFKCPKKRFGLSL-PFNQSAARFTEDSKAQKLPGPGFYDISTNIVKAQVKKPC-LKKQPKTGFGSSVPRTLFTAQKKAFRGPGPSDYQVRGTHDELPNLNK-----SAAF--LSRAEKTPPVR-KMRLPAPGRYDVQKSYDMSQVKHKYMPPRTSVAKKRHSSFLSAAPR-CLGKIADG-----PGPATYSPVLMKSGAIISFVKGPKRFQEFHGEFSPGPTTYELSPFLRHSLLKRTYNVTL 530          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Mouse
Match: Stpg2 (sperm tail PG rich repeat containing 2 [Source:MGI Symbol;Acc:MGI:2685863])

HSP 1 Score: 209.149 bits (531), Expect = 4.030e-59
Identity = 182/571 (31.87%), Postives = 257/571 (45.01%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFN--LAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQY--------CVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASY----------MHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDID-IPGPQVY----NLSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPK----QMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEE-TPGPGQYEIKPRGTSCAERCEFNITL 1683
            MYDRAPR     +   T   +GPG+YQ        +  YAPF SL+S+     ++ D  Q +PGPA Y+  Q    I GG S+ N + RFK + SD PGPG Y        C+  + K           T R   + +  ++ PSIP++  + GY       ++++ PP  D ++GPA+Y P+      + KYKG  +  +   R +F    GPGPGQYD    R L        RE        +PR  + +  +  K  +PGP  Y            S L+  P  ++  E E            RF       P PG+YN+ RTA    KK  G+   PF  +A RFTE      +PGP  Y    N+ +A  +KP  +    K GFGS+  R +    + A   PGPS YQ +    ++ N +K     S+ F  L+  +  P ++ K  LP   +YDV  +++ SQ K  Y  PRT  AK+RH SFLS A R   G   D      PGPA+Y      +     F    KRF     E +PGP  YE+ P       +  +N+TL
Sbjct:    1 MYDRAPRWLDCANRGSTEEHVGPGTYQVPFPKQQATGCYAPFLSLSSKTSACVVSSDAGQAVPGPAHYNVSQAQYNIRGGRSLQNREKRFKKLISDGPGPGSYNWPYLGTLCITTRQK-----------TPRTPAVSRNIDI-PSIPSSGKSHGYHLNDDDTIMRRTPPPSDNTIGPAYYNPQFDYPKASLKYKGVNFG-NATGRQEFLKYSGPGPGQYDIIQKRKLHCENINIKREQEHNYYTYVPRLYEAIILQEEKKGVPGPGKYNIKSEFDMIKSMSALVNSPSFIFFSETE------------RFEPIKSCTPAPGTYNEIRTAFKCPKKRFGLSL-PFNQSAARFTEDSKAQKLPGPGFYDISTNIVKAQVKKPC-LKKQPKTGFGSSVPRTLFTAQKKAFRGPGPSDYQVRGTHDELPNLNK-----SAAF--LSRAEKTPPVR-KMRLPAPGRYDVQKSYDMSQVKHKYMPPRTSVAKKRHSSFLSAAPR-CLGKIADG-----PGPATYSPVLMKSGAIISFVKGPKRFQEFHGEFSPGPTTYELSPFLRHSLLKRTYNVTL 530          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q08BC4|STPG2_DANRE (Sperm-tail PG-rich repeat-containing protein 2 OS=Danio rerio OX=7955 GN=stpg2 PE=2 SV=1)

HSP 1 Score: 276.174 bits (705), Expect = 1.946e-83
Identity = 198/563 (35.17%), Postives = 275/563 (48.85%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFN-LAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIK-CYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFT-EKVDIDIPGPQVYN-----LSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSS-MFASLTNRDYDPVIQGKF--DLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITLGAKCYLGNRDL 1716
            MYDRAPR FT  +   T  EIGPG+Y    ++      YAPF SL+ RD   L    A   PGP QY+S    N +LGG+S+ N   RF  + SD+PGPG Y V + +       +K   IT +  +        PSIP+   AFGYEE  QG L K   P RD SLGPAFY P  +E   + KYKG  +     RR    G+  PGPG Y+   D+ +        RE    ++L IPR+ + +  +  K  +PGP  Y      E     +       + PPF  QAQRF    D+ P  G+YNDPR AL  LKK   + ++PFG TA RF  E      PGP  YN     L++ + +K S +  ++K  FGS + R + L ++     PGP+ Y+ ++   A  LY+  S+  F S ++R    ++   F  D P    Y+V  +F K+Q    Y++PR ++A++R   FLS ASR    + +   DP  PGPA Y      ++       +E RF    +E PGP  YE+ P       +  FN+TL        R L
Sbjct:    1 MYDRAPR-FTQLTLSSTTSEIGPGTYNINRSLGGDRGSYAPFLSLSIRDSGFLGSASALHSPGPGQYNSDITRNHVLGGNSLQNRSKRFDDVLSDVPGPGAYNVTNDVSPARKIKAKSPKITSK-AVRPSLSPAAPSIPSPGQAFGYEEDAQGVLHKHKVPSRDHSLGPAFYSPAPEELWSSQKYKGVQFGKMSGRREPLKGADEPGPGHYELQEDQTVQYENVNVKREQRSRSELSIPRYHELVPLQEEKKGVPGPGQYYIKSQFETSSNTH----RPAQSPPFLSQAQRFSPVKDETPPVGAYNDPRCALEILKKGRALNKNPFGQTAVRFLPENRSKATPGPGAYNMFGYGLAQESLKKAS-LQSSRKAAFGSVAQRRIFLPSKEEMSTPGPTQYKVEKTNEA--LYKKQSTAAFKSASDR----LVVSLFAKDTPPPGSYNVSQSFEKTQCLHQYSKPRNENARKRQSCFLSAASR---NTDVLHNDPHTPGPAYYSPDVKSSSTLALIISKEDRFKDPKDEVPGPTAYELSPVIMDTVLKGTFNVTLHNPLMSSTRSL 547          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q8C8J0|STPG2_MOUSE (Sperm-tail PG-rich repeat-containing protein 2 OS=Mus musculus OX=10090 GN=Stpg2 PE=1 SV=1)

HSP 1 Score: 209.149 bits (531), Expect = 2.819e-58
Identity = 182/571 (31.87%), Postives = 257/571 (45.01%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFN--LAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQY--------CVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASY----------MHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDID-IPGPQVY----NLSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPK----QMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEE-TPGPGQYEIKPRGTSCAERCEFNITL 1683
            MYDRAPR     +   T   +GPG+YQ        +  YAPF SL+S+     ++ D  Q +PGPA Y+  Q    I GG S+ N + RFK + SD PGPG Y        C+  + K           T R   + +  ++ PSIP++  + GY       ++++ PP  D ++GPA+Y P+      + KYKG  +  +   R +F    GPGPGQYD    R L        RE        +PR  + +  +  K  +PGP  Y            S L+  P  ++  E E            RF       P PG+YN+ RTA    KK  G+   PF  +A RFTE      +PGP  Y    N+ +A  +KP  +    K GFGS+  R +    + A   PGPS YQ +    ++ N +K     S+ F  L+  +  P ++ K  LP   +YDV  +++ SQ K  Y  PRT  AK+RH SFLS A R   G   D      PGPA+Y      +     F    KRF     E +PGP  YE+ P       +  +N+TL
Sbjct:    1 MYDRAPRWLDCANRGSTEEHVGPGTYQVPFPKQQATGCYAPFLSLSSKTSACVVSSDAGQAVPGPAHYNVSQAQYNIRGGRSLQNREKRFKKLISDGPGPGSYNWPYLGTLCITTRQK-----------TPRTPAVSRNIDI-PSIPSSGKSHGYHLNDDDTIMRRTPPPSDNTIGPAYYNPQFDYPKASLKYKGVNFG-NATGRQEFLKYSGPGPGQYDIIQKRKLHCENINIKREQEHNYYTYVPRLYEAIILQEEKKGVPGPGKYNIKSEFDMIKSMSALVNSPSFIFFSETE------------RFEPIKSCTPAPGTYNEIRTAFKCPKKRFGLSL-PFNQSAARFTEDSKAQKLPGPGFYDISTNIVKAQVKKPC-LKKQPKTGFGSSVPRTLFTAQKKAFRGPGPSDYQVRGTHDELPNLNK-----SAAF--LSRAEKTPPVR-KMRLPAPGRYDVQKSYDMSQVKHKYMPPRTSVAKKRHSSFLSAAPR-CLGKIADG-----PGPATYSPVLMKSGAIISFVKGPKRFQEFHGEFSPGPTTYELSPFLRHSLLKRTYNVTL 530          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. UniProt/SwissProt
Match: sp|A1A5R9|STPG2_RAT (Sperm-tail PG-rich repeat-containing protein 2 OS=Rattus norvegicus OX=10116 GN=Stpg2 PE=2 SV=1)

HSP 1 Score: 202.216 bits (513), Expect = 8.143e-56
Identity = 178/576 (30.90%), Postives = 266/576 (46.18%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRD--FNLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQY-CVEDKIKCYSADSKKKTITDRNKIIYK----REEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYN-EEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDI-DIPGPQVYNLSE---ATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEE-TPGPGQYEIKPRGTSCAERCEFNITLGAKCYLGNRDLILNKLSNYRRK 1749
            MYDRAPR     +   T   +GPG+YQ        +  YAPF SL+S+   + ++ D  + +PGPA Y+  Q   KI GG ++ N + RFK + SD PGP  Y C      C         I  R KI  K    R    PSIP++  + GY       ++++ PP  D ++GPA+Y P+      + KYKG  +     R+     S GPGPG YD    R L        R+   +    +PR  +++  +  K  +PGP  Y      +  K++    +   +    F  + +RF       P PG+YN+ RTA    KK +G+  SPFG  A RFTE     ++PGP  Y++S      + K  ++    K GFGS+  R +      A   PGPS YQ  +  +  +L   M+   A L+  +    +Q +  LP    YDV  +++ SQ + +Y  PR+  AK+RH SFLS A R   G   D      PGPA+Y+     +     F    +RF    ++ +PGP  YE+ P       +  +N+TL     L NR+   + +   R+K
Sbjct:    1 MYDRAPRWLDLANRGSTEEHVGPGTYQVPFPKQQATGCYAPFLSLSSKKDAYVVSSDPGKAVPGPAHYNVSQAQYKIKGGRTLQNREKRFKKLISDGPGPASYDCPYLGTLC---------IRIRQKICRKPAVSRSLDIPSIPSSGKSHGYHLNEDDTIMRRTPPSSDKTMGPAYYNPQFDYPKASLKYKGVNFGIATGRQELLKYS-GPGPGHYDIIQKRKLRYENINIKRDQEHYCYSYVPRLYEEIALQEEKKGVPGPGKYNIKSQFDHIKSMSTIVDASSLL---FFPETERFEPIKSSTPAPGTYNETRTAFKVPKKRSGL-FSPFGQRAARFTEDYKAHELPGPGFYDISTNIVKAQVKKPHLKKKMKTGFGSSVPRALFAVQEKAFAGPGPSDYQVVRGIH-DELPNLMNKYAAFLSREERTTPVQ-EMSLPAPGCYDVQKSYDMSQVQHNYMPPRSSVAKQRHSSFLSAAPR-CLGKISDG-----PGPATYNPILMKSGAIISFVKAPRRFEEFQDKFSPGPTTYELSPFFRHSLLKRTYNVTLPCSASL-NREHAGHAVQKTRQK 553          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q8N412|STPG2_HUMAN (Sperm-tail PG-rich repeat-containing protein 2 OS=Homo sapiens OX=9606 GN=STPG2 PE=2 SV=1)

HSP 1 Score: 175.637 bits (444), Expect = 5.090e-47
Identity = 156/535 (29.16%), Postives = 217/535 (40.56%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRD--FNLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDI-DIPGPQVYNLSEAT---REKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQP---KQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSL--PGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEI 1632
            MYDRAPR         T   +GPGSYQ        +   APF SL +R+  F +A                                     I+  +PGPG Y V +  K     S+  T+T    +        PSIP+   ++GY     G +IK  PP  D +LGPA+Y P+   +  T KYKG  +  + + R +     GPGPGQYD    +    T YY++    +  Q     FI  L    +                                     + +RF       P PG+YN+PRTAL SLKK +G+K  PFG +A RFT+ +   ++PGP  YN+   T     +       KK  FGS+  R      + A   PGP+ YQ     Q    S     +++ +A+  +R    +      +P    YDV  ++  SQ K  Y  PR+  AKR+H SFLS   R        C++     PGPA+Y+     +     F    KRF    E TPGP  YEI
Sbjct:    1 MYDRAPRLLKLAEGGSTEAHVGPGSYQVPFLKQQATGSNAPFLSLTARESTFTIASS-----------------------------------IEKAVPGPGHYNVSEAQKI----SRSPTLTRSVDV--------PSIPSCGKSYGYHINDDGSIIKCFPPACDSTLGPAYYKPQFDVSNATLKYKGIHFG-NSSGRQELPKKSGPGPGQYDIVQKK----TSYYENVNIKRDQQQNYCSFIPRLYEIIVLQE----------------------------------KKKRFLPMKSITPAPGTYNEPRTALKSLKKTSGLKNIPFGQSAVRFTQDIRTEEMPGPGFYNVLNNTIIASVRNICSKKQKKSAFGSSVPRTFFSVQKEACATPGPADYQEFWHSQGVGISDELPNLTNKYAAFLSRAKRTMKVPDMVIPAPGSYDVHKSYEMSQVKHKYMPPRSLVAKRKHASFLSATPR--------CLEKVTDGPGPAAYNPVLRKSCPIPLFVKASKRFEESKEITPGPATYEI 441          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. TrEMBL
Match: A0A2C9KKI0 (Uncharacterized protein OS=Biomphalaria glabrata OX=6526 GN=106071032 PE=4 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 3.241e-107
Identity = 221/558 (39.61%), Postives = 302/558 (54.12%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTK--SDGYAPFQSLASRD-FNLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKC-YSADSKKKTITDRNKII------YKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEY-YQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRF-TEKVDIDIPGPQVYNLSEATRE--KPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRY--AKGSPLDCVDPSLPGPASYD-HKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITL 1683
            MYDRAPR+  F+    TP  IGPGSY       +K  +DGYAPF S+ SR+ F    D     PGP  YD+  + ++  G SS+ N   RF    SD PGPG Y     ++    + S    + D  K+I      + R+   PSIP    A+GYEE   G L KQ PP +D+S+GPA+Y P + E+A T  YKG  +    ++R +F G  GPGPG YDPF+D          Q  E  KF + ++PR+ + +Q++  K  +PGP +Y        P    N EG +++HPPF  QA+RF       P PGSYNDPRTAL  LK+V+GMKRSPF  T+ RF T+      PGP  YN+     E  + +YI  T+KG FG+TS R   L  +   ++PGP+HYQ K+     K Y  + S FAS+T R   P    + D P    YDV+ A+ K   K    +PRT+ A R+H SF+++A R+  A+ +    VDP  PGPASY+  K  +N K G    +++RF   I++ PGPG YE+ P       +  FN TL
Sbjct:    1 MYDRAPRDINFKVGC-TPDVIGPGSYDAAALQKSKLRTDGYAPFLSMTSRETFLKVTDQVVAAPGPGHYDT-TVQDRAKGASSLANKSKRFADPVSDTPGPGSYSSHAYVELGRKSRSAPGVMGDDGKLIKSTRVKFHRKPEAPSIPTQGQAYGYEECEDGTLKKQDPPVKDMSIGPAYYTPALPESAATKTYKGVHFGKLSSKRMEFYGKSGPGPGDYDPFTDHTAKPENLNIQGGEVMKF-EAKLPRYHELVQKEVEKKGVPGPGAYEVKSTFIIPAPALNTEGLEVDHPPFLSQAKRFAPLKSATPAPGSYNDPRTALEVLKRVSGMKRSPFSQTSVRFETDYKKKRSPGPGTYNIPGLAAESMRKAYIESTRKGVFGTTSTRIEPLSKKEDIEVPGPAHYQIKEKPFKPK-YPHLGSNFASVTARLKSP----ELDAPPPGSYDVVDAYEKLYVKPIMAKPRTEAAYRKHHSFMASADRFAPARDTMTKRVDPDNPGPASYNTAKETINPKGGLMVTKDRRFRENIDDFPGPGTYELSPMFQDTVLKGTFNHTL 550          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. TrEMBL
Match: A0A267EB22 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031153g1 PE=4 SV=1)

HSP 1 Score: 345.125 bits (884), Expect = 5.702e-107
Identity = 226/583 (38.77%), Postives = 321/583 (55.06%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTK--SDGYAPFQSLASRDFNLAHDDAQVL-PGPAQYD--SKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVED---KIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDK-YKGCFWSYDRARRTDFSG---SKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNE---EGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTG--MKRSPFGLTATRFTEKVDIDI-PGPQVYNLSE----ATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMAN-ASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYA-KGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITLGAKCYLGNRDLILNKLSN 1737
            MYDRA R+F+FQ +  T   +GPG+Y       TK  +DGYAPF SL++RD  L  +DA V  PGP QY+  S    + ++GGSS+ N  +RF   +   PGP  Y V+    K+   S  S  +     +++ +KR +  PSIP    A+G+EE   G L+KQ  P RD SLGPAFY  ++   A ++  YKGC WS  RARR DF+    + GPGPG YD   +       +   R+    A+LR+PR+ + L+R+A ++ +PGP +Y   G  +   A+       G+  E PPFGVQ++RF S  +  PGPG+Y+DPRTAL +LK+  G  +K+SPFG TA RF +   + + PGP  Y ++     A   K  ++  ++KG FGST++R      +   D PGP+ Y+ +   N  SK  QP SSMFASLTNRD+DPV+  K + P    YDV  AF+K   ++    PR + AK+R  SF +++ R+A K +     DP +PGPASY+    ++ + G    RE RF    ++ P P  Y I P   S   R   N TLG    L  +D      +N
Sbjct:    1 MYDRARRDFSFQGNAVTDIHVGPGAYDTDKPARTKIRADGYAPFNSLSTRDNFLTPNDAIVAAPGPGQYNVLSGSGQSAVVGGSSLANRSLRFVERREVAPGPADYTVQVAAIKVAPPSDASAAQHQQRGSRVRFKRVDDAPSIPFPGQAYGFEENEHGLLVKQPAPDRDTSLGPAFY--RVSGGAGSEGGYKGCHWSKSRARRADFTSGASAAGPGPGDYDIGGETQRAHVVHMNVRDGKPPAELRVPRYNEMLERQAARNPVPGPGAYGVRGHFDEVGALSEAAVANGDSAERPPFGVQSRRFGSAKEATPGPGAYSDPRTALTALKRGAGAHLKKSPFGNTAIRFQDDSGVRLMPGPGAYTVNSGMLAADSMKKVFLGASQKGAFGSTAVRMQPFVRKTEADRPGPASYEVRDRPNFQSKYNQPRSSMFASLTNRDFDPVLAEKSEQPHPAMYDVDRAFHKLHDRQQGYGPRNEAAKKRQ-SFYTSSDRFAGKTTGGFGGDPDMPGPASYNVAAGMD-RRGAAPVREGRFLDKKDDAPAPNHYHISPAVESSVLRSTHNTTLGNPVKLLAKDTAPQTATN 579          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. TrEMBL
Match: A0A267GBN7 (Uncharacterized protein OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig031153g2 PE=4 SV=1)

HSP 1 Score: 343.969 bits (881), Expect = 1.623e-106
Identity = 226/583 (38.77%), Postives = 321/583 (55.06%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTK--SDGYAPFQSLASRDFNLAHDDAQVL-PGPAQYDSKQMSNK--ILGGSSIGNGDVRFKPIKSDIPGPGQYCVED---KIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDK-YKGCFWSYDRARRTDFSG---SKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNE---EGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTG--MKRSPFGLTATRFTEKVDIDI-PGPQVYNLSE----ATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMAN-ASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYA-KGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITLGAKCYLGNRDLILNKLSN 1737
            MYDRA R+F+FQ +  T   +GPG+Y       TK  +DGYAPF SL++RD  L  +DA V  PGP QY+    S +  ++GGSS+ N  +RF   +   PGP  Y V+    K+   S  S  +     +++ +KR +  PSIP    A+G+EE   G L+KQ  P RD SLGPAFY  ++   A ++  YKGC WS  RARR DF+    + GPGPG YD   +       +   R+    A+LR+PR+ + L+R+A ++ +PGP +Y   G  +   A+       G+  E PPFGVQ++RF S  +  PGPG+Y+DPRTAL +LK+  G  +K+SPFG TA RF +   + + PGP  Y ++     A   K  ++  ++KG FGST++R      +   D PGP+ Y+ +   N  SK  QP SSMFASLTNRD+DPV+  K + P    YDV  AF+K   ++    PR + AK+R  SF +++ R+A K +     DP +PGPASY+    ++ + G    RE RF    ++ P P  Y I P   S   R   N TLG    L  +D      +N
Sbjct:    1 MYDRARRDFSFQGNAVTDIHVGPGAYDTDKPARTKIRADGYAPFNSLSTRDNFLTPNDAIVAAPGPGQYNVLLGSGQSAVVGGSSLANRSLRFVERREVAPGPADYTVQVAAIKVAPPSDASAAQHQQRGSRVRFKRVDDAPSIPFPGQAYGFEENEHGLLVKQPAPDRDTSLGPAFY--RVSGGAGSEGGYKGCHWSKSRARRADFTSGVSAAGPGPGDYDIGGETQRAHVVHMNVRDGKPPAELRVPRYNEMLERQAARNPVPGPGAYGVRGHFDEVGALSEAAVANGDAAERPPFGVQSRRFGSAKEATPGPGAYSDPRTALTALKRGAGAHLKKSPFGNTAIRFQDDSGVRLMPGPGAYTVNSGMLAADSMKKVFLGASQKGAFGSTAVRMQPFVRKTEADRPGPASYEVRDRPNFQSKYNQPRSSMFASLTNRDFDPVLAEKSEQPHPAMYDVDRAFHKLHDRQQGYGPRNEAAKKRQ-SFYTSSDRFAGKTTGGFGGDPDMPGPASYNVAAGID-RRGAAPLREGRFLDKKDDAPAPNHYHISPAVESSVLRSTHNTTLGNPVKLLAKDTAPQTATN 579          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. TrEMBL
Match: K1PZM9 (Uncharacterized protein C4orf37-like protein OS=Crassostrea gigas OX=29159 GN=CGI_10026063 PE=4 SV=1)

HSP 1 Score: 335.109 bits (858), Expect = 2.359e-103
Identity = 214/549 (38.98%), Postives = 301/549 (54.83%), Query Frame = 1
Query:   61 MYDRAPRNF--TFQSSVGTPYEIGPGSYQH--FGTINTKSDGYAPFQSLASRD-FNLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDR---------NKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFS-GSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDI-DIPGPQVYNL----SEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGK-KHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCV----DPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEI 1632
            MYDRAPR+   TF S   TP  +GPGSY          K+DGYAPF S+ SR+ F    D     PGP  YD +   + I GG ++ N   RF     + PGPG Y  E      S+ S   ++ ++         ++I + R+   PSIP    A+GYEE   G L KQ PP +D S+GPAFY P +     T  Y+G  +S   ++R D S G  GPGPG Y+P+++            ES +F + RIPR+ + + +   +  IPGP  Y   G  +      N EG ++EHPPF  Q++RF      +P PG+YNDPR A +S+K+ TG+KRSPFG T+ RF  +  +   PGP  YNL    S++ R   +YI  T+KG FG+TS+R   +  +   ++PGP+HYQ K+    ++ YQ M++ F+S+T+R  DP    K ++P    Y+V  ++  SQ +    T+PRT +AKR+H SFLS ASR+A   P D +    DP LPGP +YD K  L  K G    ++KRF  +  E PGPG YE+
Sbjct:    1 MYDRAPRDLVKTFGS---TPGNVGPGSYDSNVLPRSKIKADGYAPFLSMTSRETFLNVSDQVVAAPGPGHYDPQNAQDGITGGKTLANKSKRFMEQIPENPGPGTYSTERYTDFRSSKSAPGSMQNKGNAAGSLLTSRIKFHRKPEAPSIPMPGQAYGYEECEDGTLKKQDPPDKDKSIGPAFYNPTVDPTKATKTYQGVHFSKYSSKRLDLSKGRLGPGPGDYEPYTNLQNRPENLNAIEESHRF-EARIPRYHEAIAKDEERKAIPGPGKYDVKGGFDPEPPKVNTEGIEVEHPPFMSQSKRFTPMKKTLPAPGTYNDPRNAFDSMKRTTGLKRSPFGQTSVRFNPEPHVKKTPGPGAYNLTGMGSDSMRR--AYIESTRKGVFGTTSVRIKPITKKEEVEVPGPAHYQIKEKPFQNR-YQNMTAQFSSVTSRLKDPPTVVK-EMPPPGSYEVAMSYQNSQLQGTERTKPRTDEAKRKHGSFLSAASRFA--PPRDVINHNNDPDLPGPGAYDSKEGLARKGGLMVTKDKRFKDLKSEGPGPGSYEL 539          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. TrEMBL
Match: A0A433TUZ6 (Uncharacterized protein OS=Elysia chlorotica OX=188477 GN=EGW08_006843 PE=4 SV=1)

HSP 1 Score: 334.724 bits (857), Expect = 4.362e-103
Identity = 222/560 (39.64%), Postives = 310/560 (55.36%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTIN---TKSDGYAPFQSLASRD-FNLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCV----EDKIKCYSA---DSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLD-MTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASY-MHSG-LIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDIDI-PGPQVYNL--SEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDP--SLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITL 1683
            MYDRAPR+ +F+    TP+ IGPGSY    TIN    ++DGYAPF S++SR+ F    D     PGP  YD  Q+ + + GG S+ N   RF    +  PGPG Y      E   K  SA    S  K     ++I + R+   PSIP+   A+GYEE   G L KQ PP RD SLGPA+Y P + ++  T  Y+G  +    AR   + G  GPGP  YDP+S+  L       Q  E+ ++ + R+PR+ + + ++  K  +PGP +Y M S  ++E P    N EG ++EHPPF  QA+RF       P PG+YNDPRTAL++LKKV+G+KRSPF  TA RF  +  I + PGP  YN+    A   + +Y+  T+KG FG+TS R   +  ++  D+PGP+HYQ K+    S+ +Q + S FAS+T R  D    G    P    Y+V+ +F +S  K    +PRT+ A+R+H SF+S ASR+A+   +    P    PGP +YD      +K G    R+KRF   +E+ PGPG YE+ P       +  FN TL
Sbjct:    1 MYDRAPRDLSFKIG-STPHAIGPGSYDA-DTINKSRIRADGYAPFLSMSSRETFLNVSDQVVAAPGPGHYDLNQLQDGVRGGGSLANKSKRFTDPSTFTPGPGSYQAHKYHELNRKAKSAPGKGSNDKGSLMTSRIKFHRKPEAPSIPSQGQAYGYEECTDGTLKKQDPPARDSSLGPAYYNPALPDSKPTKTYRGPNFGKQAARNIVY-GKSGPGPSDYDPYSENILRPENANVQGEETLRY-EARLPRYYELIPKEEEKRAVPGPGTYEMRSTFMVEAP--TLNTEGIEVEHPPFLSQAKRFAPIKSVAPAPGTYNDPRTALDALKKVSGLKRSPFSQTAVRFNPEHHIKLTPGPGAYNVPGMGADSMRKAYLEATRKGVFGTTSSRSPAIQRKDELDVPGPAHYQVKEKPFVSRYHQ-LGSNFASVTTRMKDTGTDG----PPPGAYNVVQSFERS-AKPCMAKPRTEAARRKHNSFMSAASRFAQPGDMASKRPENENPGPGAYDSHGRQPSKGGLMITRDKRFRQDVEDFPGPGTYELSPLIQDTVLKGTFNHTL 548          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Cavefish
Match: stpg2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6509282:6515434:1 gene:ENSAMXG00000035146.1 transcript:ENSAMXT00000029911.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:stpg2)

HSP 1 Score: 186.808 bits (473), Expect = 6.112e-52
Identity = 140/395 (35.44%), Postives = 187/395 (47.34%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFNLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFT-EKVDIDIPGPQVYNLSEATREKPS----YISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHY 1230
            MY RAPR     S   T   +GPGSY       T+ + YAPF SL++R  ++        PGP QY+   +     GG S+ N   RF+  +SD PGP  Y +          +    ++    + Y      PSIP+   AFG+EE   G L +  PP  D SLGPA+Y P   +  +  KYKG  +S+   +R +    +GPGPGQ     D  +        R+    A+L++PR+   L  +  K  +PGP  Y   G           + EK   P     A RF       P  GSYNDPR+AL SLKK +G+KRSPF LTA RFT +      PGP  YN+ E      S     +  T+KG FGS + R + L N+  N  PGPSHY
Sbjct:    1 MYSRAPRVTQLSSGGSTSSAVGPGSYPIHANTPTR-ECYAPFLSLSNR-LSVFDAVGGASPGPGQYNIGGIRVSGAGGVSLQNRSKRFEETQSDGPGPAAYNIPHTPAHTHTPADMAAVSFSCLLSYSDA---PSIPSPGQAFGFEENEHGALCRNKPPDIDHSLGPAYYSPA--KVCVKQKYKGVPFSWMTEKRAELKLVEGPGPGQ-----DHRVQYENVNLRRDVRSRAELQVPRYHQLLPLQEEKKGVPGPGQYDVKG-----------QFEKHTDP---AGATRFSPVKQVAPPVGSYNDPRSALESLKKNSGLKRSPFNLTAARFTLDHRTHSTPGPGAYNVFELGLAHESLRRVLVENTRKGVFGSCAERALQLNNKEGNS-PGPSHY 368          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Cavefish
Match: stpg2 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000029.1:6509282:6515434:1 gene:ENSAMXG00000035146.1 transcript:ENSAMXT00000038732.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:stpg2)

HSP 1 Score: 185.652 bits (470), Expect = 4.787e-51
Identity = 148/421 (35.15%), Postives = 200/421 (47.51%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFNLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFT-EKVDIDIPGPQVYNLSEATREKPS----YISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLY-QPMSSMFASLTNR 1305
            MY RAPR     S   T   +GPGSY       T+ + YAPF SL++R  ++        PGP QY+   +     GG S+ N   RF+  +SD PGP  Y     I    A +    ++  +          PSIP+   AFG+EE   G L +  PP  D SLGPA+Y P   +  +  KYKG  +S+   +R +    +GPGPGQ     D  +        R+    A+L++PR+   L  +  K  +PGP  Y   G           + EK   P     A RF       P  GSYNDPR+AL SLKK +G+KRSPF LTA RFT +      PGP  YN+ E      S     +  T+KG FGS + R + L N+  N  PGPSHY    + +  +LY Q  +++F S T R
Sbjct:    1 MYSRAPRVTQLSSGGSTSSAVGPGSYPIHANTPTR-ECYAPFLSLSNR-LSVFDAVGGASPGPGQYNIGGIRVSGAGGVSLQNRSKRFEETQSDGPGPAAY----NIPHTPAHTHTPLLSYSDA---------PSIPSPGQAFGFEENEHGALCRNKPPDIDHSLGPAYYSP--AKVCVKQKYKGVPFSWMTEKRAELKLVEGPGPGQ-----DHRVQYENVNLRRDVRSRAELQVPRYHQLLPLQEEKKGVPGPGQYDVKG-----------QFEKHTDP---AGATRFSPVKQVAPPVGSYNDPRSALESLKKNSGLKRSPFNLTAARFTLDHRTHSTPGPGAYNVFELGLAHESLRRVLVENTRKGVFGSCAERALQLNNKEGNS-PGPSHY---TVRDTKELYKQQPTAVFRSTTER 381          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Nematostella
Match: EDO38402 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SCZ2])

HSP 1 Score: 280.026 bits (715), Expect = 3.981e-86
Identity = 196/566 (34.63%), Postives = 293/566 (51.77%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFNLAHDDAQVL-PGPAQYDSKQMSNKILGGSSIGNGDVRF--KPIKSDIPGPGQYCVEDK----------IKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKY-KGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFA-QLRIPRFIDDLQRKAIKDHIPGPASY-MHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDID--IPGPQVYNLSEATRE--KPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDP--VIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAK-RRHCSFLSNASRYA--KGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITL 1683
            MYDRAPR  T Q    T   +GPG+Y        K DGYAPF S+  R+  L   D+ V  PGP QYD + + + I GG ++ N   RF  KP+K+  PGPG Y ++ K                D     +   +++ +KR+  PPSIP+   A+GYEE   G L  Q  P +D S+GPA+Y  K  ++ +T KY KG  +S   ++R  F G+ GPGPG Y+P+ D  + +       ES K   +  +PR+   + ++  K  +PGP  Y + S     P+    ++   + + PFG Q++RF     + P PG+YN+P+ AL  LK+ TG+KRSPFG T+ RF  K       PGP  YN+++ T E  + +++  T+KG FGSTS R   +  R+ + +PGP+HY      N  ++   +SS F S T R + P  V+    D+P    YDV  +++ +QG+  Y   ++K+   +R  +F S ASR++  +  P++  D   PGP  YD         G    R+ RF  +  + PGPG YE+ P       +  FN TL
Sbjct:    1 MYDRAPRTLT-QPLSSTADAVGPGTYDPPEPGRRKYDGYAPFSSMTGRETFLDIQDSVVAAPGPGQYDPQLVQHHISGGHTLANRSSRFTSKPVKT--PGPGAYNLQKKGDWLKDGGGRRGEGVGDMGDVALFKTSRVTFKRKPDPPSIPSPGKAYGYEESTDGSLRPQEMPHKDSSMGPAYYQVKHDDDPVTRKYGKGTNFSNRTSKRLQFKGNAGPGPGDYNPYQDPGIKVPMDIIVEESRKQPFESALPRYHQVIVQEEEKKAVPGPGKYEIKSQFEVVPRPTLQDD--PVINAPFGTQSKRFFDDRQNNPAPGAYNNPKNALEVLKRTTGLKRSPFGQTSVRFEGKPHHSKKTPGPGAYNITDMTSELLRKAHLESTRKGAFGSTSHRIAPMTRRHEDHLPGPAHYLTTAEKNKKEIQ--LSSTFQSTTGRLHTPPGVV---MDVPPPGSYDVSKSYDSTQGRVMYPYAQSKNRNTKRTGAFNSTASRFSDKRRVPMEETD---PGPGHYD-AVSSGKPGGLMVTRDTRFKPLKSDVPGPGAYELNPIQAHTVLKGTFNTTL 552          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Planmine SMEST
Match: SMESG000034428.1 (SMESG000034428.1)

HSP 1 Score: 1092.41 bits (2824), Expect = 0.000e+0
Identity = 535/567 (94.36%), Postives = 538/567 (94.89%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFNLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDIDIPGPQVYNLSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITLGAKCYLGNRDLILNKLSNYRRKLRIQ 1761
            MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFNLAHDDAQVLPGPAQYDSK MSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHP    + +   +     PGP               VTGMKRSPFGLTATRFTEKVDIDIPGPQVYNLSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITLGAKCYLGNRDLILNKLSNYRRKLRIQ
Sbjct:    1 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFNLAHDDAQVLPGPAQYDSKLMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPRSVFRLKDSAANLMTFPGPA--------------VTGMKRSPFGLTATRFTEKVDIDIPGPQVYNLSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITLGAKCYLGNRDLILNKLSNYRRKLRIQ 553          
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Planmine SMEST
Match: SMESG000034428.1 (SMESG000034428.1)

HSP 1 Score: 1010.36 bits (2611), Expect = 0.000e+0
Identity = 496/543 (91.34%), Postives = 502/543 (92.45%), Query Frame = 1
Query:   61 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFNLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGPGSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDIDIPGPQVYNLSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITLGA 1689
            MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFNLAHDDAQVLPGPAQYDSK MSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHP    + +   +     PGP               VTGMKRSPFGLTATRFTEKVDIDIPGPQVYNLSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYE+  +      +  FN TLG 
Sbjct:    1 MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDFNLAHDDAQVLPGPAQYDSKLMSNKILGGSSIGNGDVRFKPIKSDIPGPGQYCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQGKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSGSKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKDHIPGPASYMHSGLIECPKAVYNEEGEKIEHPRSVFRLKDSAANLMTFPGPA--------------VTGMKRSPFGLTATRFTEKVDIDIPGPQVYNLSEATREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASKLYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTEPRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTGKFYYREKRFNAVIEETPGPGQYELPEKIADTVVKPTFNSTLGV 529          

HSP 2 Score: 87.8113 bits (216), Expect = 6.428e-18
Identity = 43/45 (95.56%), Postives = 44/45 (97.78%), Query Frame = 3
Query: 1731 IQLPEKIADTVVKPTFNSTLGVIKEATTSIVSVNPPTREHPIAIL 1865
             +LPEKIADTVVKPTFNSTLGVIKEATTSIVSVNPPTREHPIAIL
Sbjct:  508 YELPEKIADTVVKPTFNSTLGVIKEATTSIVSVNPPTREHPIAIL 552          
The following BLAST results are available for this feature:
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
STPG21.060e-4729.16sperm tail PG-rich repeat containing 2 [Source:HGN... [more]
STPG27.889e-1030.23sperm tail PG-rich repeat containing 2 [Source:HGN... [more]
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
stpg21.827e-6732.32pep chromosome:GRCz11:5:6954162:7005117:1 gene:ENS... [more]
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lhfpl29.252e-5333.81LHFPL tetraspan subfamily member 2 [Source:Xenbase... [more]
lhfpl28.349e-3730.40LHFPL tetraspan subfamily member 2 [Source:Xenbase... [more]
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Stpg24.030e-5931.87sperm tail PG rich repeat containing 2 [Source:MGI... [more]
Stpg24.030e-5931.87sperm tail PG rich repeat containing 2 [Source:MGI... [more]
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|Q08BC4|STPG2_DANRE1.946e-8335.17Sperm-tail PG-rich repeat-containing protein 2 OS=... [more]
sp|Q8C8J0|STPG2_MOUSE2.819e-5831.87Sperm-tail PG-rich repeat-containing protein 2 OS=... [more]
sp|A1A5R9|STPG2_RAT8.143e-5630.90Sperm-tail PG-rich repeat-containing protein 2 OS=... [more]
sp|Q8N412|STPG2_HUMAN5.090e-4729.16Sperm-tail PG-rich repeat-containing protein 2 OS=... [more]
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2C9KKI03.241e-10739.61Uncharacterized protein OS=Biomphalaria glabrata O... [more]
A0A267EB225.702e-10738.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GBN71.623e-10638.77Uncharacterized protein OS=Macrostomum lignano OX=... [more]
K1PZM92.359e-10338.98Uncharacterized protein C4orf37-like protein OS=Cr... [more]
A0A433TUZ64.362e-10339.64Uncharacterized protein OS=Elysia chlorotica OX=18... [more]
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
stpg26.112e-5235.44pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
stpg24.787e-5135.15pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO384023.981e-8634.63Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of sperm-tail PG-rich repeat-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000034428.10.000e+094.36SMESG000034428.1[more]
SMESG000034428.16.428e-1891.34SMESG000034428.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023691 ID=SMED30023691|Name=sperm-tail PG-rich repeat-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1937bp
TAGAAATATCGAACATTTTGAAATTCTAAATTGTGTAATAATTGCTTGAG
TTTAAATTTAATGTACGATCGAGCTCCGCGAAACTTTACTTTTCAATCAT
CTGTTGGAACACCTTACGAGATCGGACCAGGATCTTACCAACACTTCGGC
ACTATCAATACTAAGAGTGATGGATATGCTCCATTTCAATCTTTAGCATC
TAGAGATTTTAATCTTGCGCACGATGATGCACAAGTTCTTCCAGGACCAG
CACAATATGATTCGAAACAAATGTCAAACAAGATATTGGGCGGATCCTCA
ATAGGCAATGGTGACGTGCGATTTAAGCCAATCAAATCTGATATTCCAGG
CCCGGGGCAATATTGCGTCGAAGATAAAATTAAGTGCTATTCCGCTGACT
CTAAGAAAAAAACCATAACGGATAGAAATAAAATCATTTACAAAAGAGAA
GAGATGCCACCTAGCATACCAAACGCACAAACTGCTTTTGGGTACGAAGA
GGGGCCACAGGGAAAGTTAATCAAACAAGGGCCTCCACAGCGAGATATTA
GTCTTGGCCCGGCGTTTTACGTCCCGAAAATCAAGGAAAACGCGATCACA
GATAAATACAAAGGATGCTTCTGGAGTTATGACCGAGCTCGGCGTACGGA
TTTCAGCGGCTCAAAAGGTCCCGGGCCAGGGCAATACGATCCGTTTTCAG
ACCGCTGGTTAGACATGACTGAGTATTACCAGAGCAGGGAAAGCGGGAAA
TTCGCCCAACTGCGCATCCCGAGATTCATAGATGACCTGCAGAGGAAGGC
TATTAAAGATCACATTCCCGGTCCGGCATCCTACATGCATTCGGGACTCA
TCGAGTGTCCCAAGGCCGTTTACAATGAGGAAGGAGAGAAGATTGAACAC
CCTCCGTTCGGTGTTCAGGCTCAAAGATTCCGCAGCCAATTTGATGACAT
TCCCGGGCCCGGCAGTTATAATGATCCACGGACGGCTCTCAACTCATTGA
AAAAGGTAACGGGGATGAAGCGCAGCCCGTTTGGACTGACTGCAACACGA
TTTACAGAGAAGGTCGACATTGATATTCCAGGCCCACAAGTTTACAACCT
TTCGGAAGCAACCAGGGAAAAGCCCAGTTACATATCAATGACAAAGAAAG
GCGGTTTCGGCTCCACCAGTATAAGAGACGTAGATCTGGGCAATAGAAAT
GCAAATGATATTCCTGGGCCTTCTCATTACCAGCCGAAACAAATGGCTAA
TGCATCCAAACTCTATCAGCCCATGTCCTCAATGTTTGCATCTCTGACCA
ATCGGGACTATGATCCAGTCATTCAAGGCAAATTCGATTTGCCCGACGCA
ACGCAATACGATGTAATTAGCGCATTCAACAAGTCTCAAGGCAAGAAACA
TTACACAGAACCGAGAACCAAAGACGCCAAAAGAAGACATTGCAGTTTCC
TTTCTAATGCCAGTCGATATGCGAAAGGCTCTCCTTTGGATTGCGTTGAT
CCAAGCTTGCCAGGACCTGCAAGTTATGACCACAAAACCTATTTGAATAC
GAAAACTGGCAAATTCTATTACCGAGAAAAGCGATTCAATGCTGTCATTG
AGGAAACTCCAGGCCCAGGACAATATGAGATCAAGCCCAGGGGAACAAGT
TGTGCCGAAAGATGTGAATTCAACATCACTCTCGGAGCAAAGTGCTATTT
GGGCAATAGAGATCTCATTTTAAACAAATTATCCAACTACCGGAGAAAAT
TGCGGATACAGTAGTTAAGCCAACTTTCAACAGTACGCTTGGTGTCATTA
AGGAAGCGACGACTTCGATAGTGAGTGTAAATCCTCCGACTAGGGAACAT
CCCATTGCAATTCTGTGATTGTGATATTTTTTTAAGAGCTAAACTCCACT
TTTGTTTTAATGAATAAATTAGCTGTAGATTAAAAAA
back to top

protein sequence of SMED30023691-orf-1

>SMED30023691-orf-1 ID=SMED30023691-orf-1|Name=SMED30023691-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=568bp
MYDRAPRNFTFQSSVGTPYEIGPGSYQHFGTINTKSDGYAPFQSLASRDF
NLAHDDAQVLPGPAQYDSKQMSNKILGGSSIGNGDVRFKPIKSDIPGPGQ
YCVEDKIKCYSADSKKKTITDRNKIIYKREEMPPSIPNAQTAFGYEEGPQ
GKLIKQGPPQRDISLGPAFYVPKIKENAITDKYKGCFWSYDRARRTDFSG
SKGPGPGQYDPFSDRWLDMTEYYQSRESGKFAQLRIPRFIDDLQRKAIKD
HIPGPASYMHSGLIECPKAVYNEEGEKIEHPPFGVQAQRFRSQFDDIPGP
GSYNDPRTALNSLKKVTGMKRSPFGLTATRFTEKVDIDIPGPQVYNLSEA
TREKPSYISMTKKGGFGSTSIRDVDLGNRNANDIPGPSHYQPKQMANASK
LYQPMSSMFASLTNRDYDPVIQGKFDLPDATQYDVISAFNKSQGKKHYTE
PRTKDAKRRHCSFLSNASRYAKGSPLDCVDPSLPGPASYDHKTYLNTKTG
KFYYREKRFNAVIEETPGPGQYEIKPRGTSCAERCEFNITLGAKCYLGNR
DLILNKLSNYRRKLRIQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000054dorsal region of the epidermis
PLANA:0000096ventral epidermis
PLANA:0000099neuron
PLANA:0000106ciliated epithelial cell
PLANA:0000208testis
PLANA:0000418head
PLANA:0002032epidermal cell
PLANA:0002089reproductive organ
Vocabulary: INTERPRO
TermDefinition
IPR010736SHIPPO-rpt
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
Vocabulary: biological process
TermDefinition
GO:0008150biological_process