Disco-interacting protein 2 homolog C

Overview
NameDisco-interacting protein 2 homolog C
Smed IDSMED30023662
Length (bp)5245
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Disco-interacting protein 2 homolog C (SMED30023662) t-SNE clustered cells

Violin plots show distribution of expression levels for Disco-interacting protein 2 homolog C (SMED30023662) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Disco-interacting protein 2 homolog C (SMED30023662) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Disco-interacting protein 2 homolog C (SMED30023662) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023662

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023662h1SMcG0004762 Contig3860GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023662h1SMcG0020833 Contig3860GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
nervous systemSMED30023662h1SMcG0020833 dd_Smed_v4_854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023662h1SMcG0020833 dd_Smed_v4_854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023662h1SMcG0020833 dd_Smed_v4_854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023662h1SMcG0020833 dd_Smed_v4_854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023662h1SMcG0020833 dd_Smed_v4_854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023662h1SMcG0020833 dd_Smed_v4_854_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023662h1SMcG0020833 dd_Smed_v4_854_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Human
Match: DIP2C (disco interacting protein 2 homolog C [Source:HGNC Symbol;Acc:HGNC:29150])

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 723/1446 (50.00%), Postives = 964/1446 (66.67%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +A    Q+  +N  H  PPDVT++T      ++S+  E    S G          + P + G+   ++TG        +G+ VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PKP+G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   INLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSMH L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GP   GGL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  +IE          +S++L  RA  TP+  L+  LN R    +S T  QL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP       +  N  +TL                 V   +E +R   +AC  +  L C  +     A  V +     ++DTDDLPKKR       +P + D +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE+ P LWL A S  +VRDTFCSYS +EL TK L +   +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        + +L+ G+   ++ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HKS + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  192 LADVMAQTHIEN--HSAPPDVTTYT-----SEHSIQVERPQGSTGSR--------TAP-KYGNAELMETG--------DGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKPEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYSILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMAAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRTALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMHGLTYGVIRVDSEEKLSVLTVQDVGLVMPGAIMCSVKPDGVPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEYP--FIRTGLLGFVGP---GGLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QIEDNDQARKFLFLSEVLQWRAQTTPDHILYTLLNCRGAIANSLTCVQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPP-------HPQNIATTLP---------------TVKMIVEVSR---SACLMTTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKKR--PAQICKPCNPDTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLKARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFNSRLSFGDTQTIWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKS-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1556          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Human
Match: DIP2C (disco interacting protein 2 homolog C [Source:HGNC Symbol;Acc:HGNC:29150])

HSP 1 Score: 1352.81 bits (3500), Expect = 0.000e+0
Identity = 722/1446 (49.93%), Postives = 963/1446 (66.60%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +A    Q+  +N  H  PPDVT++T      ++S+  E    S G         +    + G+   ++TG        +G+ VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PKP+G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   INLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSMH L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GP   GGL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  +IE          +S++L  RA  TP+  L+  LN R    +S T  QL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP       +  N  +TL                 V   +E +R   +AC  +  L C  +     A  V +     ++DTDDLPKKR       +P + D +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE+ P LWL A S  +VRDTFCSYS +EL TK L +   +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        + +L+ G+   ++ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HKS + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  173 LADVMAQTHIEN--HSAPPDVTTYT-----SEHSIQVERPQGSTG---------SRTAPKYGNAELMETG--------DGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKPEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYSILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMAAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRTALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMHGLTYGVIRVDSEEKLSVLTVQDVGLVMPGAIMCSVKPDGVPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEYP--FIRTGLLGFVGP---GGLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QIEDNDQARKFLFLSEVLQWRAQTTPDHILYTLLNCRGAIANSLTCVQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPP-------HPQNIATTLP---------------TVKMIVEVSR---SACLMTTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKKR--PAQICKPCNPDTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLKARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFNSRLSFGDTQTIWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKS-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1537          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Human
Match: DIP2C (disco interacting protein 2 homolog C [Source:HGNC Symbol;Acc:HGNC:29150])

HSP 1 Score: 1345.1 bits (3480), Expect = 0.000e+0
Identity = 723/1456 (49.66%), Postives = 964/1456 (66.21%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICL----------QGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +A    Q+  +N  H  PPDVT++T      ++S+  E    S G          + P + G+   ++TG        +G+ VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PKP+G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   INLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSMH L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GP   GGL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  +IE          +S++L  RA  TP+  L+  LN R    +S T  QL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP       +  N  +TL                 V   +E +R   +AC  +  L C  +     A  V +     ++DTDDLPKKR       +P + D +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE+ P LWL A S  +VRDTFCSYS +EL TK L +   +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICL          QG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        + +L+ G+   ++ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HKS + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  248 LADVMAQTHIEN--HSAPPDVTTYT-----SEHSIQVERPQGSTGSR--------TAP-KYGNAELMETG--------DGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKPEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYSILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMAAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRTALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMHGLTYGVIRVDSEEKLSVLTVQDVGLVMPGAIMCSVKPDGVPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEYP--FIRTGLLGFVGP---GGLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QIEDNDQARKFLFLSEVLQWRAQTTPDHILYTLLNCRGAIANSLTCVQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPP-------HPQNIATTLP---------------TVKMIVEVSR---SACLMTTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKKR--PAQICKPCNPDTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLKARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQPHRLWTLAEQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFNSRLSFGDTQTIWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKS-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1622          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Human
Match: DIP2B (disco interacting protein 2 homolog B [Source:HGNC Symbol;Acc:HGNC:29284])

HSP 1 Score: 1326.23 bits (3431), Expect = 0.000e+0
Identity = 695/1369 (50.77%), Postives = 931/1369 (68.01%), Query Frame = 3
Query: 1083 VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIES-------KTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIK----AQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAK-KQLSMKLATGE-IDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            VSSRVS KIQQL+ TLKRPKR PL E+F +D    V     DPN PKP+G  + P  GE L ++   P +LESALQ +     K S ++ +D  G+    +LTY KL  R+ ++AY LLNKLG + E  LKP DRVALV+ NNDP+ F+ AFYGC++A V+P+ IEVPL R+DA  Q +GFLL S  I + LTSE+C K LP+T NGEI  F GWP+++W+  D    SKP +DWQP    +  E  YIEY   +K+GSV GVTVSR A L HC+ L+  C Y+EGET+V V + K++ GLWH +   +   +H + +PY+V+K  P  W++++  HKA  A+VK RD+HWA++A ++   ++LS LR+L+V+DG+NPWS+++CD F+S F+  GL+  A+CPCA S+E MT+++RRP    GV                G   PG R +LSM+ LSYG++RV++E+  ++LT+QD G ++PGG   ++KP+G P LC TDE+GE+C+ +   G  Y+GL G T   F+V P++S G+ V  + P ++RSGLLGF+GP   G L+F+ G + GL+ VSGRRHNADDI+AT LAVE +K V+RGRIAVFS+ +  DERIV+VAE R   SEE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+  TK+ FLEG L  CN+L+CPH  +TNLPKPR    G VGP+++MVG+LV G R+A A GRD+  +IE        + +++IL  RA  TP+  LF  LN +   V + +  QL +RAERIA  L +K  + A   + LLY PGIEL+ A Y C+  GCIPVT++PP           QN T                    +TL   R I++    + +LT   ++++++    A  V +     +IDTDDLP+KRL     Y+P + + +AY+DFS S  G+  GV+ +HSA+  +C+A KLQCE Y SR++ + LDPY GLGF LWCL  VY GH S  +PP  LE+   LWL+  +  ++RDTFCSYS +EL TK L N +  LK RGI+L+C+R+ V+VAEERPRV    +F KLF  +GL+ RAVST+FG RVN+AICLQG S PD + VYVD  SLR+DRV+L+E+G+P SL L ESGK+LPGV++ I +PET G   DSHLGEIWV+SP  +S      D+   +    + +L+ G+    ++ARTGYLGFVRRTELT + GERHDA++VVGAL+ T+ LRG+RYHPIDIE++V R H+S IAEC VFTW+NLLVVVVEL G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  269 VSSRVSTKIQQLLNTLKRPKRPPLKEFFVDDSEEIVEVPQPDPNQPKPEGRQMTPVKGEPLGVICNWPPALESALQRWGTTQAKCSCLTALDMTGK-PVYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPGDRVALVYPNNDPVMFMVAFYGCLLAEVIPVPIEVPLTRKDAGGQQIGFLLGSCGIALALTSEVCLKGLPKTQNGEIVQFKGWPRLKWVVTDSKYLSKPPKDWQPHISPAGTEPAYIEYK-TSKEGSVMGVTVSRLAMLSHCQALSQACNYSEGETIVNVLDFKKDAGLWHGMFANVMNKMHTISVPYSVMKTCPLSWVQRVHAHKAKVALVKCRDLHWAMMAHRDQRDVSLSSLRMLIVTDGANPWSVSSCDAFLSLFQSHGLKPEAICPCATSAEAMTVAIRRP----GV---------------PGAPLPG-RAILSMNGLSYGVIRVNTEDKNSALTVQDVGHVMPGGMMCIVKPDGPPQLCKTDEIGEICVSSRTGGMMYFGLAGVTKNTFEVIPVNSAGSPVG-DVP-FIRSGLLGFVGP---GSLVFVVGKMDGLLMVSGRRHNADDIVATGLAVESIKTVYRGRIAVFSVSVFYDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHISQTKQLFLEGSLHPCNILMCPHTCVTNLPKPRQKQPG-VGPASVMVGNLVAGKRIAQAAGRDLG-QIEENDLVRKHQFLAEILQWRAQATPDHVLFMLLNAKGTTVCTASCLQLHKRAERIASVLGDKGHLNAGDNVVLLYPPGIELIAAFYGCLYAGCIPVTVRPPHA---------QNLT--------------------ATLPTVRMIVDVSKAACILTSQTLMRLLRSREAAAAVDVKTWPTIIDTDDLPRKRL--PQLYKPPTPEMLAYLDFSVSTTGMLTGVKMSHSAVNALCRAIKLQCELYSSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLIPPMELENNLFLWLSTVNQYKIRDTFCSYSVMELCTKGLGNQVEVLKTRGINLSCVRTCVVVAEERPRVALQQSFSKLFKDIGLSPRAVSTTFGSRVNVAICLQGTSGPDPTTVYVDLKSLRHDRVRLVERGAPQSLLLSESGKILPGVKVVIVNPETKGPVGDSHLGEIWVNSPHTASGYYTIYDSETLQADHFNTRLSFGDAAQTLWARTGYLGFVRRTELTAATGERHDALYVVGALDETLELRGLRYHPIDIETSVSRIHRS-IAECAVFTWTNLLVVVVELCGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDPGVIPINSRGEKQRMHLRDSFLADQLDPIYVAYNM 1576          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Human
Match: DIP2A (disco interacting protein 2 homolog A [Source:HGNC Symbol;Acc:HGNC:17217])

HSP 1 Score: 1308.51 bits (3385), Expect = 0.000e+0
Identity = 683/1395 (48.96%), Postives = 931/1395 (66.74%), Query Frame = 3
Query: 1017 QTGSVNSLQTG--GTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQED-ENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPR--SLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGN-IVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            Q  SV S+  G  G+     +   V+SRVS KIQQL+ TLKRPKR PL E+F +D E L      EDPN PKP+G+      GE L   +G+PR  SL + LQ +     K   ++ +D+ G+    +LTY KL  R+ ++AY LLNKL  + E  LKP DRVALVF N+DP+ F+ AFYGC++A +VP+ IEVPL R+DA  Q +GFLL S  + + LT++ C K LP+   GE+ +F GWP + W+ ID    +KP +DW P  + +     YIEY   +K+GS  GVTVS  + L  CR L   C Y+E ETL  V + KR+ GLWH VLT++   +HVV +PYA++K +P  W++++  +KA AA+VKSRDMHW+LLA++    ++LS LR+L+V+DG+NPWS+++CD F++ F+ +GLR   +CPCA S E +T+++RRP    G                     P  + VLSM+ LSYG++RVD+E  L+ LT+QD GQ++PG    V+K  G+PYLC TDEVGE+C+ +S TG+ Y+GL G T   F+  P+ + G  I D     + R+GLLGF+GP     L+FI G + GLM    RRHNADD++AT LAVEPMK V+RGRIAVFS+ +L D+RIV+VAE R   SEE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPK PLGGIH+ +TK+RFLEG L  CNVL+CPH  +TNLPKPR     +VGP++M+VG+LV G R+A A GR+++   +S        ++ +L  RA  TP+  LF  LN +    S+ T  QL +RAER+A  L+EK ++     +AL+Y PG++L+ A Y C+ CGC+PVT++PP  P  +  T                            L   + I+     + VLT  AV ++++++     V +     ++DTDD+PKK++ S   +RP S D +AY+DFS S  G+  GV+ +H+A   +C++ KLQCE YPSR++ + LDPY GLGF LWCL  VY GH S  VPP  LES   LWL+A S  + R TFCSYS +E+ TK L      L+ +G++L+C+R+ ++VAEERPR+  T +F KLF  LGL +RAVST+FGCRVN+AICLQG + PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGV++ IAH ET G   DSHLGEIWVSSP N++    V  +        S +L+ G+   ++ARTGYLGF+RRTELT + G RHDA++VVG+L+ T+ LRGMRYHPIDIE++V+R H+S IAEC VFTW+NLLVVVVEL+G + +A+DLV LVT+ VLEEHYL+VGVVV+VD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  241 QVASVRSVPRGCSGSMLETADGVPVNSRVSSKIQQLLNTLKRPKRPPLKEFFVDDFEEL-----LEDPNQPKPEGSETSVLRGEPLT--AGVPRPPSLLATLQRWGTTQPKSPCLTALDTTGKAV-YTLTYGKLWSRSLKLAYTLLNKLTSKNEPLLKPGDRVALVFPNSDPVMFMVAFYGCLLAELVPVPIEVPLTRKDAGSQQVGFLLGSCGVFLALTTDACQKGLPKAQTGEVAAFKGWPPLSWLVIDGKHLAKPPKDWHPLAQDTGTGTAYIEYK-TSKEGSTVGVTVSHASLLAQCRALTQACGYSEAETLTNVLDFKRDAGLWHGVLTSVMNRMHVVSVPYALMKANPLSWIQKVCFYKARAALVKSRDMHWSLLAQRGQRDVSLSSLRMLIVADGANPWSISSCDAFLNVFQSRGLRPEVICPCASSPEALTVAIRRPPDLGG--------------------PPPRKAVLSMNGLSYGVIRVDTEEKLSVLTVQDVGQVMPGANVCVVKLEGTPYLCKTDEVGEICVSSSATGTAYYGLLGITKNVFEAVPVTTGGAPIFDRP---FTRTGLLGFIGP---DNLVFIVGKLDGLMVTGVRRHNADDVVATALAVEPMKFVYRGRIAVFSVTVLHDDRIVLVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKAPLGGIHISETKQRFLEGTLHPCNVLMCPHTCVTNLPKPRQK-QPEVGPASMIVGNLVAGKRIAQASGRELAHLEDSDQARKFLFLADVLQWRAHTTPDHPLFLLLNAKGTVTSTATCVQLHKRAERVAAALMEKGRLSVGDHVALVYPPGVDLIAAFYGCLYCGCVPVTVRPPH-PQNLGTT----------------------------LPTVKMIVEVSKSACVLTTQAVTRLLRSKEAAAAVDIRTWPTILDTDDIPKKKIAS--VFRPPSPDVLAYLDFSVSTTGILAGVKMSHAATSALCRSIKLQCELYPSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLVPPLELESNVSLWLSAVSQYKARVTFCSYSVMEMCTKGLGAQTGVLRMKGVNLSCVRTCMVVAEERPRIALTQSFSKLFKDLGLPARAVSTTFGCRVNVAICLQGTAGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVKVIIAHTETKGPLGDSHLGEIWVSSPHNATGYYTVYGEEALHADHFSARLSFGDTQTIWARTGYLGFLRRTELTDASGGRHDALYVVGSLDETLELRGMRYHPIDIETSVIRAHRS-IAECAVFTWTNLLVVVVELDGLEQDALDLVALVTNVVLEEHYLVVGVVVIVDPGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1567          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Celegans
Match: dip-2 (Disco-Interacting Protein 2 homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AE78])

HSP 1 Score: 1181.78 bits (3056), Expect = 0.000e+0
Identity = 629/1405 (44.77%), Postives = 884/1405 (62.92%), Query Frame = 3
Query: 1080 LVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESL--NMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNK---LGHRGEHSL--KPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTN------------------GEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQK--GLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQN----MIDTDDLPKK---------RLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDL------IVPNDNGEAKKQL-SMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            L  ++VS KIQ +V  L+RP+ +PL +Y+ +D+  L  +    DP+AP+P+GT++ P  GE+   N  + +PRSL+SA   +     K      +D + + +   LTY KL  RA ++AY+LL K   +   G  ++  KP DRVAL++ N  P++F+ AFYGC+ A V+P+ +E+P  +R+A    +GFLL +  +++ LTSE CYK LP+  N                   EI  F GWP++ W   +H   SKPSRDW  P RL+D+   YIEY+    DG+V+G  V+R+A   HCR L T   Y E ET+VCV + KRE GLWH++L +I+ G+ V+F+PY+++K++PA W+  +++++A  A+VKSRD+HWALLA ++H  I+L+ LR LLV+DG+NPWSL++CD F +AF      LR  A+CPCAGSSET T+S+RR                 N  L     S  GRG+LSM +LS+ +VRVD+ENSLTSLTLQD GQI+ G   VV   +GS  LC  DE+GE+C+ A+ T   YW L GQT+  FKV+P+   G ++      YVRSGL+GF+GP    G++F+    Q L+ VSGR H+ADDIIATVLAVEPMK V+RGRI VFS  +LRDERIVIVAE +   SEE AF W++RV++A+D+IHQ  +YC  LVP N+LPKTPLGG+HV +TK+RF  G L    +L+CPH  + NLPKPR+     VGP+AM VG++VQG R+A A+GR+I  E  S  + + L  RA ++P+ R+   + ++  E  + T S L +RAERIA  L ++ ++     +AL++ P I+LV A + C+  G +PV IKPP          + N+TL                         R +++      +L    V K++K++    +   N    ++D +D P              +       S +E+ Y+DFS +  G   G   + ++ + +C++ K+  E YPSR VV+   PYSG+   LWCLS VY GH +  +PP  +E QP L+LT  S  +VRD F +YS I      LA S+  L++RG +L+ LRS V +AEERPR+   S+FCKLF+ L LN+RA+STSF  RVN AIC+QGAS P+ S VYVD  +LRNDR+ L+ KG+PHS+ L+ESGKLLPGV+IAIA+PET GQCADSHLGEIWV+S  N+S L          D G     + + +L TG+    +ARTGYLGF+R+T+     GE HDAVFVVGAL  +++LRGMRYHP D+ESTV + H+  +    VFTW++L+V+  E  G + +A+DLV  +TS+VLEEH+LIVGVVVVVD G+I+    GEK R  +R +F+ +KL+P+YV+Y+M
Sbjct:  335 LKQAKVSSKIQNVVNALQRPRSKPLQDYYNDDDAELEAMAKIRDPDAPRPEGTIMNPVRGEAAHSNTNNTMPRSLDSAFHRFGTTAAKNIAAMVLDQSAKPS-TQLTYGKLHSRAGKVAYMLLTKTVQVNKDGSKNVMCKPGDRVALIYPNTQPLHFLAAFYGCLQAGVIPVPVEMPSSKREAGIAQLGFLLGNCGVKVALTSESCYKGLPKKVNTSSTFSAPSGSNSLTGTSSEIVDFRGWPRLWWAVTEH--MSKPSRDWTAPPRLADETIAYIEYT-TGNDGTVKGCCVTRQAVFAHCRALTTAMEYKEDETMVCVVDFKREVGLWHAILASIFNGMKVIFVPYSLMKMNPATWMHMVSKYQATTALVKSRDLHWALLATRDHKDISLASLRTLLVADGANPWSLSSCDAFAAAFTPSPYSLRPDAMCPCAGSSETGTISIRRRG---------------NAQL----GSQSGRGILSMSALSHCVVRVDTENSLTSLTLQDAGQIVAGAVVVVTAIDGSNRLCQADEIGEICVSANSTAQLYWALDGQTHHTFKVEPVGEYGKLI--GAVRYVRSGLIGFMGP---DGMVFVVARRQSLLAVSGRYHSADDIIATVLAVEPMKFVYRGRICVFSTSVLRDERIVIVAEQKPNCSEEEAFDWITRVLRAIDTIHQVGIYCCALVPANHLPKTPLGGVHVSETKQRFENGDLHPSTLLMCPHNCVLNLPKPRER-QADVGPAAMFVGNIVQGVRIAVAKGRNIDDE-PSLPLLECLRSRAQSSPDHRILTLVTSKNAEQDTATCSTLLKRAERIAGLLTDRARLSRGDHVALIFPPSIDLVAAFFGCLSAGLVPVCIKPPV-------ASDLNTTLG----------------------PIRMMVDMSKAVAILAPQNVSKLLKSKEAAHSIDSNAWPMILDLEDAPSSWRRKNNNNCDTTTSGSSGAASKEEICYLDFSINSSGQLQGSSMSEASAITVCKSIKVSSELYPSRHVVVCAPPYSGISLVLWCLSSVYSGHHTTLIPPMEVEQQPSLFLTTLSNLKVRDAFTTYSTINTCVTQLATSVENLRERGCNLSMLRSCVAIAEERPRIALMSSFCKLFAPLALNNRAISTSFSSRVNAAICMQGASGPEPSTVYVDARALRNDRISLVGKGAPHSVALIESGKLLPGVKIAIANPETRGQCADSHLGEIWVASIHNASPLNRLASVTGFGDEGTMNTDVYNARLTTGDTKTRWARTGYLGFLRQTQSITEHGELHDAVFVVGALNESLVLRGMRYHPFDVESTVSKAHRF-VGNSAVFTWNHLVVIAAECTGSESDALDLVPAITSAVLEEHHLIVGVVVVVDPGSIRHGPGGEKLRSTIRSLFLEEKLNPIYVAYHM 1679          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Celegans
Match: dip-2 (Disco-Interacting Protein 2 homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AE78])

HSP 1 Score: 1180.24 bits (3052), Expect = 0.000e+0
Identity = 629/1405 (44.77%), Postives = 884/1405 (62.92%), Query Frame = 3
Query: 1080 LVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESL--NMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNK---LGHRGEHSL--KPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTN------------------GEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQK--GLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQN----MIDTDDLPKK---------RLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDL------IVPNDNGEAKKQL-SMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            L  ++VS KIQ +V  L+RP+ +PL +Y+ +D+  L  +    DP+AP+P+GT++ P  GE+   N  + +PRSL+SA   +     K      +D + + +   LTY KL  RA ++AY+LL K   +   G  ++  KP DRVAL++ N  P++F+ AFYGC+ A V+P+ +E+P  +R+A    +GFLL +  +++ LTSE CYK LP+  N                   EI  F GWP++ W   +H   SKPSRDW  P RL+D+   YIEY+    DG+V+G  V+R+A   HCR L T   Y E ET+VCV + KRE GLWH++L +I+ G+ V+F+PY+++K++PA W+  +++++A  A+VKSRD+HWALLA ++H  I+L+ LR LLV+DG+NPWSL++CD F +AF      LR  A+CPCAGSSET T+S+RR                 N  L     S  GRG+LSM +LS+ +VRVD+ENSLTSLTLQD GQI+ G   VV   +GS  LC  DE+GE+C+ A+ T   YW L GQT+  FKV+P+   G ++      YVRSGL+GF+GP    G++F+    Q L+ VSGR H+ADDIIATVLAVEPMK V+RGRI VFS  +LRDERIVIVAE +   SEE AF W++RV++A+D+IHQ  +YC  LVP N+LPKTPLGG+HV +TK+RF  G L    +L+CPH  + NLPKPR+     VGP+AM VG++VQG R+A A+GR+I  E  S  + + L  RA ++P+ R+   + ++  E  + T S L +RAERIA  L ++ ++     +AL++ P I+LV A + C+  G +PV IKPP          + N+TL                         R +++      +L    V K++K++    +   N    ++D +D P              +       S +E+ Y+DFS +  G   G   + ++ + +C++ K+  E YPSR VV+   PYSG+   LWCLS VY GH +  +PP  +E QP L+LT  S  +VRD F +YS I      LA S+  L++RG +L+ LRS V +AEERPR+   S+FCKLF+ L LN+RA+STSF  RVN AIC+QGAS P+ S VYVD  +LRNDR+ L+ KG+PHS+ L+ESGKLLPGV+IAIA+PET GQCADSHLGEIWV+S  N+S L          D G     + + +L TG+    +ARTGYLGF+R+T+     GE HDAVFVVGAL  +++LRGMRYHP D+ESTV + H+  +    VFTW++L+V+  E  G + +A+DLV  +TS+VLEEH+LIVGVVVVVD G+I+    GEK R  +R +F+ +KL+P+YV+Y+M
Sbjct:  309 LKQAKVSSKIQNVVNALQRPRSKPLQDYYNDDDAELEAMAKIRDPDAPRPEGTIMNPVRGEAAHSNTNNTMPRSLDSAFHRFGTTAAKNIAAMVLDQSAKPS-TQLTYGKLHSRAGKVAYMLLTKTVQVNKDGSKNVMCKPGDRVALIYPNTQPLHFLAAFYGCLQAGVIPVPVEMPSSKREAGIAQLGFLLGNCGVKVALTSESCYKGLPKKVNTSSTFSAPSGSNSLTGTSSEIVDFRGWPRLWWAVTEH--MSKPSRDWTAPPRLADETIAYIEYT-TGNDGTVKGCCVTRQAVFAHCRALTTAMEYKEDETMVCVVDFKREVGLWHAILASIFNGMKVIFVPYSLMKMNPATWMHMVSKYQATTALVKSRDLHWALLATRDHKDISLASLRTLLVADGANPWSLSSCDAFAAAFTPSPYSLRPDAMCPCAGSSETGTISIRRRG---------------NAQL----GSQSGRGILSMSALSHCVVRVDTENSLTSLTLQDAGQIVAGAVVVVTAIDGSNRLCQADEIGEICVSANSTAQLYWALDGQTHHTFKVEPVGEYGKLI--GAVRYVRSGLIGFMGP---DGMVFVVARRQSLLAVSGRYHSADDIIATVLAVEPMKFVYRGRICVFSTSVLRDERIVIVAEQKPNCSEEEAFDWITRVLRAIDTIHQVGIYCCALVPANHLPKTPLGGVHVSETKQRFENGDLHPSTLLMCPHNCVLNLPKPRER-QADVGPAAMFVGNIVQGVRIAVAKGRNIDDE-PSLPLLECLRSRAQSSPDHRILTLVTSKNAEQDTATCSTLLKRAERIAGLLTDRARLSRGDHVALIFPPSIDLVAAFFGCLSAGLVPVCIKPPV-------ASDLNTTLG----------------------PIRMMVDMSKAVAILAPQNVSKLLKSKEAAHSIDSNAWPMILDLEDAPSSWRRKNNNNCDTTTSGSSGAASKEEICYLDFSINSSGQLQGSSMSEASAITVCKSIKVSSELYPSRHVVVCAPPYSGISLVLWCLSSVYSGHHTTLIPPMEVEQQPSLFLTTLSNLKVRDAFTTYSTINTCVTQLATSVENLRERGCNLSMLRSCVAIAEERPRIALMSSFCKLFAPLALNNRAISTSFSSRVNAAICMQGASGPEPSTVYVDARALRNDRISLVGKGAPHSVALIESGKLLPGVKIAIANPETRGQCADSHLGEIWVASIHNASPLNRLASVTGFGDEGTMNTDVYNARLTTGDTKTRWARTGYLGFLRQTQSITEHGELHDAVFVVGALNESLVLRGMRYHPFDVESTVSKAHRF-VGNSAVFTWNHLVVIAAECTGSESDALDLVPAITSAVLEEHHLIVGVVVVVDPGSIRHGPGGEKLRSTIRSLFLEEKLNPIYVAYHM 1653          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Celegans
Match: dip-2 (Disco-Interacting Protein 2 homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AE78])

HSP 1 Score: 1177.16 bits (3044), Expect = 0.000e+0
Identity = 629/1407 (44.71%), Postives = 884/1407 (62.83%), Query Frame = 3
Query: 1080 LVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESL--NMLSGLPRSLES--ALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNK---LGHRGEHSL--KPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTN------------------GEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQK--GLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQN----MIDTDDLPKK---------RLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDL------IVPNDNGEAKKQL-SMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            L  ++VS KIQ +V  L+RP+ +PL +Y+ +D+  L  +    DP+AP+P+GT++ P  GE+   N  + +PRSL+S  A   +     K      +D + + +   LTY KL  RA ++AY+LL K   +   G  ++  KP DRVAL++ N  P++F+ AFYGC+ A V+P+ +E+P  +R+A    +GFLL +  +++ LTSE CYK LP+  N                   EI  F GWP++ W   +H   SKPSRDW  P RL+D+   YIEY+    DG+V+G  V+R+A   HCR L T   Y E ET+VCV + KRE GLWH++L +I+ G+ V+F+PY+++K++PA W+  +++++A  A+VKSRD+HWALLA ++H  I+L+ LR LLV+DG+NPWSL++CD F +AF      LR  A+CPCAGSSET T+S+RR                 N  L     S  GRG+LSM +LS+ +VRVD+ENSLTSLTLQD GQI+ G   VV   +GS  LC  DE+GE+C+ A+ T   YW L GQT+  FKV+P+   G ++      YVRSGL+GF+GP    G++F+    Q L+ VSGR H+ADDIIATVLAVEPMK V+RGRI VFS  +LRDERIVIVAE +   SEE AF W++RV++A+D+IHQ  +YC  LVP N+LPKTPLGG+HV +TK+RF  G L    +L+CPH  + NLPKPR+     VGP+AM VG++VQG R+A A+GR+I  E  S  + + L  RA ++P+ R+   + ++  E  + T S L +RAERIA  L ++ ++     +AL++ P I+LV A + C+  G +PV IKPP          + N+TL                         R +++      +L    V K++K++    +   N    ++D +D P              +       S +E+ Y+DFS +  G   G   + ++ + +C++ K+  E YPSR VV+   PYSG+   LWCLS VY GH +  +PP  +E QP L+LT  S  +VRD F +YS I      LA S+  L++RG +L+ LRS V +AEERPR+   S+FCKLF+ L LN+RA+STSF  RVN AIC+QGAS P+ S VYVD  +LRNDR+ L+ KG+PHS+ L+ESGKLLPGV+IAIA+PET GQCADSHLGEIWV+S  N+S L          D G     + + +L TG+    +ARTGYLGF+R+T+     GE HDAVFVVGAL  +++LRGMRYHP D+ESTV + H+  +    VFTW++L+V+  E  G + +A+DLV  +TS+VLEEH+LIVGVVVVVD G+I+    GEK R  +R +F+ +KL+P+YV+Y+M
Sbjct:  335 LKQAKVSSKIQNVVNALQRPRSKPLQDYYNDDDAELEAMAKIRDPDAPRPEGTIMNPVRGEAAHSNTNNTMPRSLDSFSAFHRFGTTAAKNIAAMVLDQSAKPS-TQLTYGKLHSRAGKVAYMLLTKTVQVNKDGSKNVMCKPGDRVALIYPNTQPLHFLAAFYGCLQAGVIPVPVEMPSSKREAGIAQLGFLLGNCGVKVALTSESCYKGLPKKVNTSSTFSAPSGSNSLTGTSSEIVDFRGWPRLWWAVTEH--MSKPSRDWTAPPRLADETIAYIEYT-TGNDGTVKGCCVTRQAVFAHCRALTTAMEYKEDETMVCVVDFKREVGLWHAILASIFNGMKVIFVPYSLMKMNPATWMHMVSKYQATTALVKSRDLHWALLATRDHKDISLASLRTLLVADGANPWSLSSCDAFAAAFTPSPYSLRPDAMCPCAGSSETGTISIRRRG---------------NAQL----GSQSGRGILSMSALSHCVVRVDTENSLTSLTLQDAGQIVAGAVVVVTAIDGSNRLCQADEIGEICVSANSTAQLYWALDGQTHHTFKVEPVGEYGKLI--GAVRYVRSGLIGFMGP---DGMVFVVARRQSLLAVSGRYHSADDIIATVLAVEPMKFVYRGRICVFSTSVLRDERIVIVAEQKPNCSEEEAFDWITRVLRAIDTIHQVGIYCCALVPANHLPKTPLGGVHVSETKQRFENGDLHPSTLLMCPHNCVLNLPKPRER-QADVGPAAMFVGNIVQGVRIAVAKGRNIDDE-PSLPLLECLRSRAQSSPDHRILTLVTSKNAEQDTATCSTLLKRAERIAGLLTDRARLSRGDHVALIFPPSIDLVAAFFGCLSAGLVPVCIKPPV-------ASDLNTTLG----------------------PIRMMVDMSKAVAILAPQNVSKLLKSKEAAHSIDSNAWPMILDLEDAPSSWRRKNNNNCDTTTSGSSGAASKEEICYLDFSINSSGQLQGSSMSEASAITVCKSIKVSSELYPSRHVVVCAPPYSGISLVLWCLSSVYSGHHTTLIPPMEVEQQPSLFLTTLSNLKVRDAFTTYSTINTCVTQLATSVENLRERGCNLSMLRSCVAIAEERPRIALMSSFCKLFAPLALNNRAISTSFSSRVNAAICMQGASGPEPSTVYVDARALRNDRISLVGKGAPHSVALIESGKLLPGVKIAIANPETRGQCADSHLGEIWVASIHNASPLNRLASVTGFGDEGTMNTDVYNARLTTGDTKTRWARTGYLGFLRQTQSITEHGELHDAVFVVGALNESLVLRGMRYHPFDVESTVSKAHRF-VGNSAVFTWNHLVVIAAECTGSESDALDLVPAITSAVLEEHHLIVGVVVVVDPGSIRHGPGGEKLRSTIRSLFLEEKLNPIYVAYHM 1681          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Celegans
Match: dip-2 (Disco-Interacting Protein 2 homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AE78])

HSP 1 Score: 1174.84 bits (3038), Expect = 0.000e+0
Identity = 629/1407 (44.71%), Postives = 884/1407 (62.83%), Query Frame = 3
Query: 1080 LVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESL--NMLSGLPRSLES--ALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNK---LGHRGEHSL--KPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTN------------------GEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQK--GLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQN----MIDTDDLPKK---------RLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDL------IVPNDNGEAKKQL-SMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            L  ++VS KIQ +V  L+RP+ +PL +Y+ +D+  L  +    DP+AP+P+GT++ P  GE+   N  + +PRSL+S  A   +     K      +D + + +   LTY KL  RA ++AY+LL K   +   G  ++  KP DRVAL++ N  P++F+ AFYGC+ A V+P+ +E+P  +R+A    +GFLL +  +++ LTSE CYK LP+  N                   EI  F GWP++ W   +H   SKPSRDW  P RL+D+   YIEY+    DG+V+G  V+R+A   HCR L T   Y E ET+VCV + KRE GLWH++L +I+ G+ V+F+PY+++K++PA W+  +++++A  A+VKSRD+HWALLA ++H  I+L+ LR LLV+DG+NPWSL++CD F +AF      LR  A+CPCAGSSET T+S+RR                 N  L     S  GRG+LSM +LS+ +VRVD+ENSLTSLTLQD GQI+ G   VV   +GS  LC  DE+GE+C+ A+ T   YW L GQT+  FKV+P+   G ++      YVRSGL+GF+GP    G++F+    Q L+ VSGR H+ADDIIATVLAVEPMK V+RGRI VFS  +LRDERIVIVAE +   SEE AF W++RV++A+D+IHQ  +YC  LVP N+LPKTPLGG+HV +TK+RF  G L    +L+CPH  + NLPKPR+     VGP+AM VG++VQG R+A A+GR+I  E  S  + + L  RA ++P+ R+   + ++  E  + T S L +RAERIA  L ++ ++     +AL++ P I+LV A + C+  G +PV IKPP          + N+TL                         R +++      +L    V K++K++    +   N    ++D +D P              +       S +E+ Y+DFS +  G   G   + ++ + +C++ K+  E YPSR VV+   PYSG+   LWCLS VY GH +  +PP  +E QP L+LT  S  +VRD F +YS I      LA S+  L++RG +L+ LRS V +AEERPR+   S+FCKLF+ L LN+RA+STSF  RVN AIC+QGAS P+ S VYVD  +LRNDR+ L+ KG+PHS+ L+ESGKLLPGV+IAIA+PET GQCADSHLGEIWV+S  N+S L          D G     + + +L TG+    +ARTGYLGF+R+T+     GE HDAVFVVGAL  +++LRGMRYHP D+ESTV + H+  +    VFTW++L+V+  E  G + +A+DLV  +TS+VLEEH+LIVGVVVVVD G+I+    GEK R  +R +F+ +KL+P+YV+Y+M
Sbjct:  309 LKQAKVSSKIQNVVNALQRPRSKPLQDYYNDDDAELEAMAKIRDPDAPRPEGTIMNPVRGEAAHSNTNNTMPRSLDSFSAFHRFGTTAAKNIAAMVLDQSAKPS-TQLTYGKLHSRAGKVAYMLLTKTVQVNKDGSKNVMCKPGDRVALIYPNTQPLHFLAAFYGCLQAGVIPVPVEMPSSKREAGIAQLGFLLGNCGVKVALTSESCYKGLPKKVNTSSTFSAPSGSNSLTGTSSEIVDFRGWPRLWWAVTEH--MSKPSRDWTAPPRLADETIAYIEYT-TGNDGTVKGCCVTRQAVFAHCRALTTAMEYKEDETMVCVVDFKREVGLWHAILASIFNGMKVIFVPYSLMKMNPATWMHMVSKYQATTALVKSRDLHWALLATRDHKDISLASLRTLLVADGANPWSLSSCDAFAAAFTPSPYSLRPDAMCPCAGSSETGTISIRRRG---------------NAQL----GSQSGRGILSMSALSHCVVRVDTENSLTSLTLQDAGQIVAGAVVVVTAIDGSNRLCQADEIGEICVSANSTAQLYWALDGQTHHTFKVEPVGEYGKLI--GAVRYVRSGLIGFMGP---DGMVFVVARRQSLLAVSGRYHSADDIIATVLAVEPMKFVYRGRICVFSTSVLRDERIVIVAEQKPNCSEEEAFDWITRVLRAIDTIHQVGIYCCALVPANHLPKTPLGGVHVSETKQRFENGDLHPSTLLMCPHNCVLNLPKPRER-QADVGPAAMFVGNIVQGVRIAVAKGRNIDDE-PSLPLLECLRSRAQSSPDHRILTLVTSKNAEQDTATCSTLLKRAERIAGLLTDRARLSRGDHVALIFPPSIDLVAAFFGCLSAGLVPVCIKPPV-------ASDLNTTLG----------------------PIRMMVDMSKAVAILAPQNVSKLLKSKEAAHSIDSNAWPMILDLEDAPSSWRRKNNNNCDTTTSGSSGAASKEEICYLDFSINSSGQLQGSSMSEASAITVCKSIKVSSELYPSRHVVVCAPPYSGISLVLWCLSSVYSGHHTTLIPPMEVEQQPSLFLTTLSNLKVRDAFTTYSTINTCVTQLATSVENLRERGCNLSMLRSCVAIAEERPRIALMSSFCKLFAPLALNNRAISTSFSSRVNAAICMQGASGPEPSTVYVDARALRNDRISLVGKGAPHSVALIESGKLLPGVKIAIANPETRGQCADSHLGEIWVASIHNASPLNRLASVTGFGDEGTMNTDVYNARLTTGDTKTRWARTGYLGFLRQTQSITEHGELHDAVFVVGALNESLVLRGMRYHPFDVESTVSKAHRF-VGNSAVFTWNHLVVIAAECTGSESDALDLVPAITSAVLEEHHLIVGVVVVVDPGSIRHGPGGEKLRSTIRSLFLEEKLNPIYVAYHM 1655          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Celegans
Match: dip-2 (Disco-Interacting Protein 2 homolog [Source:UniProtKB/TrEMBL;Acc:A0A061AE78])

HSP 1 Score: 1163.29 bits (3008), Expect = 0.000e+0
Identity = 624/1403 (44.48%), Postives = 879/1403 (62.65%), Query Frame = 3
Query: 1104 KIQQLVQTLK------RPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESL--NMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNK---LGHRGEHSL--KPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTN------------------GEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQK--GLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQN----MIDTDDLPKK---------RLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDL------IVPNDNGEAKKQL-SMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            K+ Q +Q ++      RP+ +PL +Y+ +D+  L  +    DP+AP+P+GT++ P  GE+   N  + +PRSL+SA   +     K      +D + + +   LTY KL  RA ++AY+LL K   +   G  ++  KP DRVAL++ N  P++F+ AFYGC+ A V+P+ +E+P  +R+A    +GFLL +  +++ LTSE CYK LP+  N                   EI  F GWP++ W   +H   SKPSRDW  P RL+D+   YIEY+    DG+V+G  V+R+A   HCR L T   Y E ET+VCV + KRE GLWH++L +I+ G+ V+F+PY+++K++PA W+  +++++A  A+VKSRD+HWALLA ++H  I+L+ LR LLV+DG+NPWSL++CD F +AF      LR  A+CPCAGSSET T+S+RR                 N  L     S  GRG+LSM +LS+ +VRVD+ENSLTSLTLQD GQI+ G   VV   +GS  LC  DE+GE+C+ A+ T   YW L GQT+  FKV+P+   G ++      YVRSGL+GF+GP    G++F+    Q L+ VSGR H+ADDIIATVLAVEPMK V+RGRI VFS  +LRDERIVIVAE +   SEE AF W++RV++A+D+IHQ  +YC  LVP N+LPKTPLGG+HV +TK+RF  G L    +L+CPH  + NLPKPR+     VGP+AM VG++VQG R+A A+GR+I  E  S  + + L  RA ++P+ R+   + ++  E  + T S L +RAERIA  L ++ ++     +AL++ P I+LV A + C+  G +PV IKPP          + N+TL                         R +++      +L    V K++K++    +   N    ++D +D P              +       S +E+ Y+DFS +  G   G   + ++ + +C++ K+  E YPSR VV+   PYSG+   LWCLS VY GH +  +PP  +E QP L+LT  S  +VRD F +YS I      LA S+  L++RG +L+ LRS V +AEERPR+   S+FCKLF+ L LN+RA+STSF  RVN AIC+QGAS P+ S VYVD  +LRNDR+ L+ KG+PHS+ L+ESGKLLPGV+IAIA+PET GQCADSHLGEIWV+S  N+S L          D G     + + +L TG+    +ARTGYLGF+R+T+     GE HDAVFVVGAL  +++LRGMRYHP D+ESTV + H+  +    VFTW++L+V+  E  G + +A+DLV  +TS+VLEEH+LIVGVVVVVD G+I+    GEK R  +R +F+ +KL+P+YV+Y+M
Sbjct:  197 KLNQTIQAIEENRQKLRPRSKPLQDYYNDDDAELEAMAKIRDPDAPRPEGTIMNPVRGEAAHSNTNNTMPRSLDSAFHRFGTTAAKNIAAMVLDQSAKPS-TQLTYGKLHSRAGKVAYMLLTKTVQVNKDGSKNVMCKPGDRVALIYPNTQPLHFLAAFYGCLQAGVIPVPVEMPSSKREAGIAQLGFLLGNCGVKVALTSESCYKGLPKKVNTSSTFSAPSGSNSLTGTSSEIVDFRGWPRLWWAVTEH--MSKPSRDWTAPPRLADETIAYIEYT-TGNDGTVKGCCVTRQAVFAHCRALTTAMEYKEDETMVCVVDFKREVGLWHAILASIFNGMKVIFVPYSLMKMNPATWMHMVSKYQATTALVKSRDLHWALLATRDHKDISLASLRTLLVADGANPWSLSSCDAFAAAFTPSPYSLRPDAMCPCAGSSETGTISIRRRG---------------NAQL----GSQSGRGILSMSALSHCVVRVDTENSLTSLTLQDAGQIVAGAVVVVTAIDGSNRLCQADEIGEICVSANSTAQLYWALDGQTHHTFKVEPVGEYGKLI--GAVRYVRSGLIGFMGP---DGMVFVVARRQSLLAVSGRYHSADDIIATVLAVEPMKFVYRGRICVFSTSVLRDERIVIVAEQKPNCSEEEAFDWITRVLRAIDTIHQVGIYCCALVPANHLPKTPLGGVHVSETKQRFENGDLHPSTLLMCPHNCVLNLPKPRER-QADVGPAAMFVGNIVQGVRIAVAKGRNIDDE-PSLPLLECLRSRAQSSPDHRILTLVTSKNAEQDTATCSTLLKRAERIAGLLTDRARLSRGDHVALIFPPSIDLVAAFFGCLSAGLVPVCIKPPV-------ASDLNTTLG----------------------PIRMMVDMSKAVAILAPQNVSKLLKSKEAAHSIDSNAWPMILDLEDAPSSWRRKNNNNCDTTTSGSSGAASKEEICYLDFSINSSGQLQGSSMSEASAITVCKSIKVSSELYPSRHVVVCAPPYSGISLVLWCLSSVYSGHHTTLIPPMEVEQQPSLFLTTLSNLKVRDAFTTYSTINTCVTQLATSVENLRERGCNLSMLRSCVAIAEERPRIALMSSFCKLFAPLALNNRAISTSFSSRVNAAICMQGASGPEPSTVYVDARALRNDRISLVGKGAPHSVALIESGKLLPGVKIAIANPETRGQCADSHLGEIWVASIHNASPLNRLASVTGFGDEGTMNTDVYNARLTTGDTKTRWARTGYLGFLRQTQSITEHGELHDAVFVVGALNESLVLRGMRYHPFDVESTVSKAHRF-VGNSAVFTWNHLVVIAAECTGSESDALDLVPAITSAVLEEHHLIVGVVVVVDPGSIRHGPGGEKLRSTIRSLFLEEKLNPIYVAYHM 1539          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Fly
Match: DIP2 (gene:FBgn0024806 transcript:FBtr0332108)

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 732/1432 (51.12%), Postives = 952/1432 (66.48%), Query Frame = 3
Query: 1092 RVSEKIQQLVQTLKRPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEH--SLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPR-TTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPE-RLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPL--------DSCGN---IVDPNGPG-YVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQ-VGPSAMMVGHLVQGNRLAWAQGRDISV----EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRV-TLTDGQN---MIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQS----------------------------------------------------DGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +VS KIQQL+ TLKRPKRRPLPE++++++  L +    +DPNAPKP+G+ + P  GE L++ +GLPR+LE ALQ Y     K  + + +D NG+V   +LTY KLL RA +IA+ L  K+  +G    +LKP DRVALV+ NNDP++FI A+YGC+   +VPL IE+PL   D   Q +GFLL+S  I + LTSE C K LP+ TT GEI    GWP++QW   +H    KP +++     R  D    YIEY+   K+GSV GVTV+R A + HCR L   C Y EGET+VCV + KRE GLWHSVLT++  G+HV+FIPYA++K+ P+ W++ IT+H+A+  +VKSRD+HW LLA K+H  I+LS LR+LLV+DG+NPWSL++CD F+S F+ KGLRS A+CPCA SSE  T+SLRRP  G         S G + S         GRGVLSM +LS+G+VRVDSE+SLTSLTLQDCGQ++P  + VV++  G P LC TD+VGE+C+ +  T + Y+GL G TN  FKVQPL        D  G    I  P G   YVRSGLLGF      GGL+F+CGS  GLMTV+GR+HNADDIIATVLAVEPM+ ++RGRIAVFSI +LRDER+ ++AE R   SEE +F+WMSRV+QAVDSIHQ  +YC+ LVP N+LPKTPLGGIH+ + +RRFLEG L   NVL+CPH  +TNLPKPR++     VGP+++MVG+LVQGNRLA A GRD+ +    E + + I+ +L  RA  +P+  +F  LN++     + T S+L +RAE+IA  L E+ +I     +AL++ PG++L+CA Y C+  G IP+TI+PP  P  +N T                            L   R I++     IVL+   +IK++K++   T  D +    ++D DD PK++          S D  AY+DFS S  G   GV  TH +L  +C + KL CE YPSR V L LDPY GLGF +W L GVY GH S  + P  +E+ P LWL+  S  +VRDTFCSY  IEL TK L+NSIP+LKQR I L C+R+ V+VAEERPRVQ T  FCKLF  LGLN+R VSTSFGCRVN AIC+QGASS +++ VYVD  +LRN+RV L+E+G+P+SLC++ESGKLLPGV++ IA+PET G C DSHLGEIWV +P N++    +  D  +     + KL TG    +YARTGYLGF+RRTE +QS                                                    D E HDAV+VVGA++  I LRGM YHPIDIE++VMRCHK KIAEC VFTW+NLLVVVVEL+G + EA+DLV LVT++VLE+H LIVGVVVVVD G + +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  381 KVSAKIQQLLNTLKRPKRRPLPEFYEDNDIELEIAANTKDPNAPKPEGSTMTPVQGEQLSIPAGLPRTLECALQRYGTNSFKSPMATVLDPNGKVT-TTLTYGKLLSRAQKIAHALSTKIFSKGPEQVTLKPGDRVALVYPNNDPLSFITAWYGCMFRGLVPLPIELPLSSSDTPPQQVGFLLSSCGITVALTSEACLKGLPKSTTTGEIAKLKGWPRLQWFVTEH--LPKPPKEFNVGNLRADDSAAAYIEYT-TDKEGSVMGVTVTRAAMINHCRALTMACHYTEGETIVCVLDFKREVGLWHSVLTSVLNGMHVIFIPYALMKLRPSSWMQLITKHRASCCLVKSRDLHWGLLATKDHKDISLSSLRMLLVADGANPWSLSSCDQFLSVFQAKGLRSDAICPCASSSEVFTVSLRRPGRG---------SCGFSPSAT-------GRGVLSMAALSHGVVRVDSEDSLTSLTLQDCGQVMPAAQMVVVRSEGPPVLCKTDQVGEICVTSGSTSASYFGLDGMTNSTFKVQPLLEELEQPKDGNGTVNIISKPIGEDFYVRSGLLGF---LGPGGLVFVCGSRDGLMTVTGRKHNADDIIATVLAVEPMRFIYRGRIAVFSIKVLRDERVCVIAEQRPDCSEEESFQWMSRVLQAVDSIHQVGIYCLALVPPNHLPKTPLGGIHLCEARRRFLEGSLHPANVLMCPHTCVTNLPKPRELHQDTGVGPASVMVGNLVQGNRLAEAHGRDVGLAEDCERKPQLITGVLRWRANTSPDHIIFTLLNSKGAIAKTLTCSELHKRAEKIAALLQERGRIEPGDHVALIFPPGLDLLCAFYGCLYLGAIPITIRPPH-PQNLNTT----------------------------LPTVRMIVDVSKSGIVLSIQPIIKLLKSREAATSIDPKTWPPILDIDDNPKRKYAG---IATVSFDSSAYLDFSVSTCGRLSGVNITHRSLSSLCASLKLACELYPSRHVALCLDPYCGLGFVMWTLIGVYSGHHSILIAPYEVEANPSLWLSTLSQHRVRDTFCSYGVIELCTKALSNSIPSLKQRNIDLRCVRTCVVVAEERPRVQLTQQFCKLFQALGLNTRCVSTSFGCRVNPAICVQGASSAESAQVYVDMRALRNNRVALVERGAPNSLCVIESGKLLPGVKVIIANPETKGHCGDSHLGEIWVQAPHNANGYFTIYGDETDYNDHFNAKLVTGATSELYARTGYLGFLRRTECSQSASLLDETTPSVASRDSDTESLNSISQLQLNFSNVSLGGNSEHSLVGGASNANDQELHDAVYVVGAVDEVISLRGMNYHPIDIENSVMRCHK-KIAECAVFTWTNLLVVVVELDGNESEALDLVPLVTNTVLEDHQLIVGVVVVVDPGVVPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1756          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Fly
Match: DIP2 (gene:FBgn0024806 transcript:FBtr0305325)

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 732/1432 (51.12%), Postives = 952/1432 (66.48%), Query Frame = 3
Query: 1092 RVSEKIQQLVQTLKRPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEH--SLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPR-TTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPE-RLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPL--------DSCGN---IVDPNGPG-YVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQ-VGPSAMMVGHLVQGNRLAWAQGRDISV----EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRV-TLTDGQN---MIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQS----------------------------------------------------DGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +VS KIQQL+ TLKRPKRRPLPE++++++  L +    +DPNAPKP+G+ + P  GE L++ +GLPR+LE ALQ Y     K  + + +D NG+V   +LTY KLL RA +IA+ L  K+  +G    +LKP DRVALV+ NNDP++FI A+YGC+   +VPL IE+PL   D   Q +GFLL+S  I + LTSE C K LP+ TT GEI    GWP++QW   +H    KP +++     R  D    YIEY+   K+GSV GVTV+R A + HCR L   C Y EGET+VCV + KRE GLWHSVLT++  G+HV+FIPYA++K+ P+ W++ IT+H+A+  +VKSRD+HW LLA K+H  I+LS LR+LLV+DG+NPWSL++CD F+S F+ KGLRS A+CPCA SSE  T+SLRRP  G         S G + S         GRGVLSM +LS+G+VRVDSE+SLTSLTLQDCGQ++P  + VV++  G P LC TD+VGE+C+ +  T + Y+GL G TN  FKVQPL        D  G    I  P G   YVRSGLLGF      GGL+F+CGS  GLMTV+GR+HNADDIIATVLAVEPM+ ++RGRIAVFSI +LRDER+ ++AE R   SEE +F+WMSRV+QAVDSIHQ  +YC+ LVP N+LPKTPLGGIH+ + +RRFLEG L   NVL+CPH  +TNLPKPR++     VGP+++MVG+LVQGNRLA A GRD+ +    E + + I+ +L  RA  +P+  +F  LN++     + T S+L +RAE+IA  L E+ +I     +AL++ PG++L+CA Y C+  G IP+TI+PP  P  +N T                            L   R I++     IVL+   +IK++K++   T  D +    ++D DD PK++          S D  AY+DFS S  G   GV  TH +L  +C + KL CE YPSR V L LDPY GLGF +W L GVY GH S  + P  +E+ P LWL+  S  +VRDTFCSY  IEL TK L+NSIP+LKQR I L C+R+ V+VAEERPRVQ T  FCKLF  LGLN+R VSTSFGCRVN AIC+QGASS +++ VYVD  +LRN+RV L+E+G+P+SLC++ESGKLLPGV++ IA+PET G C DSHLGEIWV +P N++    +  D  +     + KL TG    +YARTGYLGF+RRTE +QS                                                    D E HDAV+VVGA++  I LRGM YHPIDIE++VMRCHK KIAEC VFTW+NLLVVVVEL+G + EA+DLV LVT++VLE+H LIVGVVVVVD G + +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  380 KVSAKIQQLLNTLKRPKRRPLPEFYEDNDIELEIAANTKDPNAPKPEGSTMTPVQGEQLSIPAGLPRTLECALQRYGTNSFKSPMATVLDPNGKVT-TTLTYGKLLSRAQKIAHALSTKIFSKGPEQVTLKPGDRVALVYPNNDPLSFITAWYGCMFRGLVPLPIELPLSSSDTPPQQVGFLLSSCGITVALTSEACLKGLPKSTTTGEIAKLKGWPRLQWFVTEH--LPKPPKEFNVGNLRADDSAAAYIEYT-TDKEGSVMGVTVTRAAMINHCRALTMACHYTEGETIVCVLDFKREVGLWHSVLTSVLNGMHVIFIPYALMKLRPSSWMQLITKHRASCCLVKSRDLHWGLLATKDHKDISLSSLRMLLVADGANPWSLSSCDQFLSVFQAKGLRSDAICPCASSSEVFTVSLRRPGRG---------SCGFSPSAT-------GRGVLSMAALSHGVVRVDSEDSLTSLTLQDCGQVMPAAQMVVVRSEGPPVLCKTDQVGEICVTSGSTSASYFGLDGMTNSTFKVQPLLEELEQPKDGNGTVNIISKPIGEDFYVRSGLLGF---LGPGGLVFVCGSRDGLMTVTGRKHNADDIIATVLAVEPMRFIYRGRIAVFSIKVLRDERVCVIAEQRPDCSEEESFQWMSRVLQAVDSIHQVGIYCLALVPPNHLPKTPLGGIHLCEARRRFLEGSLHPANVLMCPHTCVTNLPKPRELHQDTGVGPASVMVGNLVQGNRLAEAHGRDVGLAEDCERKPQLITGVLRWRANTSPDHIIFTLLNSKGAIAKTLTCSELHKRAEKIAALLQERGRIEPGDHVALIFPPGLDLLCAFYGCLYLGAIPITIRPPH-PQNLNTT----------------------------LPTVRMIVDVSKSGIVLSIQPIIKLLKSREAATSIDPKTWPPILDIDDNPKRKYAG---IATVSFDSSAYLDFSVSTCGRLSGVNITHRSLSSLCASLKLACELYPSRHVALCLDPYCGLGFVMWTLIGVYSGHHSILIAPYEVEANPSLWLSTLSQHRVRDTFCSYGVIELCTKALSNSIPSLKQRNIDLRCVRTCVVVAEERPRVQLTQQFCKLFQALGLNTRCVSTSFGCRVNPAICVQGASSAESAQVYVDMRALRNNRVALVERGAPNSLCVIESGKLLPGVKVIIANPETKGHCGDSHLGEIWVQAPHNANGYFTIYGDETDYNDHFNAKLVTGATSELYARTGYLGFLRRTECSQSASLLDETTPSVASRDSDTESLNSISQLQLNFSNVSLGGNSEHSLVGGASNANDQELHDAVYVVGAVDEVISLRGMNYHPIDIENSVMRCHK-KIAECAVFTWTNLLVVVVELDGNESEALDLVPLVTNTVLEDHQLIVGVVVVVDPGVVPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1755          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Fly
Match: DIP2 (gene:FBgn0024806 transcript:FBtr0072520)

HSP 1 Score: 1348.95 bits (3490), Expect = 0.000e+0
Identity = 733/1449 (50.59%), Postives = 953/1449 (65.77%), Query Frame = 3
Query: 1092 RVSEKIQQLVQTLKRPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEH--SLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPR-TTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPE-RLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPL--------DSCGN---IVDPNGPG-YVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSG------------------QVGPSAMMVGHLVQGNRLAWAQGRDISV----EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRV-TLTDGQN---MIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQS----------------------------------------------------DGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +VS KIQQL+ TLKRPKRRPLPE++++++  L +    +DPNAPKP+G+ + P  GE L++ +GLPR+LE ALQ Y     K  + + +D NG+V   +LTY KLL RA +IA+ L  K+  +G    +LKP DRVALV+ NNDP++FI A+YGC+   +VPL IE+PL   D   Q +GFLL+S  I + LTSE C K LP+ TT GEI    GWP++QW   +H    KP +++     R  D    YIEY+   K+GSV GVTV+R A + HCR L   C Y EGET+VCV + KRE GLWHSVLT++  G+HV+FIPYA++K+ P+ W++ IT+H+A+  +VKSRD+HW LLA K+H  I+LS LR+LLV+DG+NPWSL++CD F+S F+ KGLRS A+CPCA SSE  T+SLRRP  G         S G + S         GRGVLSM +LS+G+VRVDSE+SLTSLTLQDCGQ++P  + VV++  G P LC TD+VGE+C+ +  T + Y+GL G TN  FKVQPL        D  G    I  P G   YVRSGLLGF      GGL+F+CGS  GLMTV+GR+HNADDIIATVLAVEPM+ ++RGRIAVFSI +LRDER+ ++AE R   SEE +F+WMSRV+QAVDSIHQ  +YC+ LVP N+LPKTPLGGIH+ + +RRFLEG L   NVL+CPH  +TNLPKPR++  G                   VGP+++MVG+LVQGNRLA A GRD+ +    E + + I+ +L  RA  +P+  +F  LN++     + T S+L +RAE+IA  L E+ +I     +AL++ PG++L+CA Y C+  G IP+TI+PP  P  +N T                            L   R I++     IVL+   +IK++K++   T  D +    ++D DD PK++          S D  AY+DFS S  G   GV  TH +L  +C + KL CE YPSR V L LDPY GLGF +W L GVY GH S  + P  +E+ P LWL+  S  +VRDTFCSY  IEL TK L+NSIP+LKQR I L C+R+ V+VAEERPRVQ T  FCKLF  LGLN+R VSTSFGCRVN AIC+QGASS +++ VYVD  +LRN+RV L+E+G+P+SLC++ESGKLLPGV++ IA+PET G C DSHLGEIWV +P N++    +  D  +     + KL TG    +YARTGYLGF+RRTE +QS                                                    D E HDAV+VVGA++  I LRGM YHPIDIE++VMRCHK KIAEC VFTW+NLLVVVVEL+G + EA+DLV LVT++VLE+H LIVGVVVVVD G + +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  381 KVSAKIQQLLNTLKRPKRRPLPEFYEDNDIELEIAANTKDPNAPKPEGSTMTPVQGEQLSIPAGLPRTLECALQRYGTNSFKSPMATVLDPNGKVT-TTLTYGKLLSRAQKIAHALSTKIFSKGPEQVTLKPGDRVALVYPNNDPLSFITAWYGCMFRGLVPLPIELPLSSSDTPPQQVGFLLSSCGITVALTSEACLKGLPKSTTTGEIAKLKGWPRLQWFVTEH--LPKPPKEFNVGNLRADDSAAAYIEYT-TDKEGSVMGVTVTRAAMINHCRALTMACHYTEGETIVCVLDFKREVGLWHSVLTSVLNGMHVIFIPYALMKLRPSSWMQLITKHRASCCLVKSRDLHWGLLATKDHKDISLSSLRMLLVADGANPWSLSSCDQFLSVFQAKGLRSDAICPCASSSEVFTVSLRRPGRG---------SCGFSPSAT-------GRGVLSMAALSHGVVRVDSEDSLTSLTLQDCGQVMPAAQMVVVRSEGPPVLCKTDQVGEICVTSGSTSASYFGLDGMTNSTFKVQPLLEELEQPKDGNGTVNIISKPIGEDFYVRSGLLGF---LGPGGLVFVCGSRDGLMTVTGRKHNADDIIATVLAVEPMRFIYRGRIAVFSIKVLRDERVCVIAEQRPDCSEEESFQWMSRVLQAVDSIHQVGIYCLALVPPNHLPKTPLGGIHLCEARRRFLEGSLHPANVLMCPHTCVTNLPKPRELHQGVQTAAKLSSSSGCGITDTGVGPASVMVGNLVQGNRLAEAHGRDVGLAEDCERKPQLITGVLRWRANTSPDHIIFTLLNSKGAIAKTLTCSELHKRAEKIAALLQERGRIEPGDHVALIFPPGLDLLCAFYGCLYLGAIPITIRPPH-PQNLNTT----------------------------LPTVRMIVDVSKSGIVLSIQPIIKLLKSREAATSIDPKTWPPILDIDDNPKRKYAG---IATVSFDSSAYLDFSVSTCGRLSGVNITHRSLSSLCASLKLACELYPSRHVALCLDPYCGLGFVMWTLIGVYSGHHSILIAPYEVEANPSLWLSTLSQHRVRDTFCSYGVIELCTKALSNSIPSLKQRNIDLRCVRTCVVVAEERPRVQLTQQFCKLFQALGLNTRCVSTSFGCRVNPAICVQGASSAESAQVYVDMRALRNNRVALVERGAPNSLCVIESGKLLPGVKVIIANPETKGHCGDSHLGEIWVQAPHNANGYFTIYGDETDYNDHFNAKLVTGATSELYARTGYLGFLRRTECSQSASLLDETTPSVASRDSDTESLNSISQLQLNFSNVSLGGNSEHSLVGGASNANDQELHDAVYVVGAVDEVISLRGMNYHPIDIENSVMRCHK-KIAECAVFTWTNLLVVVVELDGNESEALDLVPLVTNTVLEDHQLIVGVVVVVDPGVVPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1773          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Fly
Match: DIP2 (gene:FBgn0024806 transcript:FBtr0332109)

HSP 1 Score: 1348.95 bits (3490), Expect = 0.000e+0
Identity = 733/1449 (50.59%), Postives = 953/1449 (65.77%), Query Frame = 3
Query: 1092 RVSEKIQQLVQTLKRPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEH--SLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPR-TTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPE-RLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPL--------DSCGN---IVDPNGPG-YVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSG------------------QVGPSAMMVGHLVQGNRLAWAQGRDISV----EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRV-TLTDGQN---MIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQS----------------------------------------------------DGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +VS KIQQL+ TLKRPKRRPLPE++++++  L +    +DPNAPKP+G+ + P  GE L++ +GLPR+LE ALQ Y     K  + + +D NG+V   +LTY KLL RA +IA+ L  K+  +G    +LKP DRVALV+ NNDP++FI A+YGC+   +VPL IE+PL   D   Q +GFLL+S  I + LTSE C K LP+ TT GEI    GWP++QW   +H    KP +++     R  D    YIEY+   K+GSV GVTV+R A + HCR L   C Y EGET+VCV + KRE GLWHSVLT++  G+HV+FIPYA++K+ P+ W++ IT+H+A+  +VKSRD+HW LLA K+H  I+LS LR+LLV+DG+NPWSL++CD F+S F+ KGLRS A+CPCA SSE  T+SLRRP  G         S G + S         GRGVLSM +LS+G+VRVDSE+SLTSLTLQDCGQ++P  + VV++  G P LC TD+VGE+C+ +  T + Y+GL G TN  FKVQPL        D  G    I  P G   YVRSGLLGF      GGL+F+CGS  GLMTV+GR+HNADDIIATVLAVEPM+ ++RGRIAVFSI +LRDER+ ++AE R   SEE +F+WMSRV+QAVDSIHQ  +YC+ LVP N+LPKTPLGGIH+ + +RRFLEG L   NVL+CPH  +TNLPKPR++  G                   VGP+++MVG+LVQGNRLA A GRD+ +    E + + I+ +L  RA  +P+  +F  LN++     + T S+L +RAE+IA  L E+ +I     +AL++ PG++L+CA Y C+  G IP+TI+PP  P  +N T                            L   R I++     IVL+   +IK++K++   T  D +    ++D DD PK++          S D  AY+DFS S  G   GV  TH +L  +C + KL CE YPSR V L LDPY GLGF +W L GVY GH S  + P  +E+ P LWL+  S  +VRDTFCSY  IEL TK L+NSIP+LKQR I L C+R+ V+VAEERPRVQ T  FCKLF  LGLN+R VSTSFGCRVN AIC+QGASS +++ VYVD  +LRN+RV L+E+G+P+SLC++ESGKLLPGV++ IA+PET G C DSHLGEIWV +P N++    +  D  +     + KL TG    +YARTGYLGF+RRTE +QS                                                    D E HDAV+VVGA++  I LRGM YHPIDIE++VMRCHK KIAEC VFTW+NLLVVVVEL+G + EA+DLV LVT++VLE+H LIVGVVVVVD G + +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  380 KVSAKIQQLLNTLKRPKRRPLPEFYEDNDIELEIAANTKDPNAPKPEGSTMTPVQGEQLSIPAGLPRTLECALQRYGTNSFKSPMATVLDPNGKVT-TTLTYGKLLSRAQKIAHALSTKIFSKGPEQVTLKPGDRVALVYPNNDPLSFITAWYGCMFRGLVPLPIELPLSSSDTPPQQVGFLLSSCGITVALTSEACLKGLPKSTTTGEIAKLKGWPRLQWFVTEH--LPKPPKEFNVGNLRADDSAAAYIEYT-TDKEGSVMGVTVTRAAMINHCRALTMACHYTEGETIVCVLDFKREVGLWHSVLTSVLNGMHVIFIPYALMKLRPSSWMQLITKHRASCCLVKSRDLHWGLLATKDHKDISLSSLRMLLVADGANPWSLSSCDQFLSVFQAKGLRSDAICPCASSSEVFTVSLRRPGRG---------SCGFSPSAT-------GRGVLSMAALSHGVVRVDSEDSLTSLTLQDCGQVMPAAQMVVVRSEGPPVLCKTDQVGEICVTSGSTSASYFGLDGMTNSTFKVQPLLEELEQPKDGNGTVNIISKPIGEDFYVRSGLLGF---LGPGGLVFVCGSRDGLMTVTGRKHNADDIIATVLAVEPMRFIYRGRIAVFSIKVLRDERVCVIAEQRPDCSEEESFQWMSRVLQAVDSIHQVGIYCLALVPPNHLPKTPLGGIHLCEARRRFLEGSLHPANVLMCPHTCVTNLPKPRELHQGVQTAAKLSSSSGCGITDTGVGPASVMVGNLVQGNRLAEAHGRDVGLAEDCERKPQLITGVLRWRANTSPDHIIFTLLNSKGAIAKTLTCSELHKRAEKIAALLQERGRIEPGDHVALIFPPGLDLLCAFYGCLYLGAIPITIRPPH-PQNLNTT----------------------------LPTVRMIVDVSKSGIVLSIQPIIKLLKSREAATSIDPKTWPPILDIDDNPKRKYAG---IATVSFDSSAYLDFSVSTCGRLSGVNITHRSLSSLCASLKLACELYPSRHVALCLDPYCGLGFVMWTLIGVYSGHHSILIAPYEVEANPSLWLSTLSQHRVRDTFCSYGVIELCTKALSNSIPSLKQRNIDLRCVRTCVVVAEERPRVQLTQQFCKLFQALGLNTRCVSTSFGCRVNPAICVQGASSAESAQVYVDMRALRNNRVALVERGAPNSLCVIESGKLLPGVKVIIANPETKGHCGDSHLGEIWVQAPHNANGYFTIYGDETDYNDHFNAKLVTGATSELYARTGYLGFLRRTECSQSASLLDETTPSVASRDSDTESLNSISQLQLNFSNVSLGGNSEHSLVGGASNANDQELHDAVYVVGAVDEVISLRGMNYHPIDIENSVMRCHK-KIAECAVFTWTNLLVVVVELDGNESEALDLVPLVTNTVLEDHQLIVGVVVVVDPGVVPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1772          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Fly
Match: DIP2 (gene:FBgn0024806 transcript:FBtr0332110)

HSP 1 Score: 1334.32 bits (3452), Expect = 0.000e+0
Identity = 730/1449 (50.38%), Postives = 948/1449 (65.42%), Query Frame = 3
Query: 1092 RVSEKIQQLVQTLKRPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEH--SLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPR-TTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPE-RLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPL--------DSCGN---IVDPNGPG-YVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSG------------------QVGPSAMMVGHLVQGNRLAWAQGRDISV----EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRV-TLTDGQN---MIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQS----------------------------------------------------DGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +VS KIQQL+ TLKRPKRRPLPE++++++  L +    +DPNAPKP+G+ + P  GE L++ +GLPR+LE ALQ Y     K  + + +D NG+V   +LTY KLL RA +IA+ L  K+  +G    +LKP DRVALV+ NNDP++FI A+YGC+   +VPL IE+PL   D   Q +GFLL+S  I + LTSE C K LP+ TT GEI    GWP++QW   +H    KP +++     R  D    YIEY+   K+GSV GVTV+R A + HCR L   C Y EGET+VCV + KRE GLWHSVLT++  G+HV+FIPYA++K+ P+ W++ IT+H+A+  +VKSRD+HW LLA K+H  I+LS LR+LLV+DG+NPWSL++CD F+S F+ KGLRS A+CPCA SSE  T+SLRRP  G         S G + S         GRGVLSM +LS+G+VRVDSE+SLTSLTLQDCGQ++P  + VV++  G P LC TD+VGE+C+ +  T + Y+GL G TN  FKVQPL        D  G    I  P G   YVRSGLLGF      GGL+F+CGS  GLMTV+GR+HNADDIIATVLAVEPM+ ++RGRIAVFSI +LRDER+ ++AE R   SEE +F+WMSRV+QAVDSIHQ  +YC+ LVP N+LPKTPLGGIH+ + +RRFLEG L   NVL+CPH  +TNLPKPR++  G                   VGP+++MVG+LVQGNRLA A GRD+ +    E + + I+ +L  RA  +P+  +F  LN++     + T S+L +RAE+IA  L E+ +I     +      G++L+CA Y C+  G IP+TI+PP  P  +N T                            L   R I++     IVL+   +IK++K++   T  D +    ++D DD PK++          S D  AY+DFS S  G   GV  TH +L  +C + KL CE YPSR V L LDPY GLGF +W L GVY GH S  + P  +E+ P LWL+  S  +VRDTFCSY  IEL TK L+NSIP+LKQR I L C+R+ V+VAEERPRVQ T  FCKLF  LGLN+R VSTSFGCRVN AIC+QGASS +++ VYVD  +LRN+RV L+E+G+P+SLC++ESGKLLPGV++ IA+PET G C DSHLGEIWV +P N++    +  D  +     + KL TG    +YARTGYLGF+RRTE +QS                                                    D E HDAV+VVGA++  I LRGM YHPIDIE++VMRCHK KIAEC VFTW+NLLVVVVEL+G + EA+DLV LVT++VLE+H LIVGVVVVVD G + +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  381 KVSAKIQQLLNTLKRPKRRPLPEFYEDNDIELEIAANTKDPNAPKPEGSTMTPVQGEQLSIPAGLPRTLECALQRYGTNSFKSPMATVLDPNGKVT-TTLTYGKLLSRAQKIAHALSTKIFSKGPEQVTLKPGDRVALVYPNNDPLSFITAWYGCMFRGLVPLPIELPLSSSDTPPQQVGFLLSSCGITVALTSEACLKGLPKSTTTGEIAKLKGWPRLQWFVTEH--LPKPPKEFNVGNLRADDSAAAYIEYT-TDKEGSVMGVTVTRAAMINHCRALTMACHYTEGETIVCVLDFKREVGLWHSVLTSVLNGMHVIFIPYALMKLRPSSWMQLITKHRASCCLVKSRDLHWGLLATKDHKDISLSSLRMLLVADGANPWSLSSCDQFLSVFQAKGLRSDAICPCASSSEVFTVSLRRPGRG---------SCGFSPSAT-------GRGVLSMAALSHGVVRVDSEDSLTSLTLQDCGQVMPAAQMVVVRSEGPPVLCKTDQVGEICVTSGSTSASYFGLDGMTNSTFKVQPLLEELEQPKDGNGTVNIISKPIGEDFYVRSGLLGF---LGPGGLVFVCGSRDGLMTVTGRKHNADDIIATVLAVEPMRFIYRGRIAVFSIKVLRDERVCVIAEQRPDCSEEESFQWMSRVLQAVDSIHQVGIYCLALVPPNHLPKTPLGGIHLCEARRRFLEGSLHPANVLMCPHTCVTNLPKPRELHQGVQTAAKLSSSSGCGITDTGVGPASVMVGNLVQGNRLAEAHGRDVGLAEDCERKPQLITGVLRWRANTSPDHIIFTLLNSKGAIAKTLTCSELHKRAEKIAALLQERGRIEPGDHV------GLDLLCAFYGCLYLGAIPITIRPPH-PQNLNTT----------------------------LPTVRMIVDVSKSGIVLSIQPIIKLLKSREAATSIDPKTWPPILDIDDNPKRKYAG---IATVSFDSSAYLDFSVSTCGRLSGVNITHRSLSSLCASLKLACELYPSRHVALCLDPYCGLGFVMWTLIGVYSGHHSILIAPYEVEANPSLWLSTLSQHRVRDTFCSYGVIELCTKALSNSIPSLKQRNIDLRCVRTCVVVAEERPRVQLTQQFCKLFQALGLNTRCVSTSFGCRVNPAICVQGASSAESAQVYVDMRALRNNRVALVERGAPNSLCVIESGKLLPGVKVIIANPETKGHCGDSHLGEIWVQAPHNANGYFTIYGDETDYNDHFNAKLVTGATSELYARTGYLGFLRRTECSQSASLLDETTPSVASRDSDTESLNSISQLQLNFSNVSLGGNSEHSLVGGASNANDQELHDAVYVVGAVDEVISLRGMNYHPIDIENSVMRCHK-KIAECAVFTWTNLLVVVVELDGNESEALDLVPLVTNTVLEDHQLIVGVVVVVDPGVVPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1767          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Zebrafish
Match: dip2a (disco-interacting protein 2 homolog A [Source:ZFIN;Acc:ZDB-GENE-091204-2])

HSP 1 Score: 1332.78 bits (3448), Expect = 0.000e+0
Identity = 687/1391 (49.39%), Postives = 937/1391 (67.36%), Query Frame = 3
Query: 1017 QTGSVNSLQTGGTNNGAVE--NGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRD-MPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT----ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            Q  SV  L  G T++  +E  +G+ V+SRVS KIQQL+ TLKRPKR PL E+F +D    +     DP  PKP+G  + P  G+   + S  P SL  +L  +     K   ++ +D+ G+    +LTY KL  R+ ++A+ LLNKL  R E  L+P DRVALVF NNDP+ F+ AFYGC++A +VP+ IEVPL R+DA  Q +GFLL S  + + LT++ C K LP+   GE+ +F GWP++ W   D     KP +DW PP R + +E  YIEY    K+GS  GVTVS  A L HC  L   C Y EGE +  V + KR+ GLWH VLT++   +HV+ IPY+++KV+P  W++++  +KA  A+VKSRDMHW+LLA+++   I+LS LR+L+V+DG+NPWS+++CD F++ F+ +GLR   +CPCA SSE +T+++RRP                    E+G   PG + VLSM  LSYG++RVD+E  L+ LT+QD GQ++PGG   VI+  G+PYLC TDEVGE+C+ +S TG  Y+GL G T   F+  P+ S G  +      + R+ LLGF+GP     L+F+ G + GLM VSGRRHNADD++AT LAVEPMK V+RGRIAVFS+ +L DERIV+VAE R   SEE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPK PLGGIH+ ++K+RFLEG L  CNVL+CPH  +TNLPKPR   P  +VGP++M+VG+LV G R+A A GRD++ ++E       +  +L  RA  TP+  LF  LN++   V++ +  QL +RAER+A  L+E+ ++ A   +ALLY PGI+L+   Y C+  GC+PVT++PP  P  +  T                            L   + I+       +LT  A++K++K++     V +     ++DTDDLP+KRL     Y+P S + +AY+DFS S  G+  GV+ +H+A   +C++ KLQCE YPSR++ + LDPY GLGF LWCL  VY GH S  VPP  LE+   LWL+A S  +VR TFCSYS +E+ TK L +   AL+ R ++L+C+R+ ++VAEERPR+  T +F K+F  LGL++RAVST+FGCRVN+A+CLQG + PD + VY+D  +LR+DRV+L+E+GSPHSL L+ESGK+LPGV++ IA+ ET G   DSHLGE+WVSSP N++    V  +        + +L+ G+   V+ARTGYLGF+RRTELT + GERHDA++VVGAL+ T+ LRGMRYHPIDIE++V+R HKS IAEC VFTW+NLLVVVVEL G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  248 QVASVRGLPRGYTHSSLMETADGVPVNSRVSSKIQQLLNTLKRPKRPPLREFFLDDFEELLDVQHPDPQQPKPEGGEMRPLSGDPPVVSSNRPSSLLGSLHRWGNTQAKSPCLTSLDNTGK-PLYTLTYGKLWTRSQKLAFTLLNKLSSRNEPLLRPGDRVALVFPNNDPVMFMVAFYGCLLAELVPVPIEVPLTRKDAGGQQVGFLLGSCGVTLALTTDACQKGLPKAQTGEVVTFKGWPRLLWFVTDGKHVVKPPKDWHPPIRDASNEIAYIEYK-TGKEGSTMGVTVSHSAMLAHCHALTQACGYTEGEVITNVLDFKRDAGLWHGVLTSVMNRMHVISIPYSLMKVNPLSWIQKVHTYKARVAVVKSRDMHWSLLAQRDQRDISLSSLRMLIVADGANPWSISSCDAFLNVFQSRGLRPEVICPCASSSEALTVAIRRPP-------------------ETGVPPPG-KAVLSMSGLSYGVIRVDTEEKLSVLTVQDAGQVMPGGLVCVIRVEGTPYLCRTDEVGEICVSSSTTGISYYGLPGMTKNVFETIPVTSSGAPISDRA--FTRTSLLGFIGP---DNLVFVVGKLDGLMVVSGRRHNADDVVATALAVEPMKFVYRGRIAVFSVSVLHDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKAPLGGIHISESKQRFLEGALHPCNVLMCPHTCVTNLPKPRQKQPGTEVGPASMIVGNLVAGKRIAQACGRDVT-QLEDHDQFLYLQDVLQWRAQATPDHPLFLLLNSKGTVVNTASCVQLHKRAERVALALMERGRLNAGDHVALLYPPGIDLIATFYGCLYAGCVPVTVRPPH-PQNLTTT----------------------------LPTVKMIVEVSKSVCILTTQAIMKLLKSKEAAAAVDIKAWPLILDTDDLPRKRL--PQIYKPPSPEMLAYLDFSVSTTGILAGVKMSHAATSALCRSIKLQCELYPSRQIAICLDPYCGLGFALWCLCSVYSGHQSILVPPLELETNASLWLSAVSQYKVRVTFCSYSVMEMCTKGLGSQTEALRLRNVNLSCVRTCMVVAEERPRITLTQSFSKIFKDLGLSTRAVSTTFGCRVNVAVCLQGTAGPDPTTVYLDMRALRHDRVRLVERGSPHSLPLMESGKILPGVKVIIANTETKGPLGDSHLGEVWVSSPHNATGYYTVYGEEALHADHFNTRLSFGDTQTVWARTGYLGFLRRTELTDASGERHDALYVVGALDETLELRGMRYHPIDIETSVIRSHKS-IAECAVFTWTNLLVVVVELEGSEQEALDLVALVTNVVLEEHYLIVGVVVVVDPGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1578          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Zebrafish
Match: dip2ca (disco-interacting protein 2 homolog Ca [Source:ZFIN;Acc:ZDB-GENE-031118-39])

HSP 1 Score: 1331.24 bits (3444), Expect = 0.000e+0
Identity = 714/1449 (49.28%), Postives = 950/1449 (65.56%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
             AS+S     +N  H  PPDVT++T      ++ V  E    S            + P  T    + +   T +G      VSSRVS KIQQLV TLK+P+R PL E+F +D    +     DPN P+P+G  + P  GE L +++  P SLE+ALQ +     K   ++ +D+NG+   + LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP+   GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E E +V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++K   A VKSRDMHWAL+A ++   INLS LR+L+V+DGSNPWS+++CD F++ F+ KGLR   +CPCA S+E +T+++RRPT     +DS                 P GRGVLSM  LSYG++RVDSE  L+ LT+QD G ++PG    V+KP G P LC TDE+GE+C+ +  TG  Y+GL G T   F+V P+   G  +      ++R+GLLGF+GP   GGL+FI G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIV+VAE R   +EE +F+WMSRV+QA+DSIH   V+C+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  +IE          +S++L  RA  TP+  LF  L++R   +SS T  QL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  +  T                            L   + I+     + V+T   + K++K++     V +     ++DTDDLPKK+      Y+P + D +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE  P LWL A S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV    N S    V  D        + +L+ G+   V+ARTGYLGF+RRTELT + GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HKS I EC VF W+NLLVVVVEL G + EA+DLV LVT++VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:   22 FASSSSSQTPEN--HSAPPDVTTYT-----SEHPVQVERPQVS------------TVPRTTPKYGNAELMETGDGVP----VSSRVSAKIQQLVNTLKQPRRPPLREFFVDDFEELLEVQQPDPNQPRPEGAQMVPIRGEPLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYV-LTYGKLWSRSIKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKGPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQSCGYTEAEIIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKGKVACVKSRDMHWALVAHRDQRDINLSSLRMLVVADGSNPWSISSCDAFLNVFQSKGLRPEVICPCASSAEALTVAIRRPT-----DDS---------------NQPPGRGVLSMQGLSYGVIRVDSEERLSVLTVQDVGTVMPGALMCVVKPEGVPQLCRTDEIGELCVCSIATGMSYYGLSGMTKNTFEVFPMTISGAPISEYP--FIRTGLLGFIGP---GGLVFISGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERIVVVAEQRPDSTEEDSFQWMSRVLQAIDSIHNVGVFCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QIEDNDQARKFLFLSEVLQWRAQTTPDHVLFTLLSSRGAVLSSLTCLQLHKRAEKIATMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNIATT----------------------------LPTVKMIVEVSRSACVMTTQIISKLLKSKEASAAVDVRTWPPVLDTDDLPKKK--PPQLYKPSNPDTLAYLDFSVSTTGMLAGVKMSHTATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELEVNPALWLLAVSQFRVRDTFCSYSVMELCTKGLGLQTESLKARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHCAHNGSGYFTVYGDEALQSDHFNSRLSFGDTQTVWARTGYLGFLRRTELTDASGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRTHKS-IMECAVFPWTNLLVVVVELEGSEQEALDLVPLVTNAVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1386          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Zebrafish
Match: dip2ca (disco-interacting protein 2 homolog Ca [Source:ZFIN;Acc:ZDB-GENE-031118-39])

HSP 1 Score: 1322.38 bits (3421), Expect = 0.000e+0
Identity = 710/1457 (48.73%), Postives = 944/1457 (64.79%), Query Frame = 3
Query:  882 HGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRD-------------------ISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICL----------QGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            H  PPDVT++T      ++ V  E    S            + P  T    + +   T +G      VSSRVS KIQQLV TLK+P+R PL E+F +D    +     DPN P+P+G  + P  GE L +++  P SLE+ALQ +     K   ++ +D+NG+   + LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP+   GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E E +V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++K   A VKSRDMHWAL+A ++   INLS LR+L+V+DGSNPWS+++CD F++ F+ KGLR   +CPCA S+E +T+++RRPT     +DS                 P GRGVLSM  LSYG++RVDSE  L+ LT+QD G ++PG    V+KP G P LC TDE+GE+C+ +  TG  Y+GL G T   F+V P+   G  +      ++R+GLLGF+GP   GGL+FI G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIV+VAE R   +EE +F+WMSRV+QA+DSIH   V+C+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD                   I++  E   +S++L  RA  TP+  LF  L++R   +SS T  QL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  +  T                            L   + I+     + V+T   + K++K++     V +     ++DTDDLPKK+      Y+P + D +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE  P LWL A S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICL          QG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV    N S    V  D        + +L+ G+   V+ARTGYLGF+RRTELT + GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HKS I EC VF W+NLLVVVVEL G + EA+DLV LVT++VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  202 HSAPPDVTTYT-----SEHPVQVERPQVS------------TVPRTTPKYGNAELMETGDGVP----VSSRVSAKIQQLVNTLKQPRRPPLREFFVDDFEELLEVQQPDPNQPRPEGAQMVPIRGEPLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYV-LTYGKLWSRSIKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKGPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQSCGYTEAEIIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKGKVACVKSRDMHWALVAHRDQRDINLSSLRMLVVADGSNPWSISSCDAFLNVFQSKGLRPEVICPCASSAEALTVAIRRPT-----DDS---------------NQPPGRGVLSMQGLSYGVIRVDSEERLSVLTVQDVGTVMPGALMCVVKPEGVPQLCRTDEIGELCVCSIATGMSYYGLSGMTKNTFEVFPMTISGAPISEYP--FIRTGLLGFIGP---GGLVFISGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERIVVVAEQRPDSTEEDSFQWMSRVLQAIDSIHNVGVFCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLGQIEDNDQARKILQTDVRITLGDEFLFLSEVLQWRAQTTPDHVLFTLLSSRGAVLSSLTCLQLHKRAEKIATMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNIATT----------------------------LPTVKMIVEVSRSACVMTTQIISKLLKSKEASAAVDVRTWPPVLDTDDLPKKK--PPQLYKPSNPDTLAYLDFSVSTTGMLAGVKMSHTATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELEVNPALWLLAVSQFRVRDTFCSYSVMELCTKGLGLQTESLKARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQPHRLGKLADQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHCAHNGSGYFTVYGDEALQSDHFNSRLSFGDTQTVWARTGYLGFLRRTELTDASGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRTHKS-IMECAVFPWTNLLVVVVELEGSEQEALDLVPLVTNAVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1577          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Zebrafish
Match: dip2ca (disco-interacting protein 2 homolog Ca [Source:ZFIN;Acc:ZDB-GENE-031118-39])

HSP 1 Score: 1321.61 bits (3419), Expect = 0.000e+0
Identity = 714/1459 (48.94%), Postives = 950/1459 (65.11%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICL----------QGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
             AS+S     +N  H  PPDVT++T      ++ V  E    S            + P  T    + +   T +G      VSSRVS KIQQLV TLK+P+R PL E+F +D    +     DPN P+P+G  + P  GE L +++  P SLE+ALQ +     K   ++ +D+NG+   + LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP+   GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E E +V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++K   A VKSRDMHWAL+A ++   INLS LR+L+V+DGSNPWS+++CD F++ F+ KGLR   +CPCA S+E +T+++RRPT     +DS                 P GRGVLSM  LSYG++RVDSE  L+ LT+QD G ++PG    V+KP G P LC TDE+GE+C+ +  TG  Y+GL G T   F+V P+   G  +      ++R+GLLGF+GP   GGL+FI G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIV+VAE R   +EE +F+WMSRV+QA+DSIH   V+C+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  +IE          +S++L  RA  TP+  LF  L++R   +SS T  QL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  +  T                            L   + I+     + V+T   + K++K++     V +     ++DTDDLPKK+      Y+P + D +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE  P LWL A S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICL          QG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV    N S    V  D        + +L+ G+   V+ARTGYLGF+RRTELT + GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HKS I EC VF W+NLLVVVVEL G + EA+DLV LVT++VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:   69 FASSSSSQTPEN--HSAPPDVTTYT-----SEHPVQVERPQVS------------TVPRTTPKYGNAELMETGDGVP----VSSRVSAKIQQLVNTLKQPRRPPLREFFVDDFEELLEVQQPDPNQPRPEGAQMVPIRGEPLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYV-LTYGKLWSRSIKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKGPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQSCGYTEAEIIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKGKVACVKSRDMHWALVAHRDQRDINLSSLRMLVVADGSNPWSISSCDAFLNVFQSKGLRPEVICPCASSAEALTVAIRRPT-----DDS---------------NQPPGRGVLSMQGLSYGVIRVDSEERLSVLTVQDVGTVMPGALMCVVKPEGVPQLCRTDEIGELCVCSIATGMSYYGLSGMTKNTFEVFPMTISGAPISEYP--FIRTGLLGFIGP---GGLVFISGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERIVVVAEQRPDSTEEDSFQWMSRVLQAIDSIHNVGVFCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QIEDNDQARKFLFLSEVLQWRAQTTPDHVLFTLLSSRGAVLSSLTCLQLHKRAEKIATMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNIATT----------------------------LPTVKMIVEVSRSACVMTTQIISKLLKSKEASAAVDVRTWPPVLDTDDLPKKK--PPQLYKPSNPDTLAYLDFSVSTTGMLAGVKMSHTATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELEVNPALWLLAVSQFRVRDTFCSYSVMELCTKGLGLQTESLKARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQPHRLGKLADQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHCAHNGSGYFTVYGDEALQSDHFNSRLSFGDTQTVWARTGYLGFLRRTELTDASGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRTHKS-IMECAVFPWTNLLVVVVELEGSEQEALDLVPLVTNAVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1443          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Zebrafish
Match: dip2a (disco-interacting protein 2 homolog A [Source:ZFIN;Acc:ZDB-GENE-091204-2])

HSP 1 Score: 1316.98 bits (3407), Expect = 0.000e+0
Identity = 687/1423 (48.28%), Postives = 937/1423 (65.85%), Query Frame = 3
Query: 1017 QTGSVNSLQTGGTNNGAVE--NGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRD-MPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT----ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALK--------------------------------QRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            Q  SV  L  G T++  +E  +G+ V+SRVS KIQQL+ TLKRPKR PL E+F +D    +     DP  PKP+G  + P  G+   + S  P SL  +L  +     K   ++ +D+ G+    +LTY KL  R+ ++A+ LLNKL  R E  L+P DRVALVF NNDP+ F+ AFYGC++A +VP+ IEVPL R+DA  Q +GFLL S  + + LT++ C K LP+   GE+ +F GWP++ W   D     KP +DW PP R + +E  YIEY    K+GS  GVTVS  A L HC  L   C Y EGE +  V + KR+ GLWH VLT++   +HV+ IPY+++KV+P  W++++  +KA  A+VKSRDMHW+LLA+++   I+LS LR+L+V+DG+NPWS+++CD F++ F+ +GLR   +CPCA SSE +T+++RRP                    E+G   PG + VLSM  LSYG++RVD+E  L+ LT+QD GQ++PGG   VI+  G+PYLC TDEVGE+C+ +S TG  Y+GL G T   F+  P+ S G  +      + R+ LLGF+GP     L+F+ G + GLM VSGRRHNADD++AT LAVEPMK V+RGRIAVFS+ +L DERIV+VAE R   SEE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPK PLGGIH+ ++K+RFLEG L  CNVL+CPH  +TNLPKPR   P  +VGP++M+VG+LV G R+A A GRD++ ++E       +  +L  RA  TP+  LF  LN++   V++ +  QL +RAER+A  L+E+ ++ A   +ALLY PGI+L+   Y C+  GC+PVT++PP  P  +  T                            L   + I+       +LT  A++K++K++     V +     ++DTDDLP+KRL     Y+P S + +AY+DFS S  G+  GV+ +H+A   +C++ KLQCE YPSR++ + LDPY GLGF LWCL  VY GH S  VPP  LE+   LWL+A S  +VR TFCSYS +E+ TK L +   AL+                                 R ++L+C+R+ ++VAEERPR+  T +F K+F  LGL++RAVST+FGCRVN+A+CLQG + PD + VY+D  +LR+DRV+L+E+GSPHSL L+ESGK+LPGV++ IA+ ET G   DSHLGE+WVSSP N++    V  +        + +L+ G+   V+ARTGYLGF+RRTELT + GERHDA++VVGAL+ T+ LRGMRYHPIDIE++V+R HKS IAEC VFTW+NLLVVVVEL G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  248 QVASVRGLPRGYTHSSLMETADGVPVNSRVSSKIQQLLNTLKRPKRPPLREFFLDDFEELLDVQHPDPQQPKPEGGEMRPLSGDPPVVSSNRPSSLLGSLHRWGNTQAKSPCLTSLDNTGK-PLYTLTYGKLWTRSQKLAFTLLNKLSSRNEPLLRPGDRVALVFPNNDPVMFMVAFYGCLLAELVPVPIEVPLTRKDAGGQQVGFLLGSCGVTLALTTDACQKGLPKAQTGEVVTFKGWPRLLWFVTDGKHVVKPPKDWHPPIRDASNEIAYIEYK-TGKEGSTMGVTVSHSAMLAHCHALTQACGYTEGEVITNVLDFKRDAGLWHGVLTSVMNRMHVISIPYSLMKVNPLSWIQKVHTYKARVAVVKSRDMHWSLLAQRDQRDISLSSLRMLIVADGANPWSISSCDAFLNVFQSRGLRPEVICPCASSSEALTVAIRRPP-------------------ETGVPPPG-KAVLSMSGLSYGVIRVDTEEKLSVLTVQDAGQVMPGGLVCVIRVEGTPYLCRTDEVGEICVSSSTTGISYYGLPGMTKNVFETIPVTSSGAPISDRA--FTRTSLLGFIGP---DNLVFVVGKLDGLMVVSGRRHNADDVVATALAVEPMKFVYRGRIAVFSVSVLHDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKAPLGGIHISESKQRFLEGALHPCNVLMCPHTCVTNLPKPRQKQPGTEVGPASMIVGNLVAGKRIAQACGRDVT-QLEDHDQFLYLQDVLQWRAQATPDHPLFLLLNSKGTVVNTASCVQLHKRAERVALALMERGRLNAGDHVALLYPPGIDLIATFYGCLYAGCVPVTVRPPH-PQNLTTT----------------------------LPTVKMIVEVSKSVCILTTQAIMKLLKSKEAAAAVDIKAWPLILDTDDLPRKRL--PQIYKPPSPEMLAYLDFSVSTTGILAGVKMSHAATSALCRSIKLQCELYPSRQIAICLDPYCGLGFALWCLCSVYSGHQSILVPPLELETNASLWLSAVSQYKVRVTFCSYSVMEMCTKGLGSQTEALRVSATLTHTYSNLTLPFHCICLCKCVCVCVCVQLRNVNLSCVRTCMVVAEERPRITLTQSFSKIFKDLGLSTRAVSTTFGCRVNVAVCLQGTAGPDPTTVYLDMRALRHDRVRLVERGSPHSLPLMESGKILPGVKVIIANTETKGPLGDSHLGEVWVSSPHNATGYYTVYGEEALHADHFNTRLSFGDTQTVWARTGYLGFLRRTELTDASGERHDALYVVGALDETLELRGMRYHPIDIETSVIRSHKS-IAECAVFTWTNLLVVVVELEGSEQEALDLVALVTNVVLEEHYLIVGVVVVVDPGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1610          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Xenopus
Match: dip2c (disco interacting protein 2 homolog C [Source:NCBI gene;Acc:780066])

HSP 1 Score: 1345.49 bits (3481), Expect = 0.000e+0
Identity = 715/1450 (49.31%), Postives = 959/1450 (66.14%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +A    Q+  +N  H  PPDVT++T      ++S+  E    S    +           + G+   ++TG        +G+ VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PK +G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   INLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSM  L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GPA   GL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  ++E          +S++L  RA  TP+  L+  LN+R    SS T SQL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  +  T                            L   + I+     + ++T   + K+++++     V +     ++DTDDLPKKR      Y+P   + +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE  P LWL A S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        S +L+ G+   V+ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HK  + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ +LEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  189 LADVMAQTHIEN--HSAPPDVTTYT-----SEHSIQVERPQGSTSSRVA---------PKYGNAELMETG--------DGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKAEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMQGLTYGVIRVDSEEKLSVLTVQDVGTVMPGAIMCSVKPDGIPQLCRTDEIGELCVCALATGTSYYGLSGMTKNTFEVFPMMSSGAPISEYP--FIRTGLLGFIGPA---GLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVNVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QMEDNDQARKFLFLSEVLQWRAQTTPDHVLYTLLNSRGTIASSLTCSQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNIATT----------------------------LPTVKMIVEVSRSACLMTTQLICKLLRSREASAAVDIRTWPPILDTDDLPKKR--PSQIYKPSDPEILAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELEINPALWLLAVSQYKVRDTFCSYSVMELCTKGLGLQTESLKARGLDLSRVRTCVVVAEERPRISLTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFSSRLSFGDTQTVWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKC-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVILEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1553          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Xenopus
Match: dip2c (disco interacting protein 2 homolog C [Source:NCBI gene;Acc:780066])

HSP 1 Score: 1343.56 bits (3476), Expect = 0.000e+0
Identity = 715/1454 (49.17%), Postives = 959/1454 (65.96%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-----------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +A    Q+  +N  H  PPDVT++T      ++S+  E    S    +           + G+   ++TG        +G+ VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PK +G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   INLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSM  L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GPA   GL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  ++E              +S++L  RA  TP+  L+  LN+R    SS T SQL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  +  T                            L   + I+     + ++T   + K+++++     V +     ++DTDDLPKKR      Y+P   + +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE  P LWL A S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        S +L+ G+   V+ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HK  + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ +LEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  215 LADVMAQTHIEN--HSAPPDVTTYT-----SEHSIQVERPQGSTSSRVA---------PKYGNAELMETG--------DGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKAEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMQGLTYGVIRVDSEEKLSVLTVQDVGTVMPGAIMCSVKPDGIPQLCRTDEIGELCVCALATGTSYYGLSGMTKNTFEVFPMMSSGAPISEYP--FIRTGLLGFIGPA---GLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVNVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QMEDNDQARKVLRQFLFLSEVLQWRAQTTPDHVLYTLLNSRGTIASSLTCSQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNIATT----------------------------LPTVKMIVEVSRSACLMTTQLICKLLRSREASAAVDIRTWPPILDTDDLPKKR--PSQIYKPSDPEILAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELEINPALWLLAVSQYKVRDTFCSYSVMELCTKGLGLQTESLKARGLDLSRVRTCVVVAEERPRISLTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFSSRLSFGDTQTVWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKC-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVILEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1583          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Xenopus
Match: dip2c (disco interacting protein 2 homolog C [Source:NCBI gene;Acc:780066])

HSP 1 Score: 1343.56 bits (3476), Expect = 0.000e+0
Identity = 715/1454 (49.17%), Postives = 959/1454 (65.96%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-----------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +A    Q+  +N  H  PPDVT++T      ++S+  E    S    +           + G+   ++TG        +G+ VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PK +G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   INLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSM  L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GPA   GL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  ++E              +S++L  RA  TP+  L+  LN+R    SS T SQL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  +  T                            L   + I+     + ++T   + K+++++     V +     ++DTDDLPKKR      Y+P   + +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE  P LWL A S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        S +L+ G+   V+ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HK  + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ +LEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  139 LADVMAQTHIEN--HSAPPDVTTYT-----SEHSIQVERPQGSTSSRVA---------PKYGNAELMETG--------DGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKAEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMQGLTYGVIRVDSEEKLSVLTVQDVGTVMPGAIMCSVKPDGIPQLCRTDEIGELCVCALATGTSYYGLSGMTKNTFEVFPMMSSGAPISEYP--FIRTGLLGFIGPA---GLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVNVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QMEDNDQARKVLRQFLFLSEVLQWRAQTTPDHVLYTLLNSRGTIASSLTCSQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNIATT----------------------------LPTVKMIVEVSRSACLMTTQLICKLLRSREASAAVDIRTWPPILDTDDLPKKR--PSQIYKPSDPEILAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELEINPALWLLAVSQYKVRDTFCSYSVMELCTKGLGLQTESLKARGLDLSRVRTCVVVAEERPRISLTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFSSRLSFGDTQTVWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKC-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVILEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1507          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Xenopus
Match: dip2c (disco interacting protein 2 homolog C [Source:NCBI gene;Acc:780066])

HSP 1 Score: 1323.92 bits (3425), Expect = 0.000e+0
Identity = 695/1381 (50.33%), Postives = 925/1381 (66.98%), Query Frame = 3
Query: 1083 VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGE---------TLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDIS-----------VEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PK +G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y EG+         T   +  L ++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   INLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSM  L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GPA   GL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+            +++    +S++L  RA  TP+  L+  LN+R    SS T SQL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  +  T                            L   + I+     + ++T   + K+++++     V +     ++DTDDLPKKR      Y+P   + +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE  P LWL A S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        S +L+ G+   V+ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HK  + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ +LEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  170 VSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKAEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQACGYTEGKLCYLPDPSLTDNSIFSLIKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMQGLTYGVIRVDSEEKLSVLTVQDVGTVMPGAIMCSVKPDGIPQLCRTDEIGELCVCALATGTSYYGLSGMTKNTFEVFPMMSSGAPISEYP--FIRTGLLGFIGPA---GLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVNVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLGQMEDNDQARKPLQLSFLFLSEVLQWRAQTTPDHVLYTLLNSRGTIASSLTCSQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNIATT----------------------------LPTVKMIVEVSRSACLMTTQLICKLLRSREASAAVDIRTWPPILDTDDLPKKR--PSQIYKPSDPEILAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELEINPALWLLAVSQYKVRDTFCSYSVMELCTKGLGLQTESLKARGLDLSRVRTCVVVAEERPRISLTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFSSRLSFGDTQTVWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKC-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVILEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1490          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Xenopus
Match: dip2c (disco interacting protein 2 homolog C [Source:NCBI gene;Acc:780066])

HSP 1 Score: 1323.15 bits (3423), Expect = 0.000e+0
Identity = 696/1377 (50.54%), Postives = 926/1377 (67.25%), Query Frame = 3
Query: 1083 VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAE---------GETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PK +G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C  +           ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   INLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSM  L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GPA   GL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  ++E          +S++L  RA  TP+  L+  LN+R    SS T SQL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  +  T                            L   + I+     + ++T   + K+++++     V +     ++DTDDLPKKR      Y+P   + +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE  P LWL A S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        S +L+ G+   V+ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HK  + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ +LEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  187 VSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKAEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQYCSGSLTDNSIFSLIAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMQGLTYGVIRVDSEEKLSVLTVQDVGTVMPGAIMCSVKPDGIPQLCRTDEIGELCVCALATGTSYYGLSGMTKNTFEVFPMMSSGAPISEYP--FIRTGLLGFIGPA---GLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVNVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QMEDNDQARKFLFLSEVLQWRAQTTPDHVLYTLLNSRGTIASSLTCSQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNIATT----------------------------LPTVKMIVEVSRSACLMTTQLICKLLRSREASAAVDIRTWPPILDTDDLPKKR--PSQIYKPSDPEILAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELEINPALWLLAVSQYKVRDTFCSYSVMELCTKGLGLQTESLKARGLDLSRVRTCVVVAEERPRISLTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFSSRLSFGDTQTVWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKC-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVILEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1502          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Mouse
Match: Dip2c (disco interacting protein 2 homolog C [Source:MGI Symbol;Acc:MGI:1920179])

HSP 1 Score: 1354.73 bits (3505), Expect = 0.000e+0
Identity = 724/1450 (49.93%), Postives = 965/1450 (66.55%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQT----GSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +A    Q+  +N  H  PPDVT++T      ++S+  E             R   S  S+T    G+   ++TG        +G+ VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PKP+G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   +NLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSMH L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GP   GGL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  +IE          +S++L  RA  TP+  L+  LN R    +S T  QL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP       +  N  +TL                 V   +E +R   +AC  +  L C  +     A  V +     ++DTDDLPKKR      Y+P + D +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE+ P LWL A S  +VRDTFCSYS +EL TK L +   +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        + +L+ G+   ++ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HKS + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  192 LADVMAQTHIEN--HSAPPDVTTYT-----SEHSIQVE-------------RPQGSTTSRTAPKYGNAELMETG--------DGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKPEGAQMLATRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDVNLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMHGLTYGVIRVDSEEKLSVLTVQDVGLVMPGAIMCSVKPDGIPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEYP--FIRTGLLGFVGP---GGLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QIEDNDQARKFLFLSEVLQWRAQTTPDHLLYTLLNCRGTIANSLTCVQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPP-------HPQNIATTLP---------------TVKMIVEVSR---SACLMTTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKKR--PAQIYKPSNPDTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLKARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFNSRLSFGDTQTIWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKS-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1556          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Mouse
Match: Dip2c (disco interacting protein 2 homolog C [Source:MGI Symbol;Acc:MGI:1920179])

HSP 1 Score: 1349.34 bits (3491), Expect = 0.000e+0
Identity = 722/1450 (49.79%), Postives = 963/1450 (66.41%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQT----GSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +A    Q+  +N  H  PPDVT++T      ++S+  E             R   S  S+T    G+   ++TG        +G+ VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PKP+G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   +NLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RR   GYG                    +  GRGVLSMH L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GP   GGL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  +IE          +S++L  RA  TP+  L+  LN R    +S T  QL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP       +  N  +TL                 V   +E +R   +AC  +  L C  +     A  V +     ++DTDDLPKKR      Y+P + D +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE+ P LWL A S  +VRDTFCSYS +EL TK L +   +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        + +L+ G+   ++ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HKS + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  192 LADVMAQTHIEN--HSAPPDVTTYT-----SEHSIQVE-------------RPQGSTTSRTAPKYGNAELMETG--------DGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKPEGAQMLATRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDVNLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRR--RGYG-----------------RLGNHSGRGVLSMHGLTYGVIRVDSEEKLSVLTVQDVGLVMPGAIMCSVKPDGIPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEYP--FIRTGLLGFVGP---GGLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QIEDNDQARKFLFLSEVLQWRAQTTPDHLLYTLLNCRGTIANSLTCVQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPP-------HPQNIATTLP---------------TVKMIVEVSR---SACLMTTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKKR--PAQIYKPSNPDTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLKARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFNSRLSFGDTQTIWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKS-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1557          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Mouse
Match: Dip2b (disco interacting protein 2 homolog B [Source:MGI Symbol;Acc:MGI:2145977])

HSP 1 Score: 1316.6 bits (3406), Expect = 0.000e+0
Identity = 692/1370 (50.51%), Postives = 928/1370 (67.74%), Query Frame = 3
Query: 1083 VSSRVSEKIQQLVQTLKRPKRRPLPEYFQED-ENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIES-------KTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIK----AQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAK-KQLSMKLATGE-IDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            V+SRVS KIQQL+ TLKRPKR PL E+F +D E +       DPN PKP+G  + P  GE L ++   P +LESALQ +     K   ++ +D  G+    +LTY KL  R+ ++AY LLNKLG + E  LKP DRVALV+ NNDP+ F+ AFYGC++A V+P+ IEVPL R+DA  Q +GFLL S  I + LTSE+C K LP+T NGEI  F GWP+++W+  D    SKP +DWQP    +  E  YIEY   +K+GSV GVTVSR A L  C+ L+  C Y+EGET+V V + K++ GLWH +   +   +H + +PY+V+K  P  W++++  HKA  A+VK RD+HWA++A ++   ++LS LR+L+V+DG+NPWS+++CD F+S F+  GL+  A+CPCA S+E MT+++RRP    GV                G   PG R +LSM+ LSYG++RV++E+  ++LT+QD G ++PGG   ++KP+G P LC TDE+GE+C+ +   G  Y+GL G T   F+V P+ S G+ V  + P ++RSGLLGF+GP   G L+F+ G + GL+ VSGRRHNADDI+AT LAVE +K V+RGRIAVFS+ +  DERIV+VAE R   SEE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+  TK+ FLEG L  CN+L+CPH  +TNLPKPR    G VGP+++MVG+LV G R+A A GRD+  +IE        + +++IL  RA  TP+  LF  LN +   V + +  QL +RAERIA  L +K  + A   + LLY PGIEL+ A Y C+  GCIPVT++PP           QN T                    +TL   R +++    + VLT   +++++K    A  V +     +IDTDDLP+KRL     Y+P + + +AY+DFS S  G+  GV+ +HSA+  +C+A KLQCE Y SR++ + LDPY GLGF LWCL  VY GH S  +PP  LE+   LWL   +  ++RDTFCSYS +EL TK L N +  LK RGI+L+C+R+ V+VAEERPRV    +F KLF  +GL+ RAVST+FG RVN+AICLQG S PD + VYVD  SLR+DRV+L+E+G+P SL L ESGK+LPGV++ I +PET G   DSHLGEIWV+SP  +S      D+   +    + +L+ G+    ++ARTGYLGFVRRTELT + GERHDA++VVGAL+ T+ LRG+RYHPIDIE++V R H+S IAEC VFTW+NLLVVVVEL G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G + +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  266 VNSRVSTKIQQLLNTLKRPKRPPLKEFFVDDSEEIVEGIPQPDPNQPKPEGRQMTPVKGEPLGVICNWPPALESALQRWGSTQAKCPCLTGLDVTGK-PVYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPGDRVALVYPNNDPVMFMVAFYGCLLAEVIPVPIEVPLTRKDAGGQQIGFLLGSCGIALALTSEICLKGLPKTQNGEIVQFKGWPRLKWVVTDSKYLSKPPKDWQPHISPAGTEPAYIEYK-TSKEGSVMGVTVSRLAMLSQCQALSQACNYSEGETVVNVLDFKKDAGLWHGMFANVMNKMHTISVPYSVMKTCPLSWVQRVHAHKAKVALVKCRDLHWAMMAHRDQRDVSLSSLRMLIVTDGANPWSVSSCDAFLSLFQSHGLKPEAICPCATSAEAMTVAIRRP----GV---------------PGAPLPG-RAILSMNGLSYGVIRVNTEDKNSALTVQDVGHVMPGGMMCIVKPDGLPQLCRTDEIGEICVSSRTGGMMYFGLAGVTKNTFEVIPVTSSGSPVG-DVP-FIRSGLLGFVGP---GSLVFVVGKMDGLLMVSGRRHNADDIVATGLAVESIKTVYRGRIAVFSVSVFYDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHISQTKQLFLEGSLHPCNILMCPHTCVTNLPKPRQKQPG-VGPASVMVGNLVAGKRIAQAAGRDLG-QIEENDLVRKHQFLAEILQWRAQATPDHVLFMLLNAKGTTVCTASCLQLHKRAERIASVLGDKGHLNAGDNVVLLYPPGIELIAAFYGCLYAGCIPVTVRPPHA---------QNLT--------------------ATLPTVRMVVDVSKAACVLTTQTLMRLLKSREAAAAVDVKTWPAIIDTDDLPRKRL--PQLYKPPTPEMLAYLDFSVSTTGMLTGVKMSHSAVNALCRAIKLQCELYSSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLIPPMELENNLFLWLATVNQYKIRDTFCSYSVMELCTKGLGNQVEVLKTRGINLSCIRTCVVVAEERPRVSLQQSFSKLFKDIGLSPRAVSTTFGSRVNVAICLQGTSGPDPTTVYVDLKSLRHDRVRLVERGAPQSLLLSESGKILPGVKVVIVNPETKGPVGDSHLGEIWVNSPHTASGYYTIYDSETLQADHFNTRLSFGDAAQTLWARTGYLGFVRRTELTAATGERHDALYVVGALDETLELRGLRYHPIDIETSVSRVHRS-IAECAVFTWTNLLVVVVELCGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDPGVVPINSRGEKQRMHLRDSFLADQLDPIYVAYNM 1574          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Mouse
Match: Dip2b (disco interacting protein 2 homolog B [Source:MGI Symbol;Acc:MGI:2145977])

HSP 1 Score: 1311.59 bits (3393), Expect = 0.000e+0
Identity = 692/1369 (50.55%), Postives = 927/1369 (67.71%), Query Frame = 3
Query: 1083 VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIES-------KTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIK----AQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAK-KQLSMKLATGE-IDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            V+SRVS KIQQL+ TLKRPKR PL E+F +D    V     DPN PKP+G  + P  GE L ++   P +LESALQ +     K   ++ +D  G+    +LTY KL  R+ ++AY LLNKLG + E  LKP DRVALV+ NNDP+ F+ AFYGC++A V+P+ IEVPL R+DA  Q +GFLL S  I + LTSE+C K LP+T NGEI  F GWP+++W+  D    SKP +DWQP    +  E  YIEY   +K+GSV GVTVSR A L  C+ L+  C Y+EGET+V V + K++ GLWH +   +   +H + +PY+V+K  P  W++++  HKA  A+VK RD+HWA++A ++   ++LS LR+L+V+DG+NPWS+++CD F+S F+  GL+  A+CPCA S+E MT+++RRP    GV                G   PG R +LSM+ LSYG++RV++E+  ++LT+QD G ++PGG   ++KP+G P LC TDE+GE+C+ +   G  Y+GL G T   F+V P+ S G+ V  + P ++RSGLLGF+GP   G L+F+ G + GL+ VSGRRHNADDI+AT LAVE +K V+RGRIAVFS+ +  DERIV+VAE R   SEE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+  TK+ FLEG L  CN+L+CPH  +TNLPKPR    G VGP+++MVG+LV G R+A A GRD+  +IE        + +++IL  RA  TP+  LF  LN +   V + +  QL +RAERIA  L +K  + A   + LLY PGIEL+ A Y C+  GCIPVT++PP           QN T                    +TL   R +++    + VLT   +++++K    A  V +     +IDTDDLP+KRL     Y+P + + +AY+DFS S  G+  GV+ +HSA+  +C+A KLQCE Y SR++ + LDPY GLGF LWCL  VY GH S  +PP  LE+   LWL   +  ++RDTFCSYS +EL TK L N +  LK RGI+L+C+R+ V+VAEERPRV    +F KLF  +GL+ RAVST+FG RVN+AICLQG S PD + VYVD  SLR+DRV+L+E+G+P SL L ESGK+LPGV++ I +PET G   DSHLGEIWV+SP  +S      D+   +    + +L+ G+    ++ARTGYLGFVRRTELT + GERHDA++VVGAL+ T+ LRG+RYHPIDIE++V R H+S IAEC VFTW+NLLVVVVEL G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G + +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:   33 VNSRVSTKIQQLLNTLKRPKRPPLKEFFVDDSEEIVEVPQPDPNQPKPEGRQMTPVKGEPLGVICNWPPALESALQRWGSTQAKCPCLTGLDVTGK-PVYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPGDRVALVYPNNDPVMFMVAFYGCLLAEVIPVPIEVPLTRKDAGGQQIGFLLGSCGIALALTSEICLKGLPKTQNGEIVQFKGWPRLKWVVTDSKYLSKPPKDWQPHISPAGTEPAYIEYK-TSKEGSVMGVTVSRLAMLSQCQALSQACNYSEGETVVNVLDFKKDAGLWHGMFANVMNKMHTISVPYSVMKTCPLSWVQRVHAHKAKVALVKCRDLHWAMMAHRDQRDVSLSSLRMLIVTDGANPWSVSSCDAFLSLFQSHGLKPEAICPCATSAEAMTVAIRRP----GV---------------PGAPLPG-RAILSMNGLSYGVIRVNTEDKNSALTVQDVGHVMPGGMMCIVKPDGLPQLCRTDEIGEICVSSRTGGMMYFGLAGVTKNTFEVIPVTSSGSPVG-DVP-FIRSGLLGFVGP---GSLVFVVGKMDGLLMVSGRRHNADDIVATGLAVESIKTVYRGRIAVFSVSVFYDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHISQTKQLFLEGSLHPCNILMCPHTCVTNLPKPRQKQPG-VGPASVMVGNLVAGKRIAQAAGRDLG-QIEENDLVRKHQFLAEILQWRAQATPDHVLFMLLNAKGTTVCTASCLQLHKRAERIASVLGDKGHLNAGDNVVLLYPPGIELIAAFYGCLYAGCIPVTVRPPHA---------QNLT--------------------ATLPTVRMVVDVSKAACVLTTQTLMRLLKSREAAAAVDVKTWPAIIDTDDLPRKRL--PQLYKPPTPEMLAYLDFSVSTTGMLTGVKMSHSAVNALCRAIKLQCELYSSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLIPPMELENNLFLWLATVNQYKIRDTFCSYSVMELCTKGLGNQVEVLKTRGINLSCIRTCVVVAEERPRVSLQQSFSKLFKDIGLSPRAVSTTFGSRVNVAICLQGTSGPDPTTVYVDLKSLRHDRVRLVERGAPQSLLLSESGKILPGVKVVIVNPETKGPVGDSHLGEIWVNSPHTASGYYTIYDSETLQADHFNTRLSFGDAAQTLWARTGYLGFVRRTELTAATGERHDALYVVGALDETLELRGLRYHPIDIETSVSRVHRS-IAECAVFTWTNLLVVVVELCGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDPGVVPINSRGEKQRMHLRDSFLADQLDPIYVAYNM 1340          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Mouse
Match: Dip2a (disco interacting protein 2 homolog A [Source:MGI Symbol;Acc:MGI:2385920])

HSP 1 Score: 1310.43 bits (3390), Expect = 0.000e+0
Identity = 679/1391 (48.81%), Postives = 933/1391 (67.07%), Query Frame = 3
Query: 1017 QTGSVNSLQTG-GTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            Q  SV  +  G G N     +G+ V+SRVS KIQQL+ TLKRPKR PL E+F +D    +     DPN PKP+G  +    GE L++ +  P SL +ALQ +     K   ++ +D+ G+    +LTY KL  R+ ++AY LLNKL  + E  L P DRVALVF N+DP+ F+ AFYGC++A +VP+ IEVPL R+DA  Q +GFLL S  + + LT++ C K LP+   GE+ +F GWP + W+ ID    ++P +DW P  + +     YIEY   +K+GS  GVTVS  + L  C+ L   C Y E ETL  V + KR+ GLWH VLT++   +HV+ IPYA++KV+P  W++++  +KA AA+VKSRDMHW+LLA++    + LS LR+L+V+DG+NPWS+++CD F++ F+ +GLR   +CPCA S E +T+++RRP    G                     P  + VLSM+ LSYG++RVD+E  L+ LT+QD GQ++PG    V+K +G+PYLC TDE+GE+C+ +  TG+ Y+GL G T   F+  P+ + G  V  + P + R+GLLGF+GP     L+F+ G + GLM V  RRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L D+RIV+VAE R   SEE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPK PLGGIH+ +TK+RFLEG L  CNVL+CPH  +TNLPKPR     +VGP++M+VG+LV G R+A A GR+++   +S        ++ +L  RA  TP+  LF  LN +    S+ T  QL +RAER+A  L+EK ++ A   +AL+Y PG++L+ A Y C+ CGC+PVT++PP  P  +  T                            L   + I+     + VL+  A+ +++K++     V +     ++DTDD+PKK++ S   +RP S D +AY+DFS S  G+  GV+ +H+A   +C++ KLQCE YPSR++ + LDPY GLGF LWCL  VY GH S  VPP  LES   LWL+A S  + R TFCSYS +E+ TK L     AL+ +G++L+C+R+ ++VAEERPR+  T +F KLF  LGL +RAVST+FGCRVN+AICLQG + PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGV++ IAH ET G   DSHLGEIWVSSP N++    V  +        S +L+ G+   ++ARTGYLGF+RRTELT + GERHDA++VVG+L+ T+ LRGMRYHPIDIE++V+R H+S IAEC VFTW+NLLVVVVEL+G + +A+DLV LVT+ VLEEHYL+VGVVV+VD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  193 QMASVRGIPRGHGRNVLETADGVPVNSRVSSKIQQLLNTLKRPKRPPLKEFFVDDFEELLEVQQPDPNQPKPEGDQMAVLKGEPLSVGTNGPLSLLAALQLWGTTQPKAPCLTALDTAGKAT-CTLTYGKLWSRSLKLAYTLLNKLTSKNEPLLNPGDRVALVFPNSDPVMFMVAFYGCLLAELVPVPIEVPLTRKDAGSQQVGFLLGSCGVTLALTTDACQKGLPKAPTGEVATFKGWPPLAWLVIDGKHLTRPPKDWYPLAQDTGSRTAYIEYK-TSKEGSTVGVTVSHSSLLAQCQALTQACGYTEAETLTNVLDFKRDAGLWHGVLTSVMNRMHVITIPYALMKVNPLSWIQKVCSYKARAALVKSRDMHWSLLAQRGQRDVCLSSLRMLIVADGANPWSISSCDAFLNVFQSRGLRPEVICPCASSPEALTVAIRRPPDLGG--------------------PPPRKAVLSMNGLSYGVIRVDTEEKLSVLTVQDVGQVMPGASVCVVKVDGAPYLCKTDEIGEICVNSVATGTAYYGLLGITKNTFETVPVTADGVPVS-DRP-FTRTGLLGFIGP---DNLVFVVGKLDGLMVVGVRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDDRIVLVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKAPLGGIHISETKQRFLEGTLHPCNVLMCPHTCVTNLPKPRQK-QPEVGPASMIVGNLVAGKRIAQASGRELAHLEDSDQARKFLFLADVLQWRAHTTPDHPLFLLLNAKGTVTSTATCIQLHKRAERVAAALMEKGRLDAGDHVALVYPPGVDLIAAFYGCLYCGCVPVTVRPPH-PQNLGTT----------------------------LPTVKMIVEVSKSACVLSTQAITRLLKSKEAAAAVDVRTWPTILDTDDIPKKKVAS--IFRPPSPDVLAYLDFSVSTTGILAGVKMSHAATSALCRSIKLQCELYPSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLVPPLELESNVSLWLSAVSQYKARVTFCSYSVMEMCTKGLGAQTGALRMKGVNLSCVRTCMVVAEERPRISLTQSFSKLFKDLGLPARAVSTTFGCRVNVAICLQGTTGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVKVIIAHTETKGPLGDSHLGEIWVSSPHNATGYYTVYGEETLHADHFSARLSFGDTQTIWARTGYLGFLRRTELTDASGERHDALYVVGSLDETLELRGMRYHPIDIETSVIRAHRS-IAECAVFTWTNLLVVVVELDGLEQDALDLVALVTNVVLEEHYLVVGVVVIVDPGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1523          
BLAST of Disco-interacting protein 2 homolog C vs. UniProt/SwissProt
Match: sp|Q9Y2E4|DIP2C_HUMAN (Disco-interacting protein 2 homolog C OS=Homo sapiens OX=9606 GN=DIP2C PE=1 SV=2)

HSP 1 Score: 1353.19 bits (3501), Expect = 0.000e+0
Identity = 723/1446 (50.00%), Postives = 964/1446 (66.67%), Query Frame = 3
Query:  840 IASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +A    Q+  +N  H  PPDVT++T      ++S+  E    S G          + P + G+   ++TG        +G+ VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PKP+G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   I LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   INLS LR+L+V+DG+NPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSMH L+YG++RVDSE  L+ LT+QD G ++PG     +KP+G P LC TDE+GE+C+ A  TG+ Y+GL G T   F+V P+ S G  +      ++R+GLLGF+GP   GGL+F+ G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIVIVAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  +IE          +S++L  RA  TP+  L+  LN R    +S T  QL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP       +  N  +TL                 V   +E +R   +AC  +  L C  +     A  V +     ++DTDDLPKKR       +P + D +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE+ P LWL A S  +VRDTFCSYS +EL TK L +   +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    +  D        + +L+ G+   ++ARTGYLGF+RRTELT ++GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HKS + EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  192 LADVMAQTHIEN--HSAPPDVTTYT-----SEHSIQVERPQGSTGSR--------TAP-KYGNAELMETG--------DGVPVSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKPEGAQMLAMRGEQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYI-LTYGKLWTRSMKVAYSILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMAAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRTALLTHCQALTQACGYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLIVADGANPWSISSCDAFLNVFQSKGLRQEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMHGLTYGVIRVDSEEKLSVLTVQDVGLVMPGAIMCSVKPDGVPQLCRTDEIGELCVCAVATGTSYYGLSGMTKNTFEVFPMTSSGAPISEYP--FIRTGLLGFVGP---GGLVFVVGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERIVIVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QIEDNDQARKFLFLSEVLQWRAQTTPDHILYTLLNCRGAIANSLTCVQLHKRAEKIAVMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPP-------HPQNIATTLP---------------TVKMIVEVSR---SACLMTTQLICKLLRSREAAAAVDVRTWPLILDTDDLPKKR--PAQICKPCNPDTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELETNPALWLLAVSQYKVRDTFCSYSVMELCTKGLGSQTESLKARGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNASGYFTIYGDESLQSDHFNSRLSFGDTQTIWARTGYLGFLRRTELTDANGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKS-VTECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1556          
BLAST of Disco-interacting protein 2 homolog C vs. UniProt/SwissProt
Match: sp|Q9W0S9|DIP2_DROME (Disco-interacting protein 2 OS=Drosophila melanogaster OX=7227 GN=DIP2 PE=1 SV=2)

HSP 1 Score: 1348.95 bits (3490), Expect = 0.000e+0
Identity = 733/1449 (50.59%), Postives = 953/1449 (65.77%), Query Frame = 3
Query: 1092 RVSEKIQQLVQTLKRPKRRPLPEYFQEDE-NLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEH--SLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPR-TTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPE-RLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPL--------DSCGN---IVDPNGPG-YVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSG------------------QVGPSAMMVGHLVQGNRLAWAQGRDISV----EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRV-TLTDGQN---MIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQS----------------------------------------------------DGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +VS KIQQL+ TLKRPKRRPLPE++++++  L +    +DPNAPKP+G+ + P  GE L++ +GLPR+LE ALQ Y     K  + + +D NG+V   +LTY KLL RA +IA+ L  K+  +G    +LKP DRVALV+ NNDP++FI A+YGC+   +VPL IE+PL   D   Q +GFLL+S  I + LTSE C K LP+ TT GEI    GWP++QW   +H    KP +++     R  D    YIEY+   K+GSV GVTV+R A + HCR L   C Y EGET+VCV + KRE GLWHSVLT++  G+HV+FIPYA++K+ P+ W++ IT+H+A+  +VKSRD+HW LLA K+H  I+LS LR+LLV+DG+NPWSL++CD F+S F+ KGLRS A+CPCA SSE  T+SLRRP  G         S G + S         GRGVLSM +LS+G+VRVDSE+SLTSLTLQDCGQ++P  + VV++  G P LC TD+VGE+C+ +  T + Y+GL G TN  FKVQPL        D  G    I  P G   YVRSGLLGF      GGL+F+CGS  GLMTV+GR+HNADDIIATVLAVEPM+ ++RGRIAVFSI +LRDER+ ++AE R   SEE +F+WMSRV+QAVDSIHQ  +YC+ LVP N+LPKTPLGGIH+ + +RRFLEG L   NVL+CPH  +TNLPKPR++  G                   VGP+++MVG+LVQGNRLA A GRD+ +    E + + I+ +L  RA  +P+  +F  LN++     + T S+L +RAE+IA  L E+ +I     +AL++ PG++L+CA Y C+  G IP+TI+PP  P  +N T                            L   R I++     IVL+   +IK++K++   T  D +    ++D DD PK++          S D  AY+DFS S  G   GV  TH +L  +C + KL CE YPSR V L LDPY GLGF +W L GVY GH S  + P  +E+ P LWL+  S  +VRDTFCSY  IEL TK L+NSIP+LKQR I L C+R+ V+VAEERPRVQ T  FCKLF  LGLN+R VSTSFGCRVN AIC+QGASS +++ VYVD  +LRN+RV L+E+G+P+SLC++ESGKLLPGV++ IA+PET G C DSHLGEIWV +P N++    +  D  +     + KL TG    +YARTGYLGF+RRTE +QS                                                    D E HDAV+VVGA++  I LRGM YHPIDIE++VMRCHK KIAEC VFTW+NLLVVVVEL+G + EA+DLV LVT++VLE+H LIVGVVVVVD G + +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  381 KVSAKIQQLLNTLKRPKRRPLPEFYEDNDIELEIAANTKDPNAPKPEGSTMTPVQGEQLSIPAGLPRTLECALQRYGTNSFKSPMATVLDPNGKVT-TTLTYGKLLSRAQKIAHALSTKIFSKGPEQVTLKPGDRVALVYPNNDPLSFITAWYGCMFRGLVPLPIELPLSSSDTPPQQVGFLLSSCGITVALTSEACLKGLPKSTTTGEIAKLKGWPRLQWFVTEH--LPKPPKEFNVGNLRADDSAAAYIEYT-TDKEGSVMGVTVTRAAMINHCRALTMACHYTEGETIVCVLDFKREVGLWHSVLTSVLNGMHVIFIPYALMKLRPSSWMQLITKHRASCCLVKSRDLHWGLLATKDHKDISLSSLRMLLVADGANPWSLSSCDQFLSVFQAKGLRSDAICPCASSSEVFTVSLRRPGRG---------SCGFSPSAT-------GRGVLSMAALSHGVVRVDSEDSLTSLTLQDCGQVMPAAQMVVVRSEGPPVLCKTDQVGEICVTSGSTSASYFGLDGMTNSTFKVQPLLEELEQPKDGNGTVNIISKPIGEDFYVRSGLLGF---LGPGGLVFVCGSRDGLMTVTGRKHNADDIIATVLAVEPMRFIYRGRIAVFSIKVLRDERVCVIAEQRPDCSEEESFQWMSRVLQAVDSIHQVGIYCLALVPPNHLPKTPLGGIHLCEARRRFLEGSLHPANVLMCPHTCVTNLPKPRELHQGVQTAAKLSSSSGCGITDTGVGPASVMVGNLVQGNRLAEAHGRDVGLAEDCERKPQLITGVLRWRANTSPDHIIFTLLNSKGAIAKTLTCSELHKRAEKIAALLQERGRIEPGDHVALIFPPGLDLLCAFYGCLYLGAIPITIRPPH-PQNLNTT----------------------------LPTVRMIVDVSKSGIVLSIQPIIKLLKSREAATSIDPKTWPPILDIDDNPKRKYAG---IATVSFDSSAYLDFSVSTCGRLSGVNITHRSLSSLCASLKLACELYPSRHVALCLDPYCGLGFVMWTLIGVYSGHHSILIAPYEVEANPSLWLSTLSQHRVRDTFCSYGVIELCTKALSNSIPSLKQRNIDLRCVRTCVVVAEERPRVQLTQQFCKLFQALGLNTRCVSTSFGCRVNPAICVQGASSAESAQVYVDMRALRNNRVALVERGAPNSLCVIESGKLLPGVKVIIANPETKGHCGDSHLGEIWVQAPHNANGYFTIYGDETDYNDHFNAKLVTGATSELYARTGYLGFLRRTECSQSASLLDETTPSVASRDSDTESLNSISQLQLNFSNVSLGGNSEHSLVGGASNANDQELHDAVYVVGAVDEVISLRGMNYHPIDIENSVMRCHK-KIAECAVFTWTNLLVVVVELDGNESEALDLVPLVTNTVLEDHQLIVGVVVVVDPGVVPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1773          
BLAST of Disco-interacting protein 2 homolog C vs. UniProt/SwissProt
Match: sp|Q9P265|DIP2B_HUMAN (Disco-interacting protein 2 homolog B OS=Homo sapiens OX=9606 GN=DIP2B PE=1 SV=3)

HSP 1 Score: 1326.23 bits (3431), Expect = 0.000e+0
Identity = 695/1369 (50.77%), Postives = 931/1369 (68.01%), Query Frame = 3
Query: 1083 VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIES-------KTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIK----AQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAK-KQLSMKLATGE-IDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            VSSRVS KIQQL+ TLKRPKR PL E+F +D    V     DPN PKP+G  + P  GE L ++   P +LESALQ +     K S ++ +D  G+    +LTY KL  R+ ++AY LLNKLG + E  LKP DRVALV+ NNDP+ F+ AFYGC++A V+P+ IEVPL R+DA  Q +GFLL S  I + LTSE+C K LP+T NGEI  F GWP+++W+  D    SKP +DWQP    +  E  YIEY   +K+GSV GVTVSR A L HC+ L+  C Y+EGET+V V + K++ GLWH +   +   +H + +PY+V+K  P  W++++  HKA  A+VK RD+HWA++A ++   ++LS LR+L+V+DG+NPWS+++CD F+S F+  GL+  A+CPCA S+E MT+++RRP    GV                G   PG R +LSM+ LSYG++RV++E+  ++LT+QD G ++PGG   ++KP+G P LC TDE+GE+C+ +   G  Y+GL G T   F+V P++S G+ V  + P ++RSGLLGF+GP   G L+F+ G + GL+ VSGRRHNADDI+AT LAVE +K V+RGRIAVFS+ +  DERIV+VAE R   SEE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+  TK+ FLEG L  CN+L+CPH  +TNLPKPR    G VGP+++MVG+LV G R+A A GRD+  +IE        + +++IL  RA  TP+  LF  LN +   V + +  QL +RAERIA  L +K  + A   + LLY PGIEL+ A Y C+  GCIPVT++PP           QN T                    +TL   R I++    + +LT   ++++++    A  V +     +IDTDDLP+KRL     Y+P + + +AY+DFS S  G+  GV+ +HSA+  +C+A KLQCE Y SR++ + LDPY GLGF LWCL  VY GH S  +PP  LE+   LWL+  +  ++RDTFCSYS +EL TK L N +  LK RGI+L+C+R+ V+VAEERPRV    +F KLF  +GL+ RAVST+FG RVN+AICLQG S PD + VYVD  SLR+DRV+L+E+G+P SL L ESGK+LPGV++ I +PET G   DSHLGEIWV+SP  +S      D+   +    + +L+ G+    ++ARTGYLGFVRRTELT + GERHDA++VVGAL+ T+ LRG+RYHPIDIE++V R H+S IAEC VFTW+NLLVVVVEL G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  269 VSSRVSTKIQQLLNTLKRPKRPPLKEFFVDDSEEIVEVPQPDPNQPKPEGRQMTPVKGEPLGVICNWPPALESALQRWGTTQAKCSCLTALDMTGK-PVYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPGDRVALVYPNNDPVMFMVAFYGCLLAEVIPVPIEVPLTRKDAGGQQIGFLLGSCGIALALTSEVCLKGLPKTQNGEIVQFKGWPRLKWVVTDSKYLSKPPKDWQPHISPAGTEPAYIEYK-TSKEGSVMGVTVSRLAMLSHCQALSQACNYSEGETIVNVLDFKKDAGLWHGMFANVMNKMHTISVPYSVMKTCPLSWVQRVHAHKAKVALVKCRDLHWAMMAHRDQRDVSLSSLRMLIVTDGANPWSVSSCDAFLSLFQSHGLKPEAICPCATSAEAMTVAIRRP----GV---------------PGAPLPG-RAILSMNGLSYGVIRVNTEDKNSALTVQDVGHVMPGGMMCIVKPDGPPQLCKTDEIGEICVSSRTGGMMYFGLAGVTKNTFEVIPVNSAGSPVG-DVP-FIRSGLLGFVGP---GSLVFVVGKMDGLLMVSGRRHNADDIVATGLAVESIKTVYRGRIAVFSVSVFYDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHISQTKQLFLEGSLHPCNILMCPHTCVTNLPKPRQKQPG-VGPASVMVGNLVAGKRIAQAAGRDLG-QIEENDLVRKHQFLAEILQWRAQATPDHVLFMLLNAKGTTVCTASCLQLHKRAERIASVLGDKGHLNAGDNVVLLYPPGIELIAAFYGCLYAGCIPVTVRPPHA---------QNLT--------------------ATLPTVRMIVDVSKAACILTSQTLMRLLRSREAAAAVDVKTWPTIIDTDDLPRKRL--PQLYKPPTPEMLAYLDFSVSTTGMLTGVKMSHSAVNALCRAIKLQCELYSSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLIPPMELENNLFLWLSTVNQYKIRDTFCSYSVMELCTKGLGNQVEVLKTRGINLSCVRTCVVVAEERPRVALQQSFSKLFKDIGLSPRAVSTTFGSRVNVAICLQGTSGPDPTTVYVDLKSLRHDRVRLVERGAPQSLLLSESGKILPGVKVVIVNPETKGPVGDSHLGEIWVNSPHTASGYYTIYDSETLQADHFNTRLSFGDAAQTLWARTGYLGFVRRTELTAATGERHDALYVVGALDETLELRGLRYHPIDIETSVSRIHRS-IAECAVFTWTNLLVVVVELCGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDPGVIPINSRGEKQRMHLRDSFLADQLDPIYVAYNM 1576          
BLAST of Disco-interacting protein 2 homolog C vs. UniProt/SwissProt
Match: sp|Q3UH60|DIP2B_MOUSE (Disco-interacting protein 2 homolog B OS=Mus musculus OX=10090 GN=Dip2b PE=1 SV=1)

HSP 1 Score: 1316.6 bits (3406), Expect = 0.000e+0
Identity = 692/1370 (50.51%), Postives = 928/1370 (67.74%), Query Frame = 3
Query: 1083 VSSRVSEKIQQLVQTLKRPKRRPLPEYFQED-ENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIES-------KTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIK----AQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAK-KQLSMKLATGE-IDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            V+SRVS KIQQL+ TLKRPKR PL E+F +D E +       DPN PKP+G  + P  GE L ++   P +LESALQ +     K   ++ +D  G+    +LTY KL  R+ ++AY LLNKLG + E  LKP DRVALV+ NNDP+ F+ AFYGC++A V+P+ IEVPL R+DA  Q +GFLL S  I + LTSE+C K LP+T NGEI  F GWP+++W+  D    SKP +DWQP    +  E  YIEY   +K+GSV GVTVSR A L  C+ L+  C Y+EGET+V V + K++ GLWH +   +   +H + +PY+V+K  P  W++++  HKA  A+VK RD+HWA++A ++   ++LS LR+L+V+DG+NPWS+++CD F+S F+  GL+  A+CPCA S+E MT+++RRP    GV                G   PG R +LSM+ LSYG++RV++E+  ++LT+QD G ++PGG   ++KP+G P LC TDE+GE+C+ +   G  Y+GL G T   F+V P+ S G+ V  + P ++RSGLLGF+GP   G L+F+ G + GL+ VSGRRHNADDI+AT LAVE +K V+RGRIAVFS+ +  DERIV+VAE R   SEE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+  TK+ FLEG L  CN+L+CPH  +TNLPKPR    G VGP+++MVG+LV G R+A A GRD+  +IE        + +++IL  RA  TP+  LF  LN +   V + +  QL +RAERIA  L +K  + A   + LLY PGIEL+ A Y C+  GCIPVT++PP           QN T                    +TL   R +++    + VLT   +++++K    A  V +     +IDTDDLP+KRL     Y+P + + +AY+DFS S  G+  GV+ +HSA+  +C+A KLQCE Y SR++ + LDPY GLGF LWCL  VY GH S  +PP  LE+   LWL   +  ++RDTFCSYS +EL TK L N +  LK RGI+L+C+R+ V+VAEERPRV    +F KLF  +GL+ RAVST+FG RVN+AICLQG S PD + VYVD  SLR+DRV+L+E+G+P SL L ESGK+LPGV++ I +PET G   DSHLGEIWV+SP  +S      D+   +    + +L+ G+    ++ARTGYLGFVRRTELT + GERHDA++VVGAL+ T+ LRG+RYHPIDIE++V R H+S IAEC VFTW+NLLVVVVEL G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G + +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  266 VNSRVSTKIQQLLNTLKRPKRPPLKEFFVDDSEEIVEGIPQPDPNQPKPEGRQMTPVKGEPLGVICNWPPALESALQRWGSTQAKCPCLTGLDVTGK-PVYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPGDRVALVYPNNDPVMFMVAFYGCLLAEVIPVPIEVPLTRKDAGGQQIGFLLGSCGIALALTSEICLKGLPKTQNGEIVQFKGWPRLKWVVTDSKYLSKPPKDWQPHISPAGTEPAYIEYK-TSKEGSVMGVTVSRLAMLSQCQALSQACNYSEGETVVNVLDFKKDAGLWHGMFANVMNKMHTISVPYSVMKTCPLSWVQRVHAHKAKVALVKCRDLHWAMMAHRDQRDVSLSSLRMLIVTDGANPWSVSSCDAFLSLFQSHGLKPEAICPCATSAEAMTVAIRRP----GV---------------PGAPLPG-RAILSMNGLSYGVIRVNTEDKNSALTVQDVGHVMPGGMMCIVKPDGLPQLCRTDEIGEICVSSRTGGMMYFGLAGVTKNTFEVIPVTSSGSPVG-DVP-FIRSGLLGFVGP---GSLVFVVGKMDGLLMVSGRRHNADDIVATGLAVESIKTVYRGRIAVFSVSVFYDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKTPLGGIHISQTKQLFLEGSLHPCNILMCPHTCVTNLPKPRQKQPG-VGPASVMVGNLVAGKRIAQAAGRDLG-QIEENDLVRKHQFLAEILQWRAQATPDHVLFMLLNAKGTTVCTASCLQLHKRAERIASVLGDKGHLNAGDNVVLLYPPGIELIAAFYGCLYAGCIPVTVRPPHA---------QNLT--------------------ATLPTVRMVVDVSKAACVLTTQTLMRLLKSREAAAAVDVKTWPAIIDTDDLPRKRL--PQLYKPPTPEMLAYLDFSVSTTGMLTGVKMSHSAVNALCRAIKLQCELYSSRQIAICLDPYCGLGFALWCLCSVYSGHQSVLIPPMELENNLFLWLATVNQYKIRDTFCSYSVMELCTKGLGNQVEVLKTRGINLSCIRTCVVVAEERPRVSLQQSFSKLFKDIGLSPRAVSTTFGSRVNVAICLQGTSGPDPTTVYVDLKSLRHDRVRLVERGAPQSLLLSESGKILPGVKVVIVNPETKGPVGDSHLGEIWVNSPHTASGYYTIYDSETLQADHFNTRLSFGDAAQTLWARTGYLGFVRRTELTAATGERHDALYVVGALDETLELRGLRYHPIDIETSVSRVHRS-IAECAVFTWTNLLVVVVELCGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDPGVVPINSRGEKQRMHLRDSFLADQLDPIYVAYNM 1574          
BLAST of Disco-interacting protein 2 homolog C vs. UniProt/SwissProt
Match: sp|Q6NVJ5|DI2BA_DANRE (Disco-interacting protein 2 homolog B-A OS=Danio rerio OX=7955 GN=dip2ba PE=2 SV=1)

HSP 1 Score: 1315.83 bits (3404), Expect = 0.000e+0
Identity = 683/1432 (47.70%), Postives = 943/1432 (65.85%), Query Frame = 3
Query:  888 VPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISV------EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIK----AQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            VPPDVTS  P   +D+NS        ++   I R +  +S     G V +                 SRVS KIQQL+ TLKRPKR PL E+F +D    V     DPN P+P+G  I P  GE L ++S  P +L++AL  +     K   ++ +D  G+    +LTY KL  R+ ++AY LLNKLG + E  LKP DRVALV+ N+DP  F  AFYGC++A V+P+ IEVPL R+DA  Q +GFLL S  + + LTSE+C K LP+T NGEI  F GWP+++W+  D    +KPS+DWQP    ++ +  YIEY  A+K+G+V GV VS+ + L HC+ L   C Y EGETLV V + K+++GLWH VLT++   +H + +PYAV+K  P  W++++  HKA  A+VK RD+HWA++A ++    NLS LR+L+V+DG+NPWS+++CD F++ F+  GL+   +CPCA S E MT+++RRP A                    G   P  R +LSM  LS+G++RV++E+  ++LT+QD G ++PG    ++KP+G P LC TDE+GE+ L +   G+ Y+GL G T   F+V P++S G  +  + P + R+GLLGF+GP   G L+F+ G ++GL++VSGRRHNADD++AT LAVEP+K V+RGRIAVFS+ +  DER+VIVAE R   +EE +F+WMSRV+QA+DSIHQ  +YC+ LVP N LPKTPLGGIHV +TK  FLEG L  CN+L+CPH  +TNLPKPR      VGP+++MVG+LV G R+A A GRD+ +        + + +S+ L  RA   P+  L+  LN +   VS+ T SQL +RAE+I   L+E+  I     + LLY PGI+L+ + Y C+  GCIPVT++PP  P  ++ T                            L   R I++    + +LT   ++K ++    A  V +    N+IDTDDLP+KR  S   Y+P + + +AY+DFS S  G+  GV+ +HSA+  +C++ KLQCE Y SR++ + +DPY GLGF LWCLS VY GH S  +PP  LE+   LWL+  S  ++RDTFCSYS +EL TK L     ALK R ++L+C+RS V++AEERPR+  T +F KLF  LGL+ RAVST+FG RVN+AICLQG + PD S VYVD  SLR+DRV+L+E+G+P SL L+ESG +LPGVR+ I +PET G   DSHLGEIWV+SP N+S    +  +        + +L+ G+ + ++ARTGYLGFV+RTEL  + G+RHDA+FVVG+L+ T+ LRG+RYHPIDIE++V R H+S IAE  VFTW+NLLVVVVEL+G + EA+DLV LVT+ VL+EH+LIVGVVV+VD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  225 VPPDVTSTAP---QDRNSRVDLPANIAV-KGISRGQSRSSMMDTAGGVPA----------------HSRVSTKIQQLLNTLKRPKRPPLSEFFLDDSEEIVEVPQPDPNTPRPEGRQIIPVKGEPLGVVSNWPPALQAALARWGATQAKSPALTALDITGK-PLYTLTYGKLWSRSLKLAYTLLNKLGTKNEPVLKPGDRVALVYPNSDPGMFWVAFYGCLLAEVIPVPIEVPLSRKDAGSQQIGFLLGSCGVGLALTSEVCLKGLPKTPNGEIMQFKGWPRLKWVVTDTKYLTKPSKDWQPHIPTANTDTAYIEYK-ASKEGTVMGVAVSKISMLTHCQALTQACNYCEGETLVNVLDFKKDSGLWHGVLTSVMNRIHTISVPYAVMKACPLSWVQRVHVHKARVALVKCRDLHWAMMAHRDQKDTNLSSLRMLIVADGANPWSVSSCDAFLNVFQSHGLKPEMICPCASSPEAMTVAIRRPGA-------------------PGTPLPA-RAILSMAGLSHGVIRVNTEDKNSALTVQDVGHVMPGALMCIVKPDGPPMLCKTDEIGEIVLNSRAGGTMYYGLPGVTKNTFEVIPVNSGGTPIG-DVP-FTRTGLLGFVGP---GSLVFVVGKIEGLLSVSGRRHNADDLVATALAVEPVKTVYRGRIAVFSVTVFYDERVVIVAEQRPDANEEDSFQWMSRVLQAIDSIHQVGLYCLALVPANTLPKTPLGGIHVSETKHHFLEGSLHPCNILMCPHTCVTNLPKPRQKQPVGVGPASIMVGNLVAGKRIAQASGRDLGLIDDQEQSRKHQFLSEALQWRAQTDPDHVLYMLLNAKGVAVSTATCSQLHKRAEKITAALLERGGINTGDNVVLLYPPGIDLIASFYGCLYAGCIPVTVRPPH-PQNLSAT----------------------------LPTVRMIIDVSKAACILTTQTLMKTLRSKEAAASVNVKTWPNIIDTDDLPRKRPAS--IYKPPTAEMLAYLDFSVSTTGMLTGVKMSHSAVNALCRSIKLQCELYSSRQIAICMDPYCGLGFVLWCLSSVYSGHQSILIPPMELETSLPLWLSTLSQYKIRDTFCSYSVMELCTKGLGTQTEALKARNVNLSCVRSCVVIAEERPRLALTQSFSKLFKDLGLSPRAVSTAFGSRVNLAICLQGTAGPDPSTVYVDMKSLRHDRVRLVERGAPQSLPLMESGTMLPGVRVIIVNPETKGPLGDSHLGEIWVNSPHNASGYYTIYGEESLQADHFNTRLSFGDTETLWARTGYLGFVKRTELLDASGDRHDALFVVGSLDETLELRGLRYHPIDIETSVSRAHRS-IAESAVFTWTNLLVVVVELSGSEQEALDLVPLVTNVVLKEHHLIVGVVVIVDPGVIPINSRGEKQRMHLRDSFLADQLDPIYVAYNM 1577          
BLAST of Disco-interacting protein 2 homolog C vs. TrEMBL
Match: A0A4Z2CYF3 (Disco-interacting protein 2isoform 3 OS=Schistosoma japonicum OX=6182 GN=EWB00_006364 PE=4 SV=1)

HSP 1 Score: 1588.93 bits (4113), Expect = 0.000e+0
Identity = 814/1439 (56.57%), Postives = 1036/1439 (71.99%), Query Frame = 3
Query: 1089 SRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAA-SKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRP-----TAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGN-IVDPNG-PGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTIS-----------QILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPP--------STPTGVNN-----------------------------TGNQNSTLAFNXXXXXXXXXX--------XXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQ----RVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDE-VAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNG----------------EAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +RVSEKIQ+LV TLKRPKR PLPEYF +DE+  ++    DP AP+P+G   EP +GE L + SGLPR+LESALQ YA    K   ++C+D +GR   + LTY KLLQRA RIAY LLNKLGHRG+ SLKP DRVALV+ANN+PI+F+CAFYGCI+ASV+P+SIEVP  RRDASCQSMGFLL SQ+ R+VL SE CYK+L R  NG+I SFSGWP V WIN DHHA+ +KP +DW PP+RL++D  +Y EY+++ KDGS+ GV +SRRAAL HCR L   C Y+E + +VCV + +R+ GLWH+VLT+++ GLHV+F+PY+V+++DP  WL+ +T+++A  AIVKSRDMHWALLAE++H  +NLS LR+LLV+DGSNPWSLN+CD+F+  FR +G    A+CP AGSSET+TL LRRP     +A   V      +S  +  + S  +S   RGV+S+HSL+YG+VRVD+E+SLTSLTLQDCGQ+LPG  AVV++    P LC TDEVGE+CL A YTGSGYWGL+GQT+ YF V+P+   G  +    G   Y RSG LGF GPA SGGL+FI G + GLMT++GRRHNADDIIATVLAV+P KI++RGRIAVFS+ LL+DER+VIVAELR G+S+EAAF WMS V+QAVDSIHQ +VYC+ L   N LPKTP GGI+ +  KR F +G L    +LLCPH AI NLP+PR      VGPSA+MVG +VQG RLA A+GR +     S T S           +ILI RA +TP++RLF   N + QE S+ T SQL RRAER+A  L EK K    T++ALLY PG ELVCA YAC+L G IPV ++PP        S+ TGV++                               N+NS ++ +  Q  S + +        +  ++ ++L+    ++     +++ T   ++K++K++    R+  +    ++D+++  +++  S+   +   LD+ VAY+DF+ S  G   G+R TH  +  +C+AQK+QCEFYP+REVVLSLDPYSGLGFTLW L+ VYCGH S  VPP + ES PDLWLT CS ++VRD FCS   +EL+T+YL   +  LKQR ISL+ +RSLVIVAEERPR+  T+ F KLF+ LGL +RAVSTSFGCRVN+AI LQGASSP+++ VYVD VSLRNDRVKLLEKGSPHSLCL+ESGKLLPGV +AIA+P+T+GQCADS LGEIWVSSP NS++L+ P D+                  A   L  +L TG+ + VYARTG+LGFVRRTELTQSDGE HDA+FVVG+LE TI+LRGMR+HPIDIE+TVMR HK KI EC VF+WSNLLVVV EL GE+ EA+DLVH +T+ VL EH +IVGVVVVVD  T+ +N  GEK+R+ LRD FVNDKLDP+YVSYNM
Sbjct:  443 NRVSEKIQKLVNTLKRPKRYPLPEYFLDDEDQVLVRPVIDPTAPRPRGLPSEPLLGEELVIPSGLPRNLESALQRYASLSCKTPALTCLDVSGRPTQV-LTYAKLLQRAIRIAYTLLNKLGHRGDQSLKPGDRVALVYANNEPISFLCAFYGCILASVIPISIEVPSARRDASCQSMGFLLGSQDARVVLASEQCYKALQRGPNGDILSFSGWPHVTWINTDHHASGTKPPKDWTPPDRLANDTTMYSEYTFS-KDGSIHGVMISRRAALSHCRALTVACNYSEEDIVVCVVDCRRQMGLWHAVLTSVFNGLHVIFVPYSVMQIDPGSWLRMVTKYRATVAIVKSRDMHWALLAERDHPNVNLSSLRMLLVADGSNPWSLNSCDSFVQKFRSRGFCPEAICPSAGSSETLTLCLRRPPNQSNSAMNSVNGKMCPTSRSDSLVASAPSSV--RGVISIHSLTYGVVRVDTEDSLTSLTLQDCGQVLPGASAVVVRLGPKPILCQTDEVGEICLSAEYTGSGYWGLRGQTDAYFNVEPIHEDGTPLCSSTGVKRYTRSGFLGFPGPASSGGLIFISGCIDGLMTIAGRRHNADDIIATVLAVQPTKIIYRGRIAVFSVDLLKDERLVIVAELRQGYSDEAAFTWMSLVLQAVDSIHQVSVYCLALTHQNTLPKTPFGGINCHSVKRLFSDGHLHPTALLLCPHSAIQNLPQPRQPRPSLVGPSAIMVGQVVQGVRLAEARGRPLGTSPSSNTTSGSSDNGFEMLIEILIHRANHTPDNRLFTVYNAKGQEASTLTCSQLLRRAERLAVQLKEKGKAQVGTIVALLYPPGTELVCAFYACLLIGAIPVPVRPPRIDSTFGSSSATGVSSGSSPIGLLSGPLGSGSSSGISLLGSGSGGAHNRNSPVSGSAGQLSSDTGSFPNMYFRPNAPSLDASLDLIWNVVKHSGATVIFTQNNLLKLLKSKEAVSRIPFSHWPTVLDSEEYNRRK--SNVSIQVPCLDQPVAYLDFAASTTGTLTGIRVTHQVVYALCRAQKMQCEFYPTREVVLSLDPYSGLGFTLWALTSVYCGHHSVLVPPSVTESVPDLWLTICSQRKVRDAFCSNYTMELATRYLTKQVSILKQREISLSSIRSLVIVAEERPRIHLTATFTKLFASLGLTARAVSTSFGCRVNLAISLQGASSPESTTVYVDSVSLRNDRVKLLEKGSPHSLCLMESGKLLPGVHVAIANPDTLGQCADSQLGEIWVSSPHNSTELLGPFDSASLNRSTGVASQPVPGLNAADALHARLVTGDTERVYARTGFLGFVRRTELTQSDGELHDAIFVVGSLEETILLRGMRFHPIDIENTVMRSHK-KICECAVFSWSNLLVVVAELAGEENEAMDLVHPITAHVLTEHQMIVGVVVVVDPRTVPINPSGEKQRILLRDSFVNDKLDPIYVSYNM 1874          
BLAST of Disco-interacting protein 2 homolog C vs. TrEMBL
Match: A0A4S2LIY2 (DMAP-interaction domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007221 PE=4 SV=1)

HSP 1 Score: 1563.13 bits (4046), Expect = 0.000e+0
Identity = 814/1437 (56.65%), Postives = 1035/1437 (72.03%), Query Frame = 3
Query: 1077 GLV-SSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAA-SKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFD---VSSGINESLESGCASPGG-----RGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPG---YVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISV-----------EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPS-TPTGVNN----------------------------------TGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQ----RVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNG----------------EAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            GL+  +RVSEKIQQLV TLKRPKRRPLPEYF ++E+  ++    DP+AP+P G   +P  GE L + SGLPR+LESALQ YA    K  V++C+D  GR   + LTY KLLQR+ RIAY+LLNK+GHRGE SLKP DRVALV+ANN+PI+F  AFYGCI+ASVVP++IEVP +RRDASCQSMGFLL+SQ  RIVL SE CYK+L R  NG+I + +GWP V WIN DHH   SKP +DW PP+RL ++E LY+EY+++ KDGS+ GV +SRRAAL HCR L   C Y+E + +VCV + +RE GLWH+VLT+I+ GLHV+F+PY+V++VDP  WL+ +T+++A+ AIVKSRDMHWALLAE++H  +NLS LR+LLV+DGSNPWSLN+CD+F+  FR +G R+ A+CP AGS ET+TL LRRP   + +  + +    S+G+  +L    A+        RGV+S+HSL+YG++RVDSE+SLTSLTLQDCGQ+LPG  AVV++    P LC TDE+GE+CL + YTG+GYWGL+GQT  +F V+PL+  G  V  N PG   Y RSG LGF GPA SG L+F+CGSV GL+TV+GRRHNADD+IATVLAV+P KIV+RGRIAVFSI LL+DER+VI+AELR G+S+EAAF WMS V+QAVDSIHQ +VYC+ LV  N LP+TP GGI+ +  KR F +G+L    +LLCPH AI NLP+PR +    VGPSA+M G +VQG R+A A GR I V             + + + +ILI RAI+TP+ RLF   N + QE SS T +QL RRAER+ C L +K K    T++ALLY PG E++CA YAC L G IPV I+PP    +G NN                                   GNQ+S+     S    +   +  +  ++LE    I+   N S+V T   ++K++K++    R+       ++D+++  +K+ +S     P     VAY+DF+ S  G   G+R TH  +  +C+AQK+QCEFYP+REVVLSLDPYSGLGFTLW L+ V+CGH S  VPP + E+ PDLWLT CS ++VRD FCS+  +EL+T+++   +  LK R +SL+ LRSLV+VAEERPR+  T+ F KLFS  GL SRAVSTSFGCRVN+AI LQGASSP+++ VYVD++SLRNDRVK+LEKGSPHSLCL+ESGKLLPGVR+AIA+P+T+GQCADS LGEIWVSSP NS++L+ P DN                  A   L  +L TG+ + VYARTG+LGFVRRTELTQSDGE HDA+FVVG+LE  IMLRGMR+HP+DIE+TVMR HK KI EC VFTWSNLLVVV EL GE+ EA+DLVH +T+ VL EH LIVGVVVV D GT+ VN  GEK+R+ LRD FVNDKLDP+YVSYNM
Sbjct:  451 GLICPNRVSEKIQQLVNTLKRPKRRPLPEYFLDEEDQVLVRPVVDPSAPRPHGPPSQPLRGEELVVPSGLPRNLESALQRYAGLSCKTPVLTCLDVGGRPTQV-LTYAKLLQRSIRIAYMLLNKVGHRGEQSLKPGDRVALVYANNEPISFFAAFYGCILASVVPIAIEVPSVRRDASCQSMGFLLSSQNARIVLASEQCYKALQRGPNGDIVTHAGWPNVMWINTDHHGGGSKPPKDWTPPDRLPNEESLYMEYTFS-KDGSIHGVMISRRAALAHCRALTVACHYSEEDVVVCVVDCRREIGLWHAVLTSIFNGLHVIFVPYSVMQVDPGSWLRMVTKYRASVAIVKSRDMHWALLAERDHPNVNLSSLRMLLVADGSNPWSLNSCDSFVQKFRSRGFRAEAICPAAGSPETLTLCLRRPAQVHAMGTATNGKVFSNGLPHTLTQSSAASAAASSAVRGVISIHSLTYGVIRVDSEDSLTSLTLQDCGQVLPGASAVVVRLGPKPVLCRTDELGEICLTSDYTGTGYWGLRGQTGAHFHVEPLNEDGTPV--NAPGTVTYTRSGYLGFPGPASSGSLIFVCGSVDGLLTVAGRRHNADDVIATVLAVQPTKIVYRGRIAVFSIELLKDERVVIIAELRQGYSDEAAFTWMSLVLQAVDSIHQVSVYCLALVQQNTLPRTPFGGINCHAVKRLFSDGQLHPTALLLCPHSAIQNLPQPRQLRPNLVGPSAIMCGQVVQGVRMAEASGRPIPVLPTPSASGSQTTPDGRLLVEILIWRAIHTPDDRLFTVYNQKGQEASSLTCAQLLRRAERLGCLLQDKAKATVGTIVALLYPPGTEILCAFYACQLIGAIPVPIRPPRLDQSGFNNSSSTPSTPGSVAHLSGPVGSGSSTGLSLLGLGPSAGNQSSS-GSTESWANINFRPAAPSFEASLELVWNIVKHSNASVVFTQQPIVKLLKSKEATSRIPFNHWPPVLDSEESFRKK-ISPLHQTPCVEQSVAYLDFAASTTGTVTGIRVTHQVVQAMCRAQKVQCEFYPTREVVLSLDPYSGLGFTLWALTSVHCGHHSILVPPSVTEAVPDLWLTVCSQRKVRDAFCSHYTMELATRHMTKQLSLLKPRDLSLSSLRSLVVVAEERPRIHLTATFTKLFSSFGLMSRAVSTSFGCRVNLAISLQGASSPESTTVYVDRISLRNDRVKMLEKGSPHSLCLMESGKLLPGVRVAIANPDTLGQCADSQLGEIWVSSPHNSTELLGPFDNASLSRAPGTTSQPVPGLNAADSLCARLVTGDTERVYARTGFLGFVRRTELTQSDGELHDAIFVVGSLEEAIMLRGMRFHPVDIENTVMRAHK-KICECAVFTWSNLLVVVAELVGEENEAMDLVHPITAHVLTEHQLIVGVVVVTDPGTVPVNPCGEKQRILLRDSFVNDKLDPIYVSYNM 1880          
BLAST of Disco-interacting protein 2 homolog C vs. TrEMBL
Match: A0A4S2LGV6 (DMAP-interaction domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007221 PE=4 SV=1)

HSP 1 Score: 1562.36 bits (4044), Expect = 0.000e+0
Identity = 814/1437 (56.65%), Postives = 1035/1437 (72.03%), Query Frame = 3
Query: 1077 GLV-SSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAA-SKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFD---VSSGINESLESGCASPGG-----RGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPG---YVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISV-----------EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPS-TPTGVNN----------------------------------TGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQ----RVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNG----------------EAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            GL+  +RVSEKIQQLV TLKRPKRRPLPEYF ++E+  ++    DP+AP+P G   +P  GE L + SGLPR+LESALQ YA    K  V++C+D  GR   + LTY KLLQR+ RIAY+LLNK+GHRGE SLKP DRVALV+ANN+PI+F  AFYGCI+ASVVP++IEVP +RRDASCQSMGFLL+SQ  RIVL SE CYK+L R  NG+I + +GWP V WIN DHH   SKP +DW PP+RL ++E LY+EY+++ KDGS+ GV +SRRAAL HCR L   C Y+E + +VCV + +RE GLWH+VLT+I+ GLHV+F+PY+V++VDP  WL+ +T+++A+ AIVKSRDMHWALLAE++H  +NLS LR+LLV+DGSNPWSLN+CD+F+  FR +G R+ A+CP AGS ET+TL LRRP   + +  + +    S+G+  +L    A+        RGV+S+HSL+YG++RVDSE+SLTSLTLQDCGQ+LPG  AVV++    P LC TDE+GE+CL + YTG+GYWGL+GQT  +F V+PL+  G  V  N PG   Y RSG LGF GPA SG L+F+CGSV GL+TV+GRRHNADD+IATVLAV+P KIV+RGRIAVFSI LL+DER+VI+AELR G+S+EAAF WMS V+QAVDSIHQ +VYC+ LV  N LP+TP GGI+ +  KR F +G+L    +LLCPH AI NLP+PR +    VGPSA+M G +VQG R+A A GR I V             + + + +ILI RAI+TP+ RLF   N + QE SS T +QL RRAER+ C L +K K    T++ALLY PG E++CA YAC L G IPV I+PP    +G NN                                   GNQ+S+     S    +   +  +  ++LE    I+   N S+V T   ++K++K++    R+       ++D+++  +K+ +S     P     VAY+DF+ S  G   G+R TH  +  +C+AQK+QCEFYP+REVVLSLDPYSGLGFTLW L+ V+CGH S  VPP + E+ PDLWLT CS ++VRD FCS+  +EL+T+++   +  LK R +SL+ LRSLV+VAEERPR+  T+ F KLFS  GL SRAVSTSFGCRVN+AI LQGASSP+++ VYVD++SLRNDRVK+LEKGSPHSLCL+ESGKLLPGVR+AIA+P+T+GQCADS LGEIWVSSP NS++L+ P DN                  A   L  +L TG+ + VYARTG+LGFVRRTELTQSDGE HDA+FVVG+LE  IMLRGMR+HP+DIE+TVMR HK KI EC VFTWSNLLVVV EL GE+ EA+DLVH +T+ VL EH LIVGVVVV D GT+ VN  GEK+R+ LRD FVNDKLDP+YVSYNM
Sbjct:  460 GLICPNRVSEKIQQLVNTLKRPKRRPLPEYFLDEEDQVLVRPVVDPSAPRPHGPPSQPLRGEELVVPSGLPRNLESALQRYAGLSCKTPVLTCLDVGGRPTQV-LTYAKLLQRSIRIAYMLLNKVGHRGEQSLKPGDRVALVYANNEPISFFAAFYGCILASVVPIAIEVPSVRRDASCQSMGFLLSSQNARIVLASEQCYKALQRGPNGDIVTHAGWPNVMWINTDHHGGGSKPPKDWTPPDRLPNEESLYMEYTFS-KDGSIHGVMISRRAALAHCRALTVACHYSEEDVVVCVVDCRREIGLWHAVLTSIFNGLHVIFVPYSVMQVDPGSWLRMVTKYRASVAIVKSRDMHWALLAERDHPNVNLSSLRMLLVADGSNPWSLNSCDSFVQKFRSRGFRAEAICPAAGSPETLTLCLRRPAQVHAMGTATNGKVFSNGLPHTLTQSSAASAAASSAVRGVISIHSLTYGVIRVDSEDSLTSLTLQDCGQVLPGASAVVVRLGPKPVLCRTDELGEICLTSDYTGTGYWGLRGQTGAHFHVEPLNEDGTPV--NAPGTVTYTRSGYLGFPGPASSGSLIFVCGSVDGLLTVAGRRHNADDVIATVLAVQPTKIVYRGRIAVFSIELLKDERVVIIAELRQGYSDEAAFTWMSLVLQAVDSIHQVSVYCLALVQQNTLPRTPFGGINCHAVKRLFSDGQLHPTALLLCPHSAIQNLPQPRQLRPNLVGPSAIMCGQVVQGVRMAEASGRPIPVLPTPSASGSQTTPDGRLLVEILIWRAIHTPDDRLFTVYNQKGQEASSLTCAQLLRRAERLGCLLQDKAKATVGTIVALLYPPGTEILCAFYACQLIGAIPVPIRPPRLDQSGFNNSSSTPSTPGSVAHLSGPVGSGSSTGLSLLGLGPSAGNQSSS-GSTESWANINFRPAAPSFEASLELVWNIVKHSNASVVFTQQPIVKLLKSKEATSRIPFNHWPPVLDSEESFRKK-ISPLHQTPCVEQSVAYLDFAASTTGTVTGIRVTHQVVQAMCRAQKVQCEFYPTREVVLSLDPYSGLGFTLWALTSVHCGHHSILVPPSVTEAVPDLWLTVCSQRKVRDAFCSHYTMELATRHMTKQLSLLKPRDLSLSSLRSLVVVAEERPRIHLTATFTKLFSSFGLMSRAVSTSFGCRVNLAISLQGASSPESTTVYVDRISLRNDRVKMLEKGSPHSLCLMESGKLLPGVRVAIANPDTLGQCADSQLGEIWVSSPHNSTELLGPFDNASLSRAPGTTSQPVPGLNAADSLCARLVTGDTERVYARTGFLGFVRRTELTQSDGELHDAIFVVGSLEEAIMLRGMRFHPVDIENTVMRAHK-KICECAVFTWSNLLVVVAELVGEENEAMDLVHPITAHVLTEHQLIVGVVVVTDPGTVPVNPCGEKQRILLRDSFVNDKLDPIYVSYNM 1889          
BLAST of Disco-interacting protein 2 homolog C vs. TrEMBL
Match: A0A4V3SE17 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_007221 PE=4 SV=1)

HSP 1 Score: 1559.66 bits (4037), Expect = 0.000e+0
Identity = 814/1437 (56.65%), Postives = 1035/1437 (72.03%), Query Frame = 3
Query: 1077 GLV-SSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAA-SKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFD---VSSGINESLESGCASPGG-----RGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPG---YVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISV-----------EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPS-TPTGVNN----------------------------------TGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQ----RVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNG----------------EAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            GL+  +RVSEKIQQLV TLKRPKRRPLPEYF ++E+  ++    DP+AP+P G   +P  GE L + SGLPR+LESALQ YA    K  V++C+D  GR   + LTY KLLQR+ RIAY+LLNK+GHRGE SLKP DRVALV+ANN+PI+F  AFYGCI+ASVVP++IEVP +RRDASCQSMGFLL+SQ  RIVL SE CYK+L R  NG+I + +GWP V WIN DHH   SKP +DW PP+RL ++E LY+EY+++ KDGS+ GV +SRRAAL HCR L   C Y+E + +VCV + +RE GLWH+VLT+I+ GLHV+F+PY+V++VDP  WL+ +T+++A+ AIVKSRDMHWALLAE++H  +NLS LR+LLV+DGSNPWSLN+CD+F+  FR +G R+ A+CP AGS ET+TL LRRP   + +  + +    S+G+  +L    A+        RGV+S+HSL+YG++RVDSE+SLTSLTLQDCGQ+LPG  AVV++    P LC TDE+GE+CL + YTG+GYWGL+GQT  +F V+PL+  G  V  N PG   Y RSG LGF GPA SG L+F+CGSV GL+TV+GRRHNADD+IATVLAV+P KIV+RGRIAVFSI LL+DER+VI+AELR G+S+EAAF WMS V+QAVDSIHQ +VYC+ LV  N LP+TP GGI+ +  KR F +G+L    +LLCPH AI NLP+PR +    VGPSA+M G +VQG R+A A GR I V             + + + +ILI RAI+TP+ RLF   N + QE SS T +QL RRAER+ C L +K K    T++ALLY PG E++CA YAC L G IPV I+PP    +G NN                                   GNQ+S+     S    +   +  +  ++LE    I+   N S+V T   ++K++K++    R+       ++D+++  +K+ +S     P     VAY+DF+ S  G   G+R TH  +  +C+AQK+QCEFYP+REVVLSLDPYSGLGFTLW L+ V+CGH S  VPP + E+ PDLWLT CS ++VRD FCS+  +EL+T+++   +  LK R +SL+ LRSLV+VAEERPR+  T+ F KLFS  GL SRAVSTSFGCRVN+AI LQGASSP+++ VYVD++SLRNDRVK+LEKGSPHSLCL+ESGKLLPGVR+AIA+P+T+GQCADS LGEIWVSSP NS++L+ P DN                  A   L  +L TG+ + VYARTG+LGFVRRTELTQSDGE HDA+FVVG+LE  IMLRGMR+HP+DIE+TVMR HK KI EC VFTWSNLLVVV EL GE+ EA+DLVH +T+ VL EH LIVGVVVV D GT+ VN  GEK+R+ LRD FVNDKLDP+YVSYNM
Sbjct:  431 GLICPNRVSEKIQQLVNTLKRPKRRPLPEYFLDEEDQVLVRPVVDPSAPRPHGPPSQPLRGEELVVPSGLPRNLESALQRYAGLSCKTPVLTCLDVGGRPTQV-LTYAKLLQRSIRIAYMLLNKVGHRGEQSLKPGDRVALVYANNEPISFFAAFYGCILASVVPIAIEVPSVRRDASCQSMGFLLSSQNARIVLASEQCYKALQRGPNGDIVTHAGWPNVMWINTDHHGGGSKPPKDWTPPDRLPNEESLYMEYTFS-KDGSIHGVMISRRAALAHCRALTVACHYSEEDVVVCVVDCRREIGLWHAVLTSIFNGLHVIFVPYSVMQVDPGSWLRMVTKYRASVAIVKSRDMHWALLAERDHPNVNLSSLRMLLVADGSNPWSLNSCDSFVQKFRSRGFRAEAICPAAGSPETLTLCLRRPAQVHAMGTATNGKVFSNGLPHTLTQSSAASAAASSAVRGVISIHSLTYGVIRVDSEDSLTSLTLQDCGQVLPGASAVVVRLGPKPVLCRTDELGEICLTSDYTGTGYWGLRGQTGAHFHVEPLNEDGTPV--NAPGTVTYTRSGYLGFPGPASSGSLIFVCGSVDGLLTVAGRRHNADDVIATVLAVQPTKIVYRGRIAVFSIELLKDERVVIIAELRQGYSDEAAFTWMSLVLQAVDSIHQVSVYCLALVQQNTLPRTPFGGINCHAVKRLFSDGQLHPTALLLCPHSAIQNLPQPRQLRPNLVGPSAIMCGQVVQGVRMAEASGRPIPVLPTPSASGSQTTPDGRLLVEILIWRAIHTPDDRLFTVYNQKGQEASSLTCAQLLRRAERLGCLLQDKAKATVGTIVALLYPPGTEILCAFYACQLIGAIPVPIRPPRLDQSGFNNSSSTPSTPGSVAHLSGPVGSGSSTGLSLLGLGPSAGNQSSS-GSTESWANINFRPAAPSFEASLELVWNIVKHSNASVVFTQQPIVKLLKSKEATSRIPFNHWPPVLDSEESFRKK-ISPLHQTPCVEQSVAYLDFAASTTGTVTGIRVTHQVVQAMCRAQKVQCEFYPTREVVLSLDPYSGLGFTLWALTSVHCGHHSILVPPSVTEAVPDLWLTVCSQRKVRDAFCSHYTMELATRHMTKQLSLLKPRDLSLSSLRSLVVVAEERPRIHLTATFTKLFSSFGLMSRAVSTSFGCRVNLAISLQGASSPESTTVYVDRISLRNDRVKMLEKGSPHSLCLMESGKLLPGVRVAIANPDTLGQCADSQLGEIWVSSPHNSTELLGPFDNASLSRAPGTTSQPVPGLNAADSLCARLVTGDTERVYARTGFLGFVRRTELTQSDGELHDAIFVVGSLEEAIMLRGMRFHPVDIENTVMRAHK-KICECAVFTWSNLLVVVAELVGEENEAMDLVHPITAHVLTEHQLIVGVVVVTDPGTVPVNPCGEKQRILLRDSFVNDKLDPIYVSYNM 1860          
BLAST of Disco-interacting protein 2 homolog C vs. TrEMBL
Match: G7YHV6 (Disco-interacting protein 2 homolog C OS=Clonorchis sinensis OX=79923 GN=CLF_108300 PE=4 SV=1)

HSP 1 Score: 1557.73 bits (4032), Expect = 0.000e+0
Identity = 812/1435 (56.59%), Postives = 1034/1435 (72.06%), Query Frame = 3
Query: 1077 GLV-SSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAA-SKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFD---VSSGINESLESGCASPGG-----RGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGP-GYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISV-----------EIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPS-TPTGVNN----------------------------------TGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQ----RVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNG----------------EAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            GL+  +RVSEKIQQLV TLKRPKRRPLPEYF ++E+  ++    DP+AP+P G   +P  GE L + SGLPR+LESALQ YA    K  V++C+D  GR   + LTY KLLQR+ RIAY+LLNK+GHRGE SLKP DRVALV+ANN+PI+F  AFYGCI+ASVVP++IEVP  RRDASCQSMGFLL+SQ  RIVL SE CYK+L R  NG+I + +GWP V WIN DHH   SKP +DW PP+RL ++E LY+EY+++ KDGS+ GV +SRRAAL HCR L   C Y+E + +VCV + +RE GLWH+VLT+I+ GLHV+F+PY+V++VDP  WL+ +T+++A+ AIVKSRDMHWALLAE++H  +NLS LR+LLV+DGSNPWSLN+CD+F+  FR +G R+ A+CP AGS ET+TL LRRP   + +  + +    S+G+  +L    A+        RGV+S+HSL+YG++RVDSE+SLTSLTLQDCGQ+LPG  AVV++    P LC TDE+GE+CL + YTG+GYWGL+GQT  +F V+PL+  G  V+P G   Y RSG LGF GPA SG L+F+CGSV GL+TV+GRRHNADD+IATVLAV+P KIV+RGRIAVFSI LL+DER+VI+AELR G+S+EAAF WMS V+QAVDSIHQ +VYC+ LV  N LP+TP GGI+ +  KR F +G+L    +LLCPH AI NLP+PR +    VGPSA+M G +VQG R+A A GR I V             + + + +ILI RAI+TP+ RLF   N + QE SS T +QL RRAER+ C L +K K    T++ALLY PG E++CA YAC L G IPV I+PP    +G NN                                   GNQ+S+     S    +   +  +  ++LE    I+   N S+V T   ++K++K++    R+       ++D+++  +K+ +S     P     VAY+DF+ S  G   G+R TH  +  +C+AQK+QCEFYP+REVVLSLDPYSGLGFTLW L+ V+CGH S  VPP + E+ PDLWLT CS ++VRD FCS+  +EL+T+++   +  +K R +SL+ LRSLV+VAEERPR+  T+ F KLFS  GL SRAVSTSFGCRVN+AI LQGASSP+++ VYVD++SLRNDRVK+LEKGSPHSLCL+ESGKLLPGVR+AIA+P+T+GQCADS LGEIWVSSP NS++L+ P DN                  A   L  +L TG+ + VYARTG+LGFVRRTELTQSDGE HDA+FVVG+LE  IMLRGMR+HP+DIE+TVMR HK KI EC VFTWSNLLVVV EL GE+ EA+DLVH +T+ VL EH LIVGVVVV D GT+ VN  GEK+R+ LRD FVNDKLDP+YVSYNM
Sbjct:  466 GLICPNRVSEKIQQLVNTLKRPKRRPLPEYFLDEEDQVLVRPVVDPSAPRPHGPPSQPLRGEELVVPSGLPRNLESALQRYAGLSCKTPVLTCLDVGGRPTQV-LTYAKLLQRSIRIAYMLLNKVGHRGEQSLKPGDRVALVYANNEPISFFAAFYGCILASVVPIAIEVPSARRDASCQSMGFLLSSQNARIVLASEQCYKALQRGPNGDIATHAGWPNVTWINTDHHGGGSKPPKDWTPPDRLPNEESLYMEYTFS-KDGSIHGVMISRRAALAHCRALTVACHYSEEDVVVCVVDCRREIGLWHAVLTSIFNGLHVIFVPYSVMQVDPGSWLRMVTKYRASVAIVKSRDMHWALLAERDHPNVNLSSLRMLLVADGSNPWSLNSCDSFVQKFRSRGFRAEAICPAAGSPETLTLCLRRPAQVHTMGTTTNGKVFSNGLPHTLTQSNAASAAASSAVRGVISIHSLTYGVIRVDSEDSLTSLTLQDCGQVLPGASAVVVRLGPKPVLCRTDELGEICLTSDYTGTGYWGLRGQTGAHFHVEPLNEDGTPVNPPGTVTYTRSGYLGFPGPASSGSLIFVCGSVDGLLTVAGRRHNADDVIATVLAVQPTKIVYRGRIAVFSIELLKDERVVIIAELRQGYSDEAAFTWMSLVLQAVDSIHQVSVYCLALVQQNTLPRTPFGGINCHAVKRLFSDGQLHPTALLLCPHSAIQNLPQPRQLRPNLVGPSAIMCGQVVQGVRMAEASGRPIPVLPTPSASGSQTTPDGRLLVEILIWRAIHTPDDRLFTVYNQKGQEASSLTCAQLLRRAERLGCLLQDKAKATVGTIVALLYPPGTEMLCAFYACQLIGAIPVPIRPPRLDQSGFNNSSSTPSTPGSVAHLSGPVGSGSSTGLSLLGLGSSAGNQSSS-GSTESWANINFRPAAPSFEASLELVWNIVKHSNASVVFTQQPIVKLLKSKEATSRIPFNHWPPVLDSEESFRKK-ISPLHQSPCVEQSVAYLDFAASTTGTVTGIRVTHQVVQAMCRAQKVQCEFYPTREVVLSLDPYSGLGFTLWALTSVHCGHHSILVPPSVTEAVPDLWLTVCSQRKVRDAFCSHYTMELATRHMTKQLSLVKPRDLSLSSLRSLVVVAEERPRIHLTATFTKLFSSFGLMSRAVSTSFGCRVNLAISLQGASSPESTTVYVDRISLRNDRVKMLEKGSPHSLCLMESGKLLPGVRVAIANPDTLGQCADSQLGEIWVSSPHNSTELLGPFDNASLSRAPGTTSQPVPGLNAADSLCARLVTGDTERVYARTGFLGFVRRTELTQSDGELHDAIFVVGSLEEAIMLRGMRFHPVDIENTVMRAHK-KICECAVFTWSNLLVVVAELVGEENEAMDLVHPITAHVLTEHQLIVGVVVVTDPGTVPVNPCGEKQRILLRDSFVNDKLDPIYVSYNM 1895          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Cavefish
Match: dip2ca (disco-interacting protein 2 homolog Ca [Source:ZFIN;Acc:ZDB-GENE-031118-39])

HSP 1 Score: 1338.17 bits (3462), Expect = 0.000e+0
Identity = 712/1443 (49.34%), Postives = 949/1443 (65.77%), Query Frame = 3
Query:  858 QSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            Q+  +N  H  PPDVT++T      ++ V  E    S            + P  T    + +   T +G      VSSRVS KIQQLV TLK+P+R PL E+F +D    +     DPN P+P+G  +    G+ L +++  P SLE+ALQ +     K   ++ +D+NG+   + LTY KL  R+ ++AY +L+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP+   GEI  F GWPK+ W   +    SKP RDW P  + ++++  YIEY    KDGSV GVTV R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ IPY+++KV+P  W++++ ++KA  A VKSRDMHWAL+A ++   INLS LR+L+V+DGSNPWS+++CD F++ F+ KGLR   +CPCA S E +T+++RRPT     +DS                 P GRGVLSM  LS+G++RVD+E  L+ LT+QD G ++PG    V+KP G P LC TDE+GE+C+ +  TG+ Y+GL G T   F+V P+ + G  +      + R+GLLGF+GP   GGL+FI G + GLM VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +L DERIV+VAE R   +EE +F+WMSRV+QA+DSIH   V+C+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+  +IE          +S++L  RA  TP+  LF  L++R   +SS T  QL +RAE+IA  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  +  T                            L   + I+     + V+T   + K++K++     V +     ++DTDDLPKK+      Y+P + D +AY+DFS S  G+  GV+ +HSA    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE  P LWL A S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N S    V  D        + +L+ G+   V+ARTGYLGF+RRTELT + GERHDA++VVGAL+  + LRGMRYHPIDIE++V+R HKS I EC VF W+NLLVVVVEL G + EA+DLV LVT++VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  142 QTHVKN--HSAPPDVTTYT-----SEHPVQVERPQVS------------TVPRTTPKYGNAELMETGDGVP----VSSRVSAKIQQLVNTLKQPRRPPLREFFVDDFEELLEVQQPDPNQPRPEGAQMLTMRGDQLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYV-LTYGKLWSRSIKVAYNILHKLGTKQEPMVRPGDRVALVFPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKGPTGEIPQFKGWPKLLWFVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVMRIALLTHCQALTQSCGYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISIPYSLMKVNPLSWIQKVCQYKAKVACVKSRDMHWALVAHRDQRDINLSSLRMLVVADGSNPWSISSCDAFLNVFQSKGLRPEVICPCASSPEALTVAIRRPT-----DDS---------------NQPPGRGVLSMQGLSHGVIRVDTEERLSVLTVQDVGTVMPGALMCVVKPEGVPQLCRTDEIGELCVCSVATGTSYYGLSGMTKNTFEVFPMSNSGAPISEYP--FTRTGLLGFVGP---GGLVFIAGKMDGLMVVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLHDERIVVVAEQRPDSTEEDSFQWMSRVLQAIDSIHNVGVFCLALVPANTLPKTPLGGIHLSETKQLFLEGSLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QIEDNDQARKFLFLSEVLQWRAQTTPDHVLFTLLSSRGAILSSLTCLQLHKRAEKIAAMLMERGHLQDGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNIATT----------------------------LPTVKMIVEVSRSACVMTTQVICKLLKSKEASAAVDVRTWPPVLDTDDLPKKK--PPQLYKPSNPDTLAYLDFSVSTTGMLAGVKMSHSATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELEVNPALWLLAVSQFRVRDTFCSYSVMELCTKGLGLQTESLKSRGLDLSRVRTCVVVAEERPRIALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSGHNGSGYFTVYGDEALQSDHFNSRLSFGDTQTVWARTGYLGFLRRTELTDASGERHDALYVVGALDEAMELRGMRYHPIDIETSVIRAHKS-IMECAVFPWTNLLVVVVELEGSEQEALDLVPLVTNAVLEEHYLIVGVVVVVDVGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1500          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Cavefish
Match: dip2a (disco-interacting protein 2 homolog A [Source:ZFIN;Acc:ZDB-GENE-091204-2])

HSP 1 Score: 1318.52 bits (3411), Expect = 0.000e+0
Identity = 690/1431 (48.22%), Postives = 945/1431 (66.04%), Query Frame = 3
Query:  936 NSVTTESITSSIGDNIRRSRDDASCP----------SQTGSVNSLQTGGTNNGAV---ENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            ++ T  S  + + D +  ++ D  C           SQ  SV  L  G T+  +     +G+ V+SRVS KIQQL+ TLKRPKR PL E+F +D    +     DPN PKP+G  + P  GE + +++  P SL ++LQ +     K   ++ +D+ G+    SLTY KL  R+ ++AY LLNKL  R E  L+P DRVALVF NNDP+ F+ AFYGC++A +VP+ IEVPL R+DA  Q +GFLL S  + + LT++ C K LP+   GE+ +F GWP++ W   D     KP +DW P  R + +E  YIEY   +K+GS  G+TVS  A L HC  L   C Y +GET+  V + KR+ GLWH VLT++   +HV+ IPY+++KV+P  W++++  +KA  A+VKSRDMHW+LL++K+   I+LS LR+L+V+DG+NPWS+++CD F++ F+ +GLR   +CPCA S E MT+++RRP                    E G   PG + VLSM SLS+ ++RVD+E  L+ LTLQD GQ++PG    V++P G+PYLC +DEVGE+C+ +  TG  Y+GL G T   F+  P+ + G+ V      + R+ LLGF+GP     LLF+ G + GLM VSGRRHNADD++AT LAVEPMK V+RGRIAVFS+ +L DERIV+VAE R   SEE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPK PLGGIH+ +TK+RFLEG L  CNVL+CPH  +TNLPKPR     Q  P++M+VG+LV G R+A A GRD++ ++E          +  +L  RA  TP+  LF  LN +    S+ +  Q+ +RAER+A  L+E+ ++ A   +AL+Y PG++L+   Y C+  GC+PVT++PP  P  +  T                            L   + I+       +LT  A++K++K++     V +     ++DTDDLP+K+L     Y+P + + +AY+DFS S  G+  GV+ +H+A   +C++ KLQCE YPSR++ + LDPY GLGF LWCL  VY GH S  VPP  LES   LWLTA S  +VR TFCSYS +E+ TK L +   AL+ R ++L+C+R+ ++VAEERPR+  T +F K+F  LGL+ RAVST+FGCRVN+AICLQG + PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGV++ IA+ ET G   DSHLGEIWVSSP N++    V  +          KL+ G+   V+ARTGYLGF+RRTELT + GERHDA++VVG+L+ T+ LRGMRYHPIDIE++V+R HKS IAEC VFTW+NLLVVVVEL G + EA+DLV LVT+ VLEEH+LIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:   63 HNATASSAATVLADLMAHTQLDNHCAPPDVTGLSERSQVASVRGLTRGYTHTSSTMETADGVPVNSRVSSKIQQLLNTLKRPKRPPLREFFLDDFEELLDVQQPDPNQPKPEGVQMSPLHGEPMGVVTNWPPSLLASLQRWGTTQPKSPCLTALDNAGK-PIYSLTYGKLWTRSQKLAYTLLNKLSSRNEPLLRPGDRVALVFPNNDPVMFMVAFYGCLLAELVPVPIEVPLTRKDAGSQQIGFLLGSCGVTLALTTDACQKGLPKAQTGEVATFKGWPRLLWFVTDGKHVVKPPKDWVPLIRDASNETAYIEYK-TSKEGSTMGITVSHAAMLAHCHALTQACGYTDGETITNVLDFKRDAGLWHGVLTSVMNRMHVISIPYSLMKVNPLSWIQKVHTYKARVAVVKSRDMHWSLLSQKDQRDISLSSLRMLIVADGANPWSISSCDAFLNVFQARGLRPEVICPCASSPEAMTVAIRRPP-------------------EMGVPPPG-KAVLSMSSLSHSVIRVDTEEKLSVLTLQDVGQVMPGAMVCVVRPEGTPYLCRSDEVGEICVSSCTTGISYYGLPGMTKNVFETIPVTASGSPVSDRP--FTRTSLLGFIGP---DNLLFVVGKMDGLMVVSGRRHNADDVVATALAVEPMKFVYRGRIAVFSVCVLHDERIVVVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKAPLGGIHISETKQRFLEGALHPCNVLMCPHTCVTNLPKPRQ---KQWVPASMIVGNLVAGKRIAQACGRDVA-QLEDNDQARKFLYMQDVLQWRAQATPDHPLFLLLNAKGTVASTASCVQIHKRAERVAVALMERGRLNAGDHVALVYPPGVDLIATFYGCLYAGCVPVTVRPPH-PQNLATT----------------------------LPTVKMIVEVSKSVCILTTQAIMKLLKSKEAAAAVDVKTWPVVLDTDDLPRKKL--PQIYKPPTPEMLAYLDFSVSTTGILAGVKMSHAATSALCRSIKLQCELYPSRQIAICLDPYCGLGFALWCLCSVYSGHQSILVPPLELESNVSLWLTAVSQFKVRVTFCSYSVMEMCTKGLGSQTEALRLRNVNLSCVRTCMVVAEERPRIALTQSFSKIFKDLGLSPRAVSTTFGCRVNVAICLQGTAGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVKVIIANTETKGPLGDSHLGEIWVSSPHNATGYYTVYGEEALHADHFCTKLSFGDTQTVWARTGYLGFLRRTELTDASGERHDALYVVGSLDETLELRGMRYHPIDIETSVIRAHKS-IAECAVFTWTNLLVVVVELEGSEQEALDLVALVTNVVLEEHFLIVGVVVVVDPGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1430          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Cavefish
Match: dip2cb (disco-interacting protein 2 homolog Cb [Source:ZFIN;Acc:ZDB-GENE-070912-589])

HSP 1 Score: 1301.58 bits (3367), Expect = 0.000e+0
Identity = 697/1448 (48.14%), Postives = 941/1448 (64.99%), Query Frame = 3
Query:  879 AHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQT--GSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSG-------------WPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT---ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLI-VPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            +H  PPD+TS+T     D   VT E             R   + P++   G+   ++TG        +G+ VSSRVS KI QLV TLKRPKRRPL E+F +D    +     DP+ P+P+G       GE L  L   P S+E+ALQ +     K   ++   +N +    +LTY KL  R+ ++AY +L+KLG + E  ++P DRVALV+ NNDP  F+ AFYGC++A VVP+ IEVPL ++DA  Q +GFLL S  + + LTS+           G+I  F G             WPK+ W+  +    SKP R+W P  + ++++  YIEY    KDGSV GVTV+R A L HC+TL   C Y E ETLV V + K++ GLWH +LT++   LHVV +PYA++KV+P  W++++ ++KA    VKSRD+HWAL+A ++ + +NLS LR+LLV+DG+NPWS+++CD F++ F+  GLRS  +CPCA S E +T++LRRP                NES       P GRGVLSM  LS+G++RVD+   L+ LTLQD G  +PG    V+KP   P LC TDE+GE+C+ +  TG+ Y+GL G T   F+V P+ S G +V      +VRSGLLGF+GP   GG +F+ G + GLM V+GRRHNADDI+AT LAVEPMK V+RGRIAVFSI +L DERIV+VAE R   +EE +F+WMSRV+QA+D IHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ F EG +  CNVL+CPH  +TNLPKPR     +VGP+++MVG+LV G R+A A GRD+S   ++     +S++L  RA  TP+  L+  +N+R    SS T  QL +RAE+IA  L E+ ++     +AL+Y PG++L+ A Y C+  GCIP+T++PP  P  ++ T                            L   + I+     + V+T  A+ K+++++     V L     ++DTDDLPK+R  S   Y+P   + +AY+DFS S  G+  GV+ +HSA   +C++ KLQCE YPSREV + LDPY GLGF +WCL  VY GH S  +PP  LE  P LWL + S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR+  T +F KLF  +GL+ RAVST+FGCRVN+A+CLQG S PD + V+VD  +LR+DRV+L+E+GSPHSL ++ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N+S    V  +        S +L+ G+   V+ARTGYLGF+RRTELT + GERHDA++VVGAL+  + LRGMRYHPIDIE++++R HKS I EC VFTW+ LLVVVVEL+G + EA+DLV +VT+ VLEEHYLIVGVVV+VD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  223 SHPAPPDITSYT----ADPPGVTVE-------------RPQVALPTKPKYGNAELMETG--------DGVPVSSRVSAKIHQLVNTLKRPKRRPLREFFVDDFEELLEVQQPDPSLPRPEGADSLITQGEELCGLKNCPASMEAALQRWGAIAPKAPCLTVTHANTK-QPYTLTYGKLWSRSMKVAYYILHKLGTKQEPIVRPGDRVALVYPNNDPAAFMVAFYGCLLAEVVPVPIEVPLTKKDAGSQQIGFLLGSCGVAVALTSDA----------GDIMQFKGQGFLMISSSRNQGWPKLLWVVTESKHLSKPPREWYPLIKDANNDTAYIEYK-TCKDGSVLGVTVTRMAMLTHCQTLTHTCGYKEAETLVNVLDFKKDVGLWHGILTSVLNMLHVVSVPYALMKVNPLSWIQKVCQYKAKVVCVKSRDLHWALVAHRDQTDMNLSSLRMLLVADGANPWSISSCDAFLNVFQNMGLRSEVICPCASSPEALTVALRRP----------------NES----SLKPMGRGVLSMTGLSHGVIRVDTGEKLSVLTLQDVGSPMPGALVCVVKPEAVPQLCKTDEIGEICVSSIATGTSYYGLTGMTKNTFEVCPVSSSGGLVSECV--FVRSGLLGFVGP---GGAIFVTGKMDGLMQVAGRRHNADDIVATALAVEPMKFVYRGRIAVFSITVLHDERIVVVAEQRPDSTEEESFQWMSRVLQAIDGIHQVGVYCLALVPSNTLPKTPLGGIHLSETKQLFQEGSMHPCNVLMCPHSCVTNLPKPRQK-QPEVGPASVMVGNLVAGKRMAQACGRDLSQGEDNDQFLFLSEVLQWRAQTTPDHILYTLINSRGAVGSSLTCLQLHKRAEKIAAMLFERGQLRDGDHVALVYPPGLDLIAAFYGCLYAGCIPITVRPPH-PQNISTT----------------------------LPTVKMIVEVSRSACVMTTQAICKLLRSKEASAAVDLRSWPPVLDTDDLPKRR--SPLLYKPSDPESLAYLDFSVSTTGMLAGVKMSHSATSALCRSIKLQCELYPSREVAVCLDPYCGLGFVVWCLCSVYAGHQSVLIPPAELEVNPALWLLSVSQFKVRDTFCSYSVMELCTKTLGTLTDSLKARGLDLSRVRTCVVVAEERPRISLTQSFSKLFKDVGLHPRAVSTAFGCRVNLAVCLQGTSGPDPTTVFVDMRALRHDRVRLVERGSPHSLPMMESGKILPGVRIIIANPETKGPIGDSHLGEIWVHSSQNASGYFSVFGEENVRSDHFSARLSFGDTQTVWARTGYLGFLRRTELTDASGERHDALYVVGALDEAMELRGMRYHPIDIETSIIRTHKS-ITECAVFTWTKLLVVVVELDGSEQEALDLVPMVTNVVLEEHYLIVGVVVIVDTGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1575          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Cavefish
Match: dip2ba (disco-interacting protein 2 homolog Ba [Source:NCBI gene;Acc:405899])

HSP 1 Score: 1301.19 bits (3366), Expect = 0.000e+0
Identity = 686/1442 (47.57%), Postives = 941/1442 (65.26%), Query Frame = 3
Query:  888 VPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGP-GYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESK-----------TISQILID----RAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIK----AQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            VPPDVTS  P   +++NS   E+  S +   + R +  +S       V                 V SRVS KIQQL+ TLKRPKR PL E+F +D    V     DPN P+P+G  I P  GE L ++S  P +L++AL  +     K   ++ +D  G+    +LTY KL  R+ ++AY LLNKLG + +  LKP DRVALV+ N+DP  F  AFYGC++A V+P+ IEVPL ++DA  Q +GFLL S  + + LTSE+C K LP+T +GEI+ F GWP+++W+  D    +KPS+DWQP    ++ +  YIEY  A+K+G+V GV VS+ + L HC+ L   C Y EGETLV V + K++ GLWH VLT++   +H + +PY+V+K  P  W++++   KA  A+VK RD+HWA++A ++   I LS LR+L+V+DG+NPWS+++CD F++ F+  GL+   +CPCA S+E MT+++RRP A                    G   P  R +LSM  LS+G++RV++E+  ++LT+QD G ++PG    ++KP+G P LC TDE+GE+ L +   G+ Y+GL G T   F+V P++S G    P G   + R+GLLGF+GP   G L+F+ G  +GL++VSGRRHNADD++AT LAVEP+K V+RGRIAVFS+ +  DERIV+VAE R   SEE +F+WMSRV+QA+D IHQ  +YC+ LVP N LPKTPLGGIH+ +TK+RFLEG L  CN+LLCPH  +TNLPKPR      VGP+++MVG+L+ G R+A A GR++   IE +           T+ Q L +    RA + P+  L+  LN +   VS+ T  QL +RAE+I   L+E+  I     + LLY PGI+L+ + Y C+  GCIPVT++PP           QN T                    +TL   R I++    + +LT  A++K ++    A  V +     +IDTDDLP+KR      Y+P + + +AY+DFS S  G+  GV+ +H+A+  +C++ KLQCE Y SR+V + LDPY G+GF LWCLS VY GH S  +PP  LES   LWL+  S  ++RDTFCSYS +EL TK L     ALK RG++L+C+RS V+VAEERPR   T +F KLF  LGL+ RAVST+FG RVN+AICLQG + PD S VYVD  SLR+DRV+L+E+G+P SL L ESG +LPGVR+ I +PET G   DSHLGEIWV+SP N+S    +  +        + +L+ GE   ++ARTGYLGFVRRTEL  + G+RHDA+FVVG+L+ T+ LRG+RYHPIDIE++V R H+S IAE  VFTW+NLLVVV EL+G + EA+DLV LVT+ VLEEH+LIVGVVV+VD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  110 VPPDVTSTVP---QERNS-RVETGPSPVVRGMSRGQSRSSMMETADGVP----------------VHSRVSTKIQQLLNTLKRPKRPPLTEFFLDDAEQIVEVPQPDPNTPRPEGRQIIPVKGEPLGVVSNWPPALQAALARWGATQAKSPALTALDITGK-PLYTLTYGKLWTRSLKLAYTLLNKLGTKTDPVLKPGDRVALVYPNSDPGMFWVAFYGCLLAEVIPVPIEVPLSQKDAGSQQIGFLLGSCGVSLALTSEVCLKGLPKTPSGEIQQFKGWPRLRWVVTDTKYLTKPSKDWQPHIPTANTDTAYIEYK-ASKEGTVMGVAVSKISMLTHCQALTQACNYGEGETLVNVLDFKKDMGLWHGVLTSVMNRIHTISVPYSVMKACPLSWVQRVHNSKARVALVKCRDLHWAMMAHRDQKDIGLSSLRMLIVADGANPWSVSSCDAFLNVFQSHGLKPEVICPCATSTEAMTVAIRRPGA-------------------RGAPLPA-RAILSMGGLSHGVIRVNTEDKNSALTVQDVGHVMPGALMCIVKPDGPPMLCKTDEIGEIVLNSRAGGTMYYGLPGVTKNTFEVIPVNSGGT---PIGEIPFTRTGLLGFVGP---GSLVFVVGKTEGLLSVSGRRHNADDLVATALAVEPIKTVYRGRIAVFSVTVFYDERIVMVAEQRPDASEEDSFQWMSRVLQAIDGIHQVGLYCLALVPANTLPKTPLGGIHICETKQRFLEGSLHPCNILLCPHTCVTNLPKPRQKQPVGVGPASIMVGNLIAGKRIAQAAGRELGT-IEDQDLSRKLAMWPMTMHQFLSEALQWRAQSDPDHVLYMLLNAKGVAVSTATCLQLHKRAEKITAALLERGGINTGDNVVLLYPPGIDLIASFYGCLYAGCIPVTVRPPHP---------QNLT--------------------ATLPTVRMIIDVSKAACILTTQALMKTLRSKEAAASVNVKTWPTIIDTDDLPRKR--PPQIYKPPTAEMLAYLDFSVSTTGMLTGVKISHAAVSALCRSIKLQCELYSSRQVAICLDPYCGMGFVLWCLSSVYSGHQSILIPPMELESSLPLWLSTLSQYKIRDTFCSYSVMELCTKGLGTQTEALKARGLNLSCVRSCVVVAEERPRQSLTQSFSKLFKDLGLSPRAVSTAFGSRVNLAICLQGTAGPDPSTVYVDMKSLRHDRVRLVERGAPQSLPLTESGTILPGVRVIIVNPETKGPLGDSHLGEIWVTSPHNASGYYTIYGEESLQADHFNTRLSFGEAQTLWARTGYLGFVRRTELLDASGDRHDALFVVGSLDETLELRGLRYHPIDIETSVSRAHRS-IAESAVFTWTNLLVVVAELSGSEQEALDLVPLVTNVVLEEHHLIVGVVVIVDPGVIPINSRGEKQRMHLRDSFLADQLDPIYVAYNM 1470          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Cavefish
Match: dip2bb (disco-interacting protein 2 homolog B-A-like [Source:NCBI gene;Acc:103044253])

HSP 1 Score: 1285.01 bits (3324), Expect = 0.000e+0
Identity = 670/1369 (48.94%), Postives = 917/1369 (66.98%), Query Frame = 3
Query: 1083 VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGP-GYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQR----VTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            VSSRVS KIQQL+ TLKRPKR PL E+F +D+   V     DPN PKP+G  I P  GE L ++S  P +L++AL  +    GK   ++ +D  G+    +LTY KL  R+ ++AY LLNKLG + E  LKP DRVALV+ N+DP  F  AFYGC++A V+P+ IEVPL R+DA    +GFLL S  + + LTSE+C K LP+T  GEI  F GWP+++W+  D    +KPS+DWQP    ++ +  YIEY  A+K+G+V GV VS+ A L HC+ L   C Y EGETLV V + K++ GLWH VLT++   +H + +PYAV+K  P  W++++  HKA  A+VK RD+HWA+++ +E   I+L+ LR+L+V+DG+NPWS+++CD F++ F+  GL+   +CPCA S E MT+++RRP    GV                G   P  R +LSM  LS+G++RV++E+  ++LT+QD G ++PG    ++KP+G P LC TDE+GE+ + +   G+ Y+GL G T   F+V P+++ G    P G   +VRSGLLGF+GP   G L+F+ G  +GL+TVSGRRHNADD++AT LAVEP+K V+RGRIAVFS+ +  DERIVIVAE R   SEE +F+WMSRV+QA+DSIHQ  +YC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CN+L+CPH  +TN+PKPR      VGP+++MVG+LV G R+A A GRD+ + IE +        +++ L  RA   P+  L+  LN +   V + T  QL +RAE+IA  L+E+  I     + LLY PGI+L+ A Y C+  GCIPVT++PP  P  ++ T                            L   R I++    + +LT   ++K+++++     V +     +IDTDDLP+KR      Y+P S + +AY+DFS S  G+  GV+ +H+A+  +C++ KLQCE Y SR++ + LDPY GLGF LWCL+ VY GH S  +PP  LES   LWL+  S  ++RDTFCSYS +EL TK L      LK RG++L C+RS V+VAEERPR+  T +F KLF  LGL+SRAVST+FG RVN+AICLQG + PD S VYVD  SLR+DRV+L+E+G+P SL L+ESG +LPGVR+ I +PET G   DSHLGEIWV SP  ++    +  +        + KL+ G+   ++ARTGYLGFV+RTELT S G+RHDA+FVVG+L+ T+ LRG+RYHPIDIE++V R H+  I E  VFTW+NLLVVV EL G + +A+DLV L+T+ VLEEH+LIVGVVV+VD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  302 VSSRVSTKIQQLLNTLKRPKRPPLSEFFMDDQEEIVEVPRPDPNTPKPEGRQIIPVKGEPLGVVSNWPPALQAALARWGATQGKSPALTALDITGK-PLYTLTYGKLWSRSVKLAYTLLNKLGTKNEQILKPGDRVALVYPNSDPGMFWVAFYGCLLAEVIPVPIEVPLSRKDAGSSQVGFLLGSCGVGLALTSEICLKGLPKTPTGEILQFKGWPRLKWVITDSKYLTKPSKDWQPHIPTANTDTAYIEYK-ASKEGTVMGVAVSKVAMLTHCQALTQACNYCEGETLVNVLDFKKDMGLWHGVLTSVMNRIHTISVPYAVMKACPLSWVQRVHIHKARVALVKCRDLHWAMMSHREQRDISLASLRMLIVADGANPWSVSSCDAFLNVFQAHGLKPEVICPCATSPEAMTVAIRRP----GV---------------PGAPLPA-RAILSMTGLSHGVIRVNTEDKNSALTVQDVGHVMPGALMCIVKPDGPPMLCKTDEIGEIVVNSRAGGNMYYGLSGVTKNTFEVIPVNASGA---PIGEIPFVRSGLLGFVGP---GSLIFVVGKNEGLLTVSGRRHNADDLVATALAVEPVKTVYRGRIAVFSVTVFYDERIVIVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGLYCLALVPANTLPKTPLGGIHISETKQLFLEGSLHPCNILMCPHTCVTNMPKPRQKQPVGVGPASIMVGNLVAGKRIAQAAGRDLGM-IEDQDLVRKHQFLTEALQWRAQTDPDHVLYVLLNAKGVAVCTATCVQLHKRAEKIAAALMERSGINTGENVVLLYPPGIDLIAAFYGCLYAGCIPVTVRPPH-PQNLSAT----------------------------LPTVRMIIDVSKAACILTTQVLMKILRSKEAAVSVNIKTWPIIIDTDDLPRKR--PPTIYKPPSAEMIAYLDFSVSTTGMLTGVKISHAAVSALCRSIKLQCELYSSRQIAICLDPYCGLGFVLWCLASVYSGHQSILIPPLELESSLSLWLSTLSQYRIRDTFCSYSVMELCTKGLGGQTEILKTRGLNLACVRSCVVVAEERPRLALTQSFSKLFKDLGLSSRAVSTAFGSRVNLAICLQGTTGPDPSTVYVDMKSLRHDRVRLVERGAPQSLPLMESGTILPGVRVIIVNPETRGPLGDSHLGEIWVHSPHTATGYYTIYGEESLQADHFNTKLSFGDPQTLWARTGYLGFVKRTELTDSSGDRHDALFVVGSLDETLELRGLRYHPIDIETSVCRAHRG-IGESAVFTWTNLLVVVSELCGSEQDALDLVPLITNVVLEEHHLIVGVVVIVDPGVIPINSRGEKQRMHLRDSFLADQLDPIYVAYNM 1609          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001386.1 (pep scaffold:Pmarinus_7.0:GL477282:11654:68835:-1 gene:ENSPMAG00000001211.1 transcript:ENSPMAT00000001386.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 1244.57 bits (3219), Expect = 0.000e+0
Identity = 653/1387 (47.08%), Postives = 903/1387 (65.10%), Query Frame = 3
Query: 1053 TNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTF------EDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAA-----SKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-----ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVT-LTDGQ---NMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDL-IVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            + NGAV N    S VS KIQQL+ TLKRPKR P+ E + +DE++  L  F      +DPN P+P+G  + P  GE L ++S  P +LE+ALQ +     K   ++ +D+NG+V   +L Y KL  ++ ++A+ LLNKLG + +  LKP DRVALV+ N+DPI F  AFYGC++  +VP+ IEVPL  +D  CQ +GFLL +  + + LTSE+C+K LP+T  G+I  F    KV  + + +         KP  D     +   D  +Y  Y   +KDGSV GV VSR A L HC  L   C Y EGETLV V + KRE GLWH +LT +   +H+V +PY ++K +P  W+++I   KA  A VKSRDM WAL+A KE   + L  LR+L+V+DG+ PWS+ TC+ F+  F+ +GLR  A+CPCA S E +T+S+RRP    G        SG           P     L+++ LSYG++R  ++ S ++L LQD G ++PG  A V++P+G P LC  DEVGE+C+++  T + Y+GL   T   F+V P++  G     +   +VR+GLLGF+G   +GG +F+ G V+G+MT+ GRRH+ADD+IAT LA+EP+K+V RGRI  FS+ +LRDER V+VAE R+  SEE +FKWMS+VIQAVD+IHQ A+YC+V+VP N LPK  LGG+ +++T++RFLEG L  C VL+CPH AITNLP+PR+    ++ P+ MM+G LV G R+A A GRD+  + + +      +S +L  RA  +P+  LF  LN +    S+ T  QL +RAE++A  L EK K+     +AL+Y  G++L+ A + C+  GC+PVTI+PP TP  ++ T                            L   + I+       VLT   ++K+IK++    +TD +    MIDTD+LPKK+L     Y+  + + +AY+DFS S  G+  GV  +H+A   +C++ K+QCE YPSR++ L LDP+ GLGF LWCLSGVY GH S  +PP  LE+ P +WL+A S  ++RDTFCSYS +E  T+ L+    ALK RG++L+ +R+ V+VAEERPR+   ++F KLF  LGL+ RAV  +FGCRVN+AICLQG S PD + VYVD  +LRNDRV+L+EKGSPHSL L+ESGK+LPGVR+ I +PE++G   DS LGEIWV SP  +S       D          +L  G+   V+ARTGYLGF+RRT+LT ++GERHDA++VVG+LE  + LRGMRYHP+DIE++V+R HKS I EC VF W NLLV VVE  G + EA+DLV  VT +VLEEHYL+VGVVV+ D GT+ +NSRGEK+R+ LRD F++DKLDP+YV+YNM
Sbjct:   41 SGNGAVSN----SHVSSKIQQLLNTLKRPKRVPVKELYTDDEDM--LEAFDDPVPVQDPNRPRPEGAEMVPVQGEPLGVVSNWPSALEAALQRWGIQSAKAPCLTALDTNGKVLN-TLAYGKLFSKSRKMAFTLLNKLGTKQDQLLKPGDRVALVYPNSDPIAFTLAFYGCLLGGLVPVPIEVPLTNKDTGCQQIGFLLGTCGVTVALTSELCHKGLPKTPAGDIFQF----KVSVLLLRYATKLGPYIGKPVTDKFIGLKSYCDPYVYSTYK-TSKDGSVMGVAVSRVAMLAHCHGLTQACGYTEGETLVNVLDFKREAGLWHGILTGVMNMMHIVCVPYTLMKANPLSWIQKIHAFKAKLACVKSRDMTWALMAFKEQKDLALGSLRMLVVTDGAYPWSVATCEAFVKTFQGRGLRREAVCPCACSPEALTVSMRRPLTEGG--------SGF---------PPPAHSSLALYGLSYGVIRPATDVSQSALALQDVGNVMPGAIACVVRPDGPPQLCREDEVGEICVRSQATAASYYGLAAITKNTFEVFPVNVVGAPFCEHS--FVRTGLLGFVG---AGGQVFVVGRVEGVMTIGGRRHSADDLIATALAIEPIKVVNRGRIVAFSVTILRDERAVLVAEQRSQASEEESFKWMSQVIQAVDTIHQMALYCVVVVPENSLPKLALGGVDLFETRQRFLEGTLRPCGVLMCPHAAITNLPRPREKQQ-EMAPANMMLGKLVTGKRIAEAIGRDLGQKDDDQARKFLYLSDVLQWRAQTSPDQNLFTLLNAKGAVASTMTCVQLHKRAEKVAVLLTEKGKLSKGDHVALIYPAGLDLIAAFFGCLYAGCVPVTIRPP-TPQNLSTT----------------------------LATVKLIVETSKSVCVLTTQLLMKLIKSKEAAAVTDSKVWPPMIDTDELPKKKL--FQIYKAPTPEMLAYLDFSVSTVGMLAGVNMSHAAASSLCRSIKIQCELYPSRQIALCLDPHCGLGFVLWCLSGVYAGHQSVLIPPAELEANPAVWLSAVSQYKIRDTFCSYSVMEHCTRMLSTQTDALKARGVNLSGVRTCVVVAEERPRIALATSFSKLFKDLGLSLRAVGATFGCRVNLAICLQGTSGPDPTTVYVDMRALRNDRVRLVEKGSPHSLPLMESGKILPGVRVMIVNPESLGPLGDSDLGEIWVQSPHGASGYHSFVGDASLIAGHFDGRLRVGDTHAVWARTGYLGFLRRTDLTDANGERHDALYVVGSLEEAMELRGMRYHPVDIEASVLRAHKS-ITECAVFPWKNLLVAVVEFGGLEQEALDLVAQVTGAVLEEHYLVVGVVVLADPGTVPINSRGEKQRMHLRDGFLDDKLDPIYVAYNM 1360          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002071.1 (pep scaffold:Pmarinus_7.0:GL479928:182456:220195:-1 gene:ENSPMAG00000001878.1 transcript:ENSPMAT00000002071.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 723.391 bits (1866), Expect = 0.000e+0
Identity = 347/715 (48.53%), Postives = 481/715 (67.27%), Query Frame = 3
Query: 1074 NGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGR-IAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSG 3212
            NG+ V+SRVS KIQQL+ TLKRPKR PL E+F +D +  +     DPN PKP+G    P  GE L +++  P SLE+ALQ +A    K   ++ +D+ GR    SLTY    +R  +I  +L+N++  R    L+P +RVALV+ N+DP  F+ AFYGC++  ++P+ IEVP   RDA  Q +GFLL S  I + LTS++C K LP+   GE  +F GWP++ W   D    SKP +DW    R S+ +  YIE    +++G+V GV VSR + L HC+TL  VC Y EG+ L+ V + KR+ GLWH VLT++   +HVV +PYA++K +P  W++++ + KA  A VKSRDMHWA+++ +EH  +NLS LR+L+VSDG+NPWS+++CD F++ F+ +GL+  A+CPCA S E +T+++RRP    G E S                 P GRGVLSMH LS+G++R DSE  L+ LT+QD G ++PG    ++KP+G P LC TDE+GE+C+ +  T S Y+GL G T   F+V P+ + G+ V      ++R+GLLGFLGP    GL+F  G   GLM V+GRRH+ADD+IAT LAVEP+K+V+RGR IAVFS+ +LRD+RIV+VAE R   SE+  F+WMSRV+QA+DSIHQ  VYC+ LVP N LPK PLGG+H+ ++++RFLEG L  CN+L+CPH  +TNLPKPR    G
Sbjct:  208 NGMPVNSRVSSKIQQLLNTLKRPKRPPLKEFFVDDFDELLEVPQPDPNQPKPEGAQTTPVKGEPLGVVTNWPPSLEAALQRWATQSAKALCLTALDTTGRPQ-CSLTYVFFQERFKKILAVLINQITARSSPLLRPGNRVALVYPNSDPAAFVVAFYGCLIGGLIPVPIEVPFTLRDAGSQQIGFLLGSCGISVALTSDVCLKGLPKAPTGETITFKGWPRLTWFVTDSKNLSKPPKDWPANPRESNSDAAYIEKKKTSREGTVVGVAVSRASMLTHCQTLTQVCGYTEGDILINVVDFKRDVGLWHGVLTSVMNMVHVVCVPYALMKANPLSWIQKVCQFKAGVATVKSRDMHWAMMSHREHREVNLSSLRMLVVSDGANPWSVSSCDAFLNTFQSRGLKPDAICPCASSPEALTVAIRRP----GAEGS----------------RPTGRGVLSMHGLSFGVIRADSEEKLSVLTVQDSGNVMPGALMCIVKPDGPPQLCRTDEIGEICVSSRSTASTYYGLPGITKSIFEVFPVSATGSPVSQY--PFIRTGLLGFLGP---NGLMFSVGKTDGLMMVAGRRHSADDVIATALAVEPVKLVYRGRWIAVFSVNVLRDDRIVVVAEQRPEASEDDCFQWMSRVLQAIDSIHQVGVYCLALVPANTLPKCPLGGVHISESRQRFLEGALHPCNILMCPHTCVTNLPKPRQKQPG 896          

HSP 2 Score: 62.3882 bits (150), Expect = 8.816e-10
Identity = 117/547 (21.39%), Postives = 212/547 (38.76%), Query Frame = 3
Query: 3348 TPNSRLFC--QLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTL------IALLY--SPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLT------------CGAVIKVIKAQRVT--LTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFS-WSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERP-RVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLL---ESGKLLPGVRIAIAHPETMGQ-CADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQLSMKLATGEIDGVYA--RTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKI 4892
            T +++  C   L+T  +   S T+   Q R ++I   L+ +    +  L      +AL+Y  S     V A Y C++ G IPV I+ P T   + + G+Q   + F                         ++ +C  S+ LT             G  I      R+T  +TD +N+      P K   ++     +S  + AYI+    S +G  +GV  + +++L  CQ     C +     ++  +D    +G     L+ V        VP  L+++ P  W+      Q +    +  + ++    +++     + R ++L+ LR LV+     P  V S   F   F   GL   A+         + + ++   +  +       +S+      ++   S   L +L   +SG ++PG  + I  P+   Q C    +GEI VSS   +S         ++  ++    ATG     Y   RTG LGF+    L          +F VG  +  +M+ G R+   D+ +T +     K+
Sbjct:  291 TQSAKALCLTALDTTGRPQCSLTYVFFQERFKKILAVLINQITARSSPLLRPGNRVALVYPNSDPAAFVVAFYGCLIGGLIPVPIEVPFT---LRDAGSQQ--IGF-------------------------LLGSCGISVALTSDVCLKGLPKAPTGETITFKGWPRLTWFVTDSKNL----SKPPKDWPANPR---ESNSDAAYIEKKKTSREGTVVGVAVSRASMLTHCQTLTQVCGYTEGDILINVVDFKRDVGLWHGVLTSVMNMVHVVCVPYALMKANPLSWIQKVC--QFKAGVATVKSRDMHWAMMSHR----EHREVNLSSLRMLVVSDGANPWSVSSCDAFLNTFQSRGLKPDAICPCASSPEALTVAIRRPGAEGSRPTGRGVLSMHGLSFGVIRADSEEKLSVLTVQDSGNVMPGALMCIVKPDGPPQLCRTDEIGEICVSSRSTASTYYGLPGITKSIFEVFPVSATGSPVSQYPFIRTGLLGFLGPNGL----------MFSVGKTDGLMMVAGRRHSADDVIATALAVEPVKL 784          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006897.1 (pep scaffold:Pmarinus_7.0:GL489792:1491:6881:-1 gene:ENSPMAG00000006239.1 transcript:ENSPMAT00000006897.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 161.77 bits (408), Expect = 1.030e-45
Identity = 78/174 (44.83%), Postives = 115/174 (66.09%), Query Frame = 3
Query: 1206 DPNAPKPKGTVIEPAIGESLNM-LSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSG 1724
            DPN P+P+G +     GE L   ++  P +LE+AL  +    G+   ++ +D+ G+   ++LTY KL  R+ ++AY LL+KLG + E  LKP D+VALV+ NNDP+ F+ AFYGC++A +VP+ IEVPL R+DA  Q +GFLL S  + + +TS+ CYK LP+T  G+I  F G
Sbjct:    3 DPNQPRPEGAMTSVVRGEPLGAGVTAWPPALEAALHRWGTTSGRMPCLTALDTAGKPT-VTLTYGKLWSRSVKLAYTLLHKLGGKQEALLKPGDKVALVYPNNDPVAFLVAFYGCLLAELVPVPIEVPLTRKDAGSQQIGFLLGSCCVTVAMTSDACYKGLPKTPTGDISQFKG 175          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Yeast
Match: CMR2 (Putative protein of unknown function; deletion causes sensitivity to unfolded protein response-inducing agents [Source:SGD;Acc:S000005619])

HSP 1 Score: 102.064 bits (253), Expect = 5.339e-22
Identity = 86/358 (24.02%), Postives = 156/358 (43.58%), Query Frame = 3
Query: 3924 IGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNC----------------LRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLL---EKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEA-------KKQLSMKLATGEIDGV--YARTGYLGFVRRTELTQSDGE--RHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVV 4907
            I V  THS+LL+  +  K   +   +  +       SGLGF   CL G+Y G  +       + + P  +L       V+D +     +       ++ I   K +  ++N                 +R+++I    RPR+ +  N  K +S + L+   +S  +    N  I L+        ++Y+D  SLR   ++ +   +  + + + + +SG +     +++ +PET+  C D   GEIW  S  N+ D  V N +           +Q   K+ + E++    Y RTG LGF++    T S GE    + +FV+G++  +I + G+ +   D+E TV   H S I  C++
Sbjct: 1187 IHVTMTHSSLLNASKIVKETLQLRNNSPLFSICSHTSGLGFMFSCLLGIYTGASTCLFSLTDVLTDPKEFLIGLQNLNVKDLYLKLETLYALLDRASSLIEGFKNKKENINSAKNNTSGSLREDVFKGVRNIMIPFPNRPRIYTIENILKRYSTISLSCTQISYVYQHHFNPLISLRSYLDIPPVDLYLDPFSLREGIIREVNPNDVSAGNYIKIQDSGVVPVCTDVSVVNPETLLPCVDGEFGEIWCCSEANAFDYFVCNSSKNKLYKDPFITEQFKSKMKS-EVNNTLSYLRTGDLGFIKNVSCTNSQGEVVNLNLLFVLGSIHESIEILGLTHFVSDLERTVKDVH-SDIGSCLI 1542          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Nematostella
Match: EDO28946 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T518])

HSP 1 Score: 358.607 bits (919), Expect = 7.099e-113
Identity = 163/275 (59.27%), Postives = 214/275 (77.82%), Query Frame = 3
Query: 4059 LSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHK 4883
            L  VY GH +  +PP  LE+ P LWL+A +  +VRDTFCSY  ++L TK L  ++PALK +G++L C+R+ V+VAEERPR+  T+ F  LFS LGL+ RAVSTSFGCRVN+AIC QGAS+P+ ++VYVD  +LRNDRV ++E+GSP+SLCLLESGK+LPGV++ IA+PET G CADSHLGEIWV SP N S      ++   +++   ++ TG+    YARTGYLGF++RT+ TQ+DG  HDA+FVVG+LE T+MLRGMRYHP+DIE+TV+RCHK
Sbjct:    1 LVSVYSGHHTILIPPGDLEANPALWLSAVAQYKVRDTFCSYPVMDLCTKGLGQAVPALKAKGVNLACVRNCVVVAEERPRITLTTAFSHLFSSLGLSPRAVSTSFGCRVNVAICTQGASTPEATSVYVDTRALRNDRVTIVERGSPNSLCLLESGKILPGVKVVIANPETRGMCADSHLGEIWVCSPHNGSGYYTAGEDKMTEERFGARMTTGDTVTQYARTGYLGFIKRTDFTQTDGAMHDAMFVVGSLEETMMLRGMRYHPVDIENTVIRCHK 275          

HSP 2 Score: 68.5514 bits (166), Expect = 3.541e-12
Identity = 74/304 (24.34%), Postives = 128/304 (42.11%), Query Frame = 3
Query: 1998 LTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVK-------SRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGV-LSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYW--GLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLG----PAKSGGL---LFICGSVQGLMTVSGRRHNADDIIATVL 2858
            L ++Y+G H + IP   L+ +PA+WL  + ++K              ++ +  A+ A K    +NL+C+R  +V     P  +     F   F   G                 LS R  +  +G   +  + +        G ++P    V +   +L    V +    S  SL L + G+ILPG K V+  P  +  +C    +GE+ + + + GSGY+  G    T   F  +   + G+ V      Y R+G LGF+         G +   +F+ GS++  M + G R++  DI  TV+
Sbjct:    1 LVSVYSGHHTILIPPGDLEANPALWLSAVAQYKVRDTFCSYPVMDLCTKGLGQAVPALKAKG-VNLACVRNCVVVAEERP-RITLTTAFSHLFSSLG-----------------LSPRAVSTSFGCRVNVAICT-------QGASTPEATSVYVDTRALRNDRVTIVERGSPNSLCLLESGKILPGVKVVIANPE-TRGMCADSHLGEIWVCSPHNGSGYYTAGEDKMTEERFGARM--TTGDTVTQ----YARTGYLGFIKRTDFTQTDGAMHDAMFVVGSLEETMMLRGMRYHPVDIENTVI 271          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Nematostella
Match: EDO28945 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T517])

HSP 1 Score: 123.25 bits (308), Expect = 1.299e-32
Identity = 60/131 (45.80%), Postives = 81/131 (61.83%), Query Frame = 3
Query: 1608 CQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVL 2000
            CQ +GFLL S  +   LT+E C KSLP+   G++ SF GWPK+QW   ++ +   P +DWQPP  +      YIE S   +DG+V GVTV+R +   H +TL   C Y EGE ++ V + KRE GLWHSV+
Sbjct:    2 CQQIGFLLGSCGVSWGLTTEACLKSLPKNEAGQVCSFKGWPKLQWFITENLSRPTP-KDWQPPTNMDRSSPAYIE-SLLGRDGAVMGVTVTRMSMALHSQTLTQACDYVEGEVMISVLDSKREVGLWHSVM 130          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Medaka
Match: ENSORLT00000002992.2 (disco-interacting protein 2 homolog C [Source:NCBI gene;Acc:105356645])

HSP 1 Score: 1353.58 bits (3502), Expect = 0.000e+0
Identity = 715/1434 (49.86%), Postives = 967/1434 (67.43%), Query Frame = 3
Query:  882 HGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT---ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLT-DGQN---MIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQ---LSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            H  PPDVT ++ ++    +S       S++G   R ++       + G+   ++TG        +G+ VSSRVS KIQQLV TLK+P+R PL E+F +D +  +     DPN P+P+G  + P  GE L +++  P SLE+ALQ +     K   ++ +D+ G+   + LTY KL  R+ ++AY +L+KLG + E  ++P DRVALV+ NNDP+ F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ WI  +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ +PY+++KV+P  W++++ + KA  A VKSRDMHWAL+A K+   INLS LR+LLV+DGSNPWS+++CD F++ F+ KGLR+  +CPCA S E +T+++RRP     VEDS               + P GRGVLSM  LSYG+VRVD+E  L+ LT+QD G ++PGG   V+KP G P LC TDE+GE+C+ +  TG+ Y+GL G T   F+V P+ S G ++      +VR+ LLGF+GP   GGL+FI G + GL+ VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +LRDERIV+VAE R   +EE +F+WMSRV+QA+DSIH   V+C+ LVP N LPKTPLGGIH+ + K+ +LEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+    ++     +S++L  RA  TP+  L+  L++R    SS T  QL +RAER+A  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  ++ T                            L   + I+   + + V+T   + K+++++  T T D +N   ++DTDDLPKK+  +   Y+P + D +AY+DFS S  G+  GV+ +H+A+   C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE+ P LWL A S  +VRDTFCSYS +EL TK L     ALK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ R+VSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N S     +  GE   Q    + +L+ G+   V+ARTGYLGF+RRTELT + GERHDA+FVVGALE  + LRGMRYHPIDIE++V+R HKS I EC VFTW+NLLVVVVEL G + EA+DLV +VT +VLEEHYLIVGVVVV D G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  246 HSAPPDVTGYSSDS---SHSHVERHHMSNMGTIARNTQ-------KYGNAERMETG--------DGVPVSSRVSAKIQQLVNTLKQPRRPPLREFFVDDFDELLEVQQPDPNQPRPEGAEMMPVRGEPLGVVTNWPPSLEAALQRWGTISPKAPCLTSLDTAGKPLYV-LTYGKLWSRSIKLAYNILHKLGSKQEPMVRPGDRVALVYPNNDPVAFMVAFYGCLLAEVVPVPIEVPLSRKDAGSQQIGFLLGSCGVAVALTSDACHKGLPKSATGEIPQFKGWPKLLWIVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQSCSYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISVPYSLMKVNPLSWIQKVCQFKAKVACVKSRDMHWALVAHKDQKDINLSSLRMLLVADGSNPWSISSCDAFLNVFQTKGLRAEVICPCASSPEALTVAIRRP-----VEDS---------------SQPPGRGVLSMQGLSYGVVRVDTEERLSVLTVQDVGTVIPGGLVCVVKPEGVPQLCQTDEIGELCVCSIATGTSYYGLTGMTKNTFEVFPVSSSGGLISEYA--FVRTSLLGFIGP---GGLVFITGKMDGLIMVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLRDERIVVVAEQRPDSTEEDSFQWMSRVLQAIDSIHGVGVFCLALVPANTLPKTPLGGIHLSEIKQLYLEGGLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLGQTDDNDQFLFLSEVLQWRAQTTPDHVLYTLLSSRGAVSSSLTCLQLHKRAERVAALLMERGGLQEGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNISTT----------------------------LPTVKMIVEVSHSACVMTTAVICKLLRSKEATATVDIRNWPPVLDTDDLPKKKAPA--LYKPTNPDGLAYLDFSVSTTGMLAGVQMSHNAVGAFCRSVKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPVELETNPALWLLAVSQLRVRDTFCSYSVMELCTKGLGLQTEALKARGLDLSRVRACVVVAEERPRMALTHSFSKLFKDLGLHPRSVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNGSGYY--SGYGEEVLQSDHFNSRLSFGDTQTVWARTGYLGFLRRTELTDAHGERHDALFVVGALEEAMELRGMRYHPIDIETSVIRAHKS-IMECAVFTWTNLLVVVVELEGSEQEALDLVPMVTKAVLEEHYLIVGVVVVTDVGVIPINSRGEKQRMHLRDGFLQDQLDPIYVAYNM 1599          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Medaka
Match: dip2ca (disco interacting protein 2 homolog C [Source:NCBI gene;Acc:101156198])

HSP 1 Score: 1332.01 bits (3446), Expect = 0.000e+0
Identity = 718/1435 (50.03%), Postives = 947/1435 (65.99%), Query Frame = 3
Query:  891 PPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPS---QTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT-------ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLT----DGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            PPDVT +T       N+ T         D I+  R   S  S   QT    + +   T +G      VSSRVS KIQQLV TLKRPKR PL E+F +D    +     DPN PK +G  +    GE L +++  P SLE+ALQ +     K   ++ +D+NG+   + LTY KL  R+ ++AY LL+KLG + E  ++P DRVALVF NNDP  F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GE++ F GWPKV W   +    SKP RDW P  + +  +  YIEY    KDG V GVTV+R A L HC++L   C Y E ET+V V + K++ GLWH+V T++   +HV+ IPYA++KV+P  W++++  +KA  A VKSRDMHWAL+A ++   +NLS LR+L+V+DGSNPWS+++CD F++ F+ KGL+   +CPCA S E +T++++RP                   LE G ++P GRG+LSM  LS+G++RVDSE  L+ LTLQD G ++PGG   V+K  G P LC TDE+GE+C+    TG+ Y+GL G T   F+V PL + G+ +  + P + R+GLLGF+GPA   GL+F+ G + GLM V GRRHNADDI+AT LAVEPMK V+RGRIAVFSI +L DERIV+VAE R   +EE +F+WMSRV+QA+DSIHQ  VYC+ LVP N LPKTPLGGIH+ +TK+ FLEG L  CNVL+CPH  + NLPKPR     ++GP+++MVG+LV G R+A A GRD+  +IE          +S++L  RA  TP+  L+  LN+R    SS T  QL +RAE+IA  L E+  +     IAL+Y PGI+L+ A Y C+  GC+P+T++PP  P  ++ T                            L   + I+       V+T   + K+++++  + T        +IDTDDLPKK+      ++P + D +AY+DFS S  G+  GV+ +H+A    C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE  P LWL+A S  +VRDTFCSYS +EL TK L     +LK RG+ L+ +R+ V+VAEERPR   T +F KLF  LGL+ RAVSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   +SHLGEIWV S  N+S    V  D        S +L+ G+   V+ARTGYLGF+RRTELT + GERHDA++VVGALE  + LRGMRYHPIDIE++V+R HKS I EC VFTW+NLLVVVVEL+G + EA+DLV LVT+ VLEEHYLIVGVVVVVD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:    2 PPDVTGYT-------NTTT---------DGIQVERAPVSVTSAQRQTPKYGNAELMDTGDGVP----VSSRVSAKIQQLVNTLKRPKRPPLREFFVDDFEELLEVQQPDPNQPKAEGAQMVAVQGEKLGVVTNWPPSLEAALQRWGTISPKAPCLTTMDTNGKPLYV-LTYGKLWSRSVKVAYNLLHKLGTKQEPLVRPGDRVALVFPNNDPGAFMTAFYGCLLAEVVPVPIEVPLSRKDAGSQQIGFLLGSCGVTVALTSDACHKGLPKSPTGEVQQFRGWPKVLWFVTESKHLSKPPRDWFPYIKEATQDTAYIEYK-TCKDGGVLGVTVTRIAMLTHCQSLTQSCSYTEAETIVNVLDFKKDVGLWHAVQTSVMNMMHVISIPYALMKVNPLSWIQKVCLYKAKVACVKSRDMHWALVAHRDQRDVNLSSLRMLVVADGSNPWSISSCDAFLNVFQTKGLKPEVICPCASSPEALTVAIQRP-------------------LEEG-STPPGRGILSMQGLSHGVIRVDSEEKLSVLTLQDVGSVMPGGVMCVVKLEGVPQLCKTDEIGELCVCTVATGTSYYGLSGMTKNTFEVFPLANDGSSIS-DLP-FTRTGLLGFIGPA---GLIFVAGKMDGLMVVGGRRHNADDIVATALAVEPMKFVYRGRIAVFSITVLHDERIVVVAEQRPDSTEEDSFQWMSRVLQAIDSIHQVGVYCLALVPSNTLPKTPLGGIHLSETKQLFLEGALHPCNVLMCPHTCVINLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLG-QIEDNDQARKFLFLSEVLQWRAQTTPDHVLYTLLNSRGTIASSLTCVQLHKRAEKIAAILAERGPLQDGDHIALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNISTT----------------------------LPTVKMIVEVSRSVCVMTTQVISKLLRSKEASATVDIRTWPPIIDTDDLPKKK--PPLLHKPSNADTLAYLDFSVSTTGMLAGVKMSHAATSAFCRSIKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPSELEVNPALWLSAVSQYKVRDTFCSYSVMELCTKGLGLQTDSLKSRGLDLSRVRTCVVVAEERPRTALTQSFSKLFKDLGLHPRAVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLSLMESGKILPGVRIIIANPETKGPMGESHLGEIWVHSGHNASGYFTVYGDEALQSDHFSSRLSFGDTQTVWARTGYLGFLRRTELTDASGERHDALYVVGALEEAMELRGMRYHPIDIETSVIRTHKS-ITECAVFTWTNLLVVVVELDGSEQEALDLVPLVTNVVLEEHYLIVGVVVVVDIGVIPINSRGEKQRMHLRDGFLADQLDPIYVAYNM 1355          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Medaka
Match: ENSORLT00000028714.1 (disco-interacting protein 2 homolog C [Source:NCBI gene;Acc:105356645])

HSP 1 Score: 1311.98 bits (3394), Expect = 0.000e+0
Identity = 707/1434 (49.30%), Postives = 955/1434 (66.60%), Query Frame = 3
Query:  882 HGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGL-VSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT---ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLT-DGQN---MIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQ---LSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            H  PPDVT ++ ++    +S       S++G   R ++       + G+   ++TG        +G+ VSSRVS KIQQLV TLK+P+R PL E+F +D +  +     DPN P+P+G  + P  GE L +++  P SLE+ALQ +     K   ++ +D+ G+   + LTY KL  R+ ++AY +L+KLG + E  ++P DRVALV+ NNDP+ F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ WI  +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E         L+ + G   SV+      +HV+ +PY+++KV+P  W++++ + KA  A VKSRDMHWAL+A K+   INLS LR+LLV+DGSNPWS+++CD F++ F+ KGLR+  +CPCA S E +T+++RRP     VEDS               + P GRGVLSM  LSYG+VRVD+E  L+ LT+QD G ++PGG   V+KP G P LC TDE+GE+C+ +  TG+ Y+GL G T   F+V P+ S G ++      +VR+ LLGF+GP   GGL+FI G + GL+ VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +LRDERIV+VAE R   +EE +F+WMSRV+QA+DSIH   V+C+ LVP N LPKTPLGGIH+ + K+ +LEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+    ++     +S++L  RA  TP+  L+  L++R    SS T  QL +RAER+A  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  ++ T                            L   + I+   + + V+T   + K+++++  T T D +N   ++DTDDLPKK+  +   Y+P + D +AY+DFS S  G+  G+  +H+A+   C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE+ P LWL A S  +VRDTFCSYS +EL TK L     ALK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ R+VSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N S     +  GE   Q    + +L+ G+   V+ARTGYLGF+RRTELT + GERHDA+FVVGALE  + LRGMRYHPIDIE++V+R HKS I EC VFTW+NLLVVVVEL G + EA+DLV +VT +VLEEHYLIVGVVVV D G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  211 HSAPPDVTGYSSDS---SHSHVERHHMSNMGTIARNTQ-------KYGNAERMETG--------DGVPVSSRVSAKIQQLVNTLKQPRRPPLREFFVDDFDELLEVQQPDPNQPRPEGAEMMPVRGEPLGVVTNWPPSLEAALQRWGTISPKAPCLTSLDTAGKPLYV-LTYGKLWSRSIKLAYNILHKLGSKQEPMVRPGDRVALVYPNNDPVAFMVAFYGCLLAEVVPVPIEVPLSRKDAGSQQIGFLLGSCGVAVALTSDACHKGLPKSATGEIPQFKGWPKLLWIVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQSCSYTEDHR----ERLRLQEGRGASVMNM----MHVISVPYSLMKVNPLSWIQKVCQFKAKVACVKSRDMHWALVAHKDQKDINLSSLRMLLVADGSNPWSISSCDAFLNVFQTKGLRAEVICPCASSPEALTVAIRRP-----VEDS---------------SQPPGRGVLSMQGLSYGVVRVDTEERLSVLTVQDVGTVIPGGLVCVVKPEGVPQLCQTDEIGELCVCSIATGTSYYGLTGMTKNTFEVFPVSSSGGLISEYA--FVRTSLLGFIGP---GGLVFITGKMDGLIMVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLRDERIVVVAEQRPDSTEEDSFQWMSRVLQAIDSIHGVGVFCLALVPANTLPKTPLGGIHLSEIKQLYLEGGLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLGQTDDNDQFLFLSEVLQWRAQTTPDHVLYTLLSSRGAVSSSLTCLQLHKRAERVAALLMERGGLQEGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNISTT----------------------------LPTVKMIVEVSHSACVMTTAVICKLLRSKEATATVDIRNWPPVLDTDDLPKKK--APALYKPTNPDGLAYLDFSVSTTGMLAGM--SHNAVGAFCRSVKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPVELETNPALWLLAVSQLRVRDTFCSYSVMELCTKGLGLQTEALKARGLDLSRVRACVVVAEERPRMALTHSFSKLFKDLGLHPRSVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNGSGYY--SGYGEEVLQSDHFNSRLSFGDTQTVWARTGYLGFLRRTELTDAHGERHDALFVVGALEEAMELRGMRYHPIDIETSVIRAHKS-IMECAVFTWTNLLVVVVELEGSEQEALDLVPMVTKAVLEEHYLIVGVVVVTDVGVIPINSRGEKQRMHLRDGFLQDQLDPIYVAYNM 1554          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Medaka
Match: ENSORLT00000034729.1 (disco-interacting protein 2 homolog C [Source:NCBI gene;Acc:105356645])

HSP 1 Score: 1311.98 bits (3394), Expect = 0.000e+0
Identity = 679/1325 (51.25%), Postives = 910/1325 (68.68%), Query Frame = 3
Query: 1206 DPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKT---ISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLT-DGQN---MIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQ---LSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            DPN P+P+G  + P  GE L +++  P SLE+ALQ +     K   ++ +D+ G+   + LTY KL  R+ ++AY +L+KLG + E  ++P DRVALV+ NNDP+ F+ AFYGC++A VVP+ IEVPL R+DA  Q +GFLL S  + + LTS+ C+K LP++  GEI  F GWPK+ WI  +    SKP RDW P  + ++++  YIEY    KDGSV GVTV+R A L HC+ L   C Y E ET+V V + K++ GLWH +LT++   +HV+ +PY+++KV+P  W++++ + KA  A VKSRDMHWAL+A K+   INLS LR+LLV+DGSNPWS+++CD F++ F+ KGLR+  +CPCA S E +T+++RRP     VEDS               + P GRGVLSM  LSYG+VRVD+E  L+ LT+QD G ++PGG   V+KP G P LC TDE+GE+C+ +  TG+ Y+GL G T   F+V P+ S G ++      +VR+ LLGF+GP   GGL+FI G + GL+ VSGRRHNADDI+AT LAVEPMK V+RGRIAVFS+ +LRDERIV+VAE R   +EE +F+WMSRV+QA+DSIH   V+C+ LVP N LPKTPLGGIH+ + K+ +LEG L  CNVL+CPH  +TNLPKPR     ++GP+++MVG+LV G R+A A GRD+    ++     +S++L  RA  TP+  L+  L++R    SS T  QL +RAER+A  L+E+  +     +AL+Y PGI+L+ A Y C+  GC+P+T++PP  P  ++ T                            L   + I+   + + V+T   + K+++++  T T D +N   ++DTDDLPKK+  +   Y+P + D +AY+DFS S  G+  GV+ +H+A+   C++ KLQCE YPSREV + LDPY GLGF LWCL  VY GH S  +PP  LE+ P LWL A S  +VRDTFCSYS +EL TK L     ALK RG+ L+ +R+ V+VAEERPR+  T +F KLF  LGL+ R+VSTSFGCRVN+AICLQG S PD + VYVD  +LR+DRV+L+E+GSPHSL L+ESGK+LPGVRI IA+PET G   DSHLGEIWV S  N S     +  GE   Q    + +L+ G+   V+ARTGYLGF+RRTELT + GERHDA+FVVGALE  + LRGMRYHPIDIE++V+R HKS I EC VFTW+NLLVVVVEL G + EA+DLV +VT +VLEEHYLIVGVVVV D G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  297 DPNQPRPEGAEMMPVRGEPLGVVTNWPPSLEAALQRWGTISPKAPCLTSLDTAGKPLYV-LTYGKLWSRSIKLAYNILHKLGSKQEPMVRPGDRVALVYPNNDPVAFMVAFYGCLLAEVVPVPIEVPLSRKDAGSQQIGFLLGSCGVAVALTSDACHKGLPKSATGEIPQFKGWPKLLWIVTESKHLSKPPRDWFPHIKDANNDTAYIEYK-TCKDGSVLGVTVTRIALLTHCQALTQSCSYTEAETIVNVLDFKKDVGLWHGILTSVMNMMHVISVPYSLMKVNPLSWIQKVCQFKAKVACVKSRDMHWALVAHKDQKDINLSSLRMLLVADGSNPWSISSCDAFLNVFQTKGLRAEVICPCASSPEALTVAIRRP-----VEDS---------------SQPPGRGVLSMQGLSYGVVRVDTEERLSVLTVQDVGTVIPGGLVCVVKPEGVPQLCQTDEIGELCVCSIATGTSYYGLTGMTKNTFEVFPVSSSGGLISEYA--FVRTSLLGFIGP---GGLVFITGKMDGLIMVSGRRHNADDIVATALAVEPMKFVYRGRIAVFSVTVLRDERIVVVAEQRPDSTEEDSFQWMSRVLQAIDSIHGVGVFCLALVPANTLPKTPLGGIHLSEIKQLYLEGGLHPCNVLMCPHTCVTNLPKPRQK-QPEIGPASVMVGNLVSGKRIAQASGRDLGQTDDNDQFLFLSEVLQWRAQTTPDHVLYTLLSSRGAVSSSLTCLQLHKRAERVAALLMERGGLQEGDHVALVYPPGIDLIAAFYGCLYAGCVPITVRPPH-PQNISTT----------------------------LPTVKMIVEVSHSACVMTTAVICKLLRSKEATATVDIRNWPPVLDTDDLPKKKAPA--LYKPTNPDGLAYLDFSVSTTGMLAGVQMSHNAVGAFCRSVKLQCELYPSREVAICLDPYCGLGFVLWCLCSVYSGHQSILIPPVELETNPALWLLAVSQLRVRDTFCSYSVMELCTKGLGLQTEALKARGLDLSRVRACVVVAEERPRMALTHSFSKLFKDLGLHPRSVSTSFGCRVNLAICLQGTSGPDPTTVYVDMRALRHDRVRLVERGSPHSLPLMESGKILPGVRIIIANPETKGPLGDSHLGEIWVHSAHNGSGYY--SGYGEEVLQSDHFNSRLSFGDTQTVWARTGYLGFLRRTELTDAHGERHDALFVVGALEEAMELRGMRYHPIDIETSVIRAHKS-IMECAVFTWTNLLVVVVELEGSEQEALDLVPMVTKAVLEEHYLIVGVVVVTDVGVIPINSRGEKQRMHLRDGFLQDQLDPIYVAYNM 1559          
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Medaka
Match: dip2ba (disco-interacting protein 2 homolog B-A [Source:NCBI gene;Acc:101163572])

HSP 1 Score: 1298.11 bits (3358), Expect = 0.000e+0
Identity = 683/1469 (46.49%), Postives = 951/1469 (64.74%), Query Frame = 3
Query:  786 PRPQPRPRLTVVVKDSESIASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTG--GTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGP-GYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDI-SVEIES-----KTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIK----AQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSD-LIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            P+ QP+P+  V +     +A     +R +N    VPPDVTS TP                      R +R D   P +  S    ++    T +G  +   VSSRVS KIQQL+ TLKRPKR PL E+F +D    V     DPN PKP+G  I P  GE L ++S  P +L++AL  +     K   ++ +D  G+    +LTY KL  R+ ++AY LLNKLG + E  L+P DRVALV+ N+DP  F  AFYGC++A V+P+ IEVPL R+DA  Q +GFLL S  + + LTSE+C K LP+T NGEI  F GWP+++W+  D    +KPS+DWQP    ++ +  YIEY   +K+G+V GV VS+ + L HC+ L   C Y+EGE LV V + K++ GLWH VLT++   +H + +PYAV+K  P  W++++  HKA  A+VK RD+HWA++A K+    NLS +R+L+V+DG+NPWS+++CD F++ F+  GL+    CPCA S E +T+++RRP A                    G   P  R +LSM  LS+G++RV++E+  ++LT+QD G I+PG    ++KP+GSP LC TDE+GE+ + +   G+ Y+GL G T   F+V P++  G    P G   + R+GLLGF+GP   G L+F+ G  +GL+TVSGRRH+ADD++AT LAVEP+K V+RGRIAVFS+ +  DERIVIVAE R   SEE +F+WMSRV+QA+DSIHQ  +YC+ LVP N LPKTPLGGI +Y+TK+ FL+G L  CN+L+CPH  +TN+PKPR      VGP++M+VG+LV G R+A A GR++ +VE +      + +S+ L  RA   P+  L+  LN +   V + T +QL +RAE+I   L+E+  +     + LLY PGI+L+ A Y C+  G IPVT++PP  P  +  T                            L   R I++    + +LT   ++++++    A  V +     +IDTDDLP+KR      Y+P + + +AY+DFS S  G+  GV+ +H+A+  +C++ KLQCE Y SR++ + LDPY GLGF LWCLS VY GH S  +PP  LES   +WL+  S  ++RDTFCSYS +EL TK L      LK RG++L+C+RS V++AEERPR+  + +F KLF  LGL+ RAVST+FG RVN+AICLQG + PD S VYVD  SLR+DRV+L+E+G+P S+ L+ESG +LPGVR+ I +PET G   DSHLGEIWV+SP N+S    +  +        + KL+ G+   ++ARTGYLGF++RTEL  + G+RHDA+FVVG+L+ T+ LRG+RYHPIDIE++V R H+S IAE  VFTW+NLLVVV EL+G + EA+DLV LVT+ VLEEH+LIVGVVV+VD G I +NSRGEK+R+ LRD F+ D+LDP+YV+YNM
Sbjct:  201 PKTQPQPQPAVSL-----LADVLAHTRMENS---VPPDVTSSTPQE--------------------RGTRVDIPPPVRGMSRGQSRSSMLDTADGKRKGVPVSSRVSTKIQQLLNTLKRPKRPPLSEFFLDDSEEIVEVPQLDPNTPKPEGRQIIPVKGEPLGVVSNWPPALQAALARWGATQAKSPALTALDITGK-PLYTLTYGKLWSRSLKLAYTLLNKLGTKAEPVLQPGDRVALVYPNSDPGMFWIAFYGCLLAEVIPVPIEVPLSRQDAGSQQIGFLLGSCGVSLALTSEVCLKGLPKTQNGEIIQFKGWPRMKWVVTDTKYLTKPSKDWQPHIPTANTDTAYIEYK-TSKEGTVMGVAVSKISMLTHCQALTQACNYSEGENLVNVLDCKKDMGLWHGVLTSVMNRIHTIAVPYAVMKACPMSWVQRVHIHKARVALVKCRDLHWAMMANKDQKDSNLSSIRMLIVADGANPWSVSSCDAFLNVFQPLGLKPEVFCPCATSPEALTVAIRRPGA-------------------RGAPLPA-RAILSMGGLSHGVIRVNTEDKNSALTVQDVGHIMPGALMCIVKPDGSPQLCKTDEIGEIVINSRAGGTMYYGLPGVTKNTFEVIPVNQAGA---PIGEVPFTRTGLLGFVGP---GSLVFVVGKNEGLLTVSGRRHSADDLVATALAVEPVKTVYRGRIAVFSVTVFYDERIVIVAEQRPDASEEDSFQWMSRVLQAIDSIHQVGLYCLALVPANTLPKTPLGGIQIYETKQNFLDGNLHPCNILMCPHTCVTNMPKPRQKQPVDVGPASMLVGNLVAGKRIAQAIGRELGTVEDQDLIRKHQFLSEALQWRAQTDPDHVLYVLLNAKGVPVCTATCAQLHKRAEKITATLMERGGLNTGDNVVLLYPPGIDLIAAFYGCLYAGVIPVTVRPPH-PQNLAAT----------------------------LPTVRMIIDVSKAACILTTQPLMRILRSREAAASVNVKTWPTIIDTDDLPRKR--PPQIYKPPTAEMLAYLDFSVSTTGMLTGVKMSHAAVSTLCRSIKLQCELYSSRQIAICLDPYCGLGFVLWCLSSVYSGHQSILIPPMELESSLAVWLSTLSQYKIRDTFCSYSVMELCTKGLGTQTEMLKTRGLNLSCVRSCVVIAEERPRLALSQSFSKLFKDLGLSPRAVSTAFGSRVNLAICLQGTAGPDPSTVYVDMKSLRHDRVRLVERGAPQSIPLMESGTILPGVRVIIVNPETKGPLGDSHLGEIWVNSPHNASGYYTIYGEESLQADHFNTKLSFGDPQTLWARTGYLGFIKRTELLDASGDRHDALFVVGSLDETLELRGLRYHPIDIETSVSRAHRS-IAESAVFTWTNLLVVVAELSGSEQEALDLVPLVTNVVLEEHHLIVGVVVIVDPGVIPINSRGEKQRMHLRDSFLADQLDPIYVAYNM 1581          
BLAST of Disco-interacting protein 2 homolog C vs. Planmine SMEST
Match: SMESG000017043.1 (SMESG000017043.1)

HSP 1 Score: 3312.32 bits (8587), Expect = 0.000e+0
Identity = 1689/1690 (99.94%), Postives = 1690/1690 (100.00%), Query Frame = 3
Query:   81 MDLSNHAEYSNXXXXXXXXXXXXXXXGDITEKGFLKKKALLLQKYSKDQNVEISDHNITHGYPGIMNPPQIDMKGDSINEAPVTRKKDGRRYTRDESRYRSAQSRHLELRDSYSGGDIREEAVREALAKHKGQEALVPSKRKEPLSISSEDDPKRISGLGGPSFRNPESRLQXXXXXXXXXXXXXXXXXXXXGSTRHRIKLIDTPSAPSSQAASHKSPRVSRRDAATSQQQSSNLPRPQPRPRLTVVVKDSESIASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            MDLSNHAEYSNEILEKIRELELELSEGDITEKGFLKKKALLLQKYSKDQNVEISDHNITHGYPGIMNPPQIDMKGDSINEAPVTRKKDGRRYTRDESRYRSAQSRHLELRDSYSGGDIREEAVREALAKHKGQEALVPSKRKEPLSISSEDDPKRISGLGGPSFRNPESRLQEHDSDSEDDEEDDTTNLSSDGSTRHRIKLIDTPSAPSSQAASHKSPRVSRRDAATSQQQSSNLPRPQPRPRLTVVVKDSESIASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTT+SITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNTSQTISSSSTSVDAVASTLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNLLVVVVELNGEDWEAVDLVHLVTSSVLEEHYLIVGVVVVVDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM
Sbjct:    1 MDLSNHAEYSNEILEKIRELELELSEGDITEKGFLKKKALLLQKYSKDQNVEISDHNITHGYPGIMNPPQIDMKGDSINEAPVTRKKDGRRYTRDESRYRSAQSRHLELRDSYSGGDIREEAVREALAKHKGQEALVPSKRKEPLSISSEDDPKRISGLGGPSFRNPESRLQEHDSDSEDDEEDDTTNLSSDGSTRHRIKLIDTPSAPSSQAASHKSPRVSRRDAATSQQQSSNLPRPQPRPRLTVVVKDSESIASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTDSITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNTSQTISSSSTSVDAVASTLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNLLVVVVELNGEDWEAVDLVHLVTSSVLEEHYLIVGVVVVVDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 1690          
BLAST of Disco-interacting protein 2 homolog C vs. Planmine SMEST
Match: SMESG000017043.1 (SMESG000017043.1)

HSP 1 Score: 3273.41 bits (8486), Expect = 0.000e+0
Identity = 1674/1690 (99.05%), Postives = 1675/1690 (99.11%), Query Frame = 3
Query:   81 MDLSNHAEYSNXXXXXXXXXXXXXXXGDITEKGFLKKKALLLQKYSKDQNVEISDHNITHGYPGIMNPPQIDMKGDSINEAPVTRKKDGRRYTRDESRYRSAQSRHLELRDSYSGGDIREEAVREALAKHKGQEALVPSKRKEPLSISSEDDPKRISGLGGPSFRNPESRLQXXXXXXXXXXXXXXXXXXXXGSTRHRIKLIDTPSAPSSQAASHKSPRVSRRDAATSQQQSSNLPRPQPRPRLTVVVKDSESIASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNXXXXXXXXNGEDWEAVDLVHLVTSSVLEEHYLIXXXXXXXDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 5150
            MDLSNHAEYSNEILEKIRELELELSEGDITEKGFLKKKALLLQKYSKDQNVEISDHNITHGYPGIMNPPQIDMKGDSINEAPVTRKKDGRRYTRDESRYRS               DIREEAVREALAKHKGQEALVPSKRKEPLSISSEDDPKRISGLGGPSFRNPESRLQEHDSDSEDDEEDDTTNLSSDGSTRHRIKLIDTPSAPSSQAASHKSPRVSRRDAATSQQQSSNLPRPQPRPRLTVVVKDSESIASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTT+SITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNTSQTISSSSTSVDAVASTLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNLLVVVVELNGEDWEAVDLVHLVTSSVLEEHYLIVGVVVVVDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM
Sbjct:    1 MDLSNHAEYSNEILEKIRELELELSEGDITEKGFLKKKALLLQKYSKDQNVEISDHNITHGYPGIMNPPQIDMKGDSINEAPVTRKKDGRRYTRDESRYRS---------------DIREEAVREALAKHKGQEALVPSKRKEPLSISSEDDPKRISGLGGPSFRNPESRLQEHDSDSEDDEEDDTTNLSSDGSTRHRIKLIDTPSAPSSQAASHKSPRVSRRDAATSQQQSSNLPRPQPRPRLTVVVKDSESIASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTDSITSSIGDNIRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAYLLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNTSQTISSSSTSVDAVASTLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLPKKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQLSMKLATGEIDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSNLLVVVVELNGEDWEAVDLVHLVTSSVLEEHYLIVGVVVVVDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM 1675          
BLAST of Disco-interacting protein 2 homolog C vs. Planmine SMEST
Match: SMESG000053080.1 (SMESG000053080.1)

HSP 1 Score: 607.831 bits (1566), Expect = 0.000e+0
Identity = 404/1326 (30.47%), Postives = 679/1326 (51.21%), Query Frame = 3
Query: 1098 SEKIQQLVQTLKRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSGLPRSLESALQSYAQAHGKQSVMSCIDSNGR-VNGISLTYTKLLQRANRIAYLLLNKLGHRGEH-SLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIEVPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWPKVQWINIDHHAASKPSRDWQPPERLSD-DECLYIEYSYAAKDGSVRGVTVSRRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVVFIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWAL-LAEKEHSLINLSCLRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLRRPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSENSLT-SLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSGYWGLQGQTNV-YFKVQ---PLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLFICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDERIVIVAELRN-GFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKTPLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPK-PRDMPSGQVGPSAMMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLNTRMQEVSSFTFSQLQRRAERIACYLVEKRKIPA-KTLIALLYSPGIELVCAVYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNXXXXXXXXXXXXXXXXXXLEAARQIMNACNCS---IVLTCGAVIKVIKAQRVTL---TD-GQNMIDTDDLPKKRLVS-HDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKLQCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDLWLTACSTKQVRDTFCSYSAIE---LSTKYLAN-SIPALKQRGISLNCLRSLVIVAEERPRVQSTSNFCKLF--SVLGLNSRAVSTSFGCRVNIAICLQGASSPDTSNVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQCADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQ------------------------LSMKLATGE-IDGVYARTGYLGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCHKSKIAECVVFTWSN 4922
            S  I++L+ TL   K    P Y+ + +       F +P  P+P G +  P I   + M + L   L  +L   A  + K+   + +D N + V G+SLTY KL+QRA RI+  +  KL +     +++P   VALVF+  D I+F+  F+ C+ A V+ + +E PL  + +S    G  L+   + ++LT+  C+K + R     IE F  W  + W++ID +   K  + +  PE  +  D  LY+EY Y+ +  ++RGV VS  + L+HC+ L  +CRY EG++++C  +++ +TGLWH VLTA Y+G++ +F+PY+ +K +PA W+  +T+HK    +  SR +H +L + +KE + +++S L+ LLVSD   PW   T D F+  F+  GL+S  + PC   SET+T+ +RR        +  D S  + ++             L + SLSY L++  S++S + ++ L+  G +LP  KA V++ +    LC  DE+GE+C+ + ++   +W      +  Y  V    P +   NIV      + R+G +GF  P      +FI G ++  + V GRR N+DDII TV  V+P+ ++++GR  VF++P+L   R+VI  E+ +  +S+   + W+S V+QAV ++HQ  VYC+V +  +  PKT LG I+V DT  RFL G L+  ++ LCP  A+ NLP   R          A ++ H +     A   G       ++ ++ +IL  RA +TP+  LF  +N+++         QL R+AERIA  + +K K PA  +++A++ +  +EL CA+Y C   G +P+ +         N   +  S L+FN                       + + AC  S   + LT G  I+++K++  +    TD    +ID  + PKK+ +S +    P+   +++ + F     G+      THS +  +C+A KLQ +  P  EV L +D  S  G  L C+S VYCGH S+ V P ++ + PD WL     K ++ TFCS  A+     S ++  N S P  K+  ++L  + SL++   ERP       F  +F  S  GLN+ ++       + + I +   S P T  VY+++++LRN R+   E+ +  +L +LE G+ +    + I   ++  Q + + LGE+WVSS +  + ++    +   ++                         LS KLA G+ I   +A+T  +GF+R      S G  +  + V+G  ++ I +RG  Y P +IE  + +     I + +VFT S+
Sbjct:  132 SSTIEKLLATLNDVKDCNSPSYYSDGQ------FFRNPQVPQPNGDLQFP-ISSKIPMENMLTTDLLESLIERANTNPKEPFFTVLDGNSKAVTGMSLTYGKLVQRAERISCYITTKLSNTAYGLNVRPGQSVALVFSKEDAIDFVIGFFACLFAKVIAVPVEKPLTSQISSSALTGKYLSQLGVSVILTNTNCHKEITR---KGIE-FPQWKDLFWVSIDSYYNDKLPKSYILPESCTTFDAPLYVEYVYSDQH-TLRGVPVSHESTLQHCQALKVMCRYTEGQSILCTDDIRHQTGLWHCVLTAAYSGMNTLFLPYSFVKKNPACWINAVTKHKVKFMVSSSRVLHNSLSIEKKELNGVDISHLKTLLVSDACFPWINETIDRFVQRFQPVGLQSDVVLPCVSKSETLTICMRR-------RNETDKSYPLVQT-------------LCLESLSYDLIKETSKDSSSMTIVLESNGSLLPSMKAAVVRLDNYSQLCRQDEIGEICVSSKFSNRVFWMTPDDVSTQYLSVNVNIPSEESDNIV-----TFTRTGFVGFFRPHNGMNHIFIHGLLKNFIEVCGRRFNSDDIIGTVSVVKPLGVLYKGRCCVFTVPVLDHNRLVIAIEVNSEKYSDNKIYDWISNVLQAVLNLHQLNVYCVVGIACDTFPKTLLGDINVNDTMVRFLRGVLNITHLTLCPQTALLNLPGVNRSATHNHHFSPASLLAHAMHSQSFASVSGISTPPITKTSSLIEILEWRATHTPDHPLFSVINSKLAVTDRLNCEQLYRKAERIASLMKDKMKTPAVGSVVAIILNNPLELACALYGCYYLGMVPLVL---------NMVDSDTSWLSFNLM---------------------ENIWACKHSKAILCLTSGQNIRLLKSKECSSYVPTDLWPQLIDISEAPKKKPLSMYTVSSPEK--QLSLMRFHVDRDGLTTLSGWTHSNIAALCEAHKLQNDLAPGTEVALCIDATSNTGLFLNCISPVYCGHHSFIVSPSIMNTNPDTWLLFLHRKLIKHTFCSELALSQSIYSARFDQNCSFP--KKPCLNLQHIESLIVCVNERPNYMVIREFLVVFEDSKFGLNTLSIGIDSPWIMGMFIQIPKTSYPRT--VYLEKLALRNYRITESEESNDTALEVLELGQPVTNTLVLIVDRQSQCQKSINQLGELWVSSEYTCNQIVAAATSQHIEQLYRDVLNVGRYVCDTDTCDVISDNILSAKLAMGQNIQQTFAKTSLMGFLR------SFGPENQLI-VLGRADDIIEMRGFTYFPTEIEDCIRQVDTEIINQSIVFTESD 1377          
The following BLAST results are available for this feature:
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIP2C0.000e+050.00disco interacting protein 2 homolog C [Source:HGNC... [more]
DIP2C0.000e+049.93disco interacting protein 2 homolog C [Source:HGNC... [more]
DIP2C0.000e+049.66disco interacting protein 2 homolog C [Source:HGNC... [more]
DIP2B0.000e+050.77disco interacting protein 2 homolog B [Source:HGNC... [more]
DIP2A0.000e+048.96disco interacting protein 2 homolog A [Source:HGNC... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dip-20.000e+044.77Disco-Interacting Protein 2 homolog [Source:UniPr... [more]
dip-20.000e+044.77Disco-Interacting Protein 2 homolog [Source:UniPr... [more]
dip-20.000e+044.71Disco-Interacting Protein 2 homolog [Source:UniPr... [more]
dip-20.000e+044.71Disco-Interacting Protein 2 homolog [Source:UniPr... [more]
dip-20.000e+044.48Disco-Interacting Protein 2 homolog [Source:UniPr... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
DIP20.000e+051.12gene:FBgn0024806 transcript:FBtr0332108[more]
DIP20.000e+051.12gene:FBgn0024806 transcript:FBtr0305325[more]
DIP20.000e+050.59gene:FBgn0024806 transcript:FBtr0072520[more]
DIP20.000e+050.59gene:FBgn0024806 transcript:FBtr0332109[more]
DIP20.000e+050.38gene:FBgn0024806 transcript:FBtr0332110[more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dip2a0.000e+049.39disco-interacting protein 2 homolog A [Source:ZFIN... [more]
dip2ca0.000e+049.28disco-interacting protein 2 homolog Ca [Source:ZFI... [more]
dip2ca0.000e+048.73disco-interacting protein 2 homolog Ca [Source:ZFI... [more]
dip2ca0.000e+048.94disco-interacting protein 2 homolog Ca [Source:ZFI... [more]
dip2a0.000e+048.28disco-interacting protein 2 homolog A [Source:ZFIN... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dip2c0.000e+049.31disco interacting protein 2 homolog C [Source:NCBI... [more]
dip2c0.000e+049.17disco interacting protein 2 homolog C [Source:NCBI... [more]
dip2c0.000e+049.17disco interacting protein 2 homolog C [Source:NCBI... [more]
dip2c0.000e+050.33disco interacting protein 2 homolog C [Source:NCBI... [more]
dip2c0.000e+050.54disco interacting protein 2 homolog C [Source:NCBI... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Dip2c0.000e+049.93disco interacting protein 2 homolog C [Source:MGI ... [more]
Dip2c0.000e+049.79disco interacting protein 2 homolog C [Source:MGI ... [more]
Dip2b0.000e+050.51disco interacting protein 2 homolog B [Source:MGI ... [more]
Dip2b0.000e+050.55disco interacting protein 2 homolog B [Source:MGI ... [more]
Dip2a0.000e+048.81disco interacting protein 2 homolog A [Source:MGI ... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9Y2E4|DIP2C_HUMAN0.000e+050.00Disco-interacting protein 2 homolog C OS=Homo sapi... [more]
sp|Q9W0S9|DIP2_DROME0.000e+050.59Disco-interacting protein 2 OS=Drosophila melanoga... [more]
sp|Q9P265|DIP2B_HUMAN0.000e+050.77Disco-interacting protein 2 homolog B OS=Homo sapi... [more]
sp|Q3UH60|DIP2B_MOUSE0.000e+050.51Disco-interacting protein 2 homolog B OS=Mus muscu... [more]
sp|Q6NVJ5|DI2BA_DANRE0.000e+047.70Disco-interacting protein 2 homolog B-A OS=Danio r... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4Z2CYF30.000e+056.57Disco-interacting protein 2isoform 3 OS=Schistosom... [more]
A0A4S2LIY20.000e+056.65DMAP-interaction domain-containing protein OS=Opis... [more]
A0A4S2LGV60.000e+056.65DMAP-interaction domain-containing protein OS=Opis... [more]
A0A4V3SE170.000e+056.65Uncharacterized protein OS=Opisthorchis felineus O... [more]
G7YHV60.000e+056.59Disco-interacting protein 2 homolog C OS=Clonorchi... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
dip2ca0.000e+049.34disco-interacting protein 2 homolog Ca [Source:ZFI... [more]
dip2a0.000e+048.22disco-interacting protein 2 homolog A [Source:ZFIN... [more]
dip2cb0.000e+048.14disco-interacting protein 2 homolog Cb [Source:ZFI... [more]
dip2ba0.000e+047.57disco-interacting protein 2 homolog Ba [Source:NCB... [more]
dip2bb0.000e+048.94disco-interacting protein 2 homolog B-A-like [Sour... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ENSPMAT00000001386.10.000e+047.08pep scaffold:Pmarinus_7.0:GL477282:11654:68835:-1 ... [more]
ENSPMAT00000002071.18.816e-1048.53pep scaffold:Pmarinus_7.0:GL479928:182456:220195:-... [more]
ENSPMAT00000006897.11.030e-4544.83pep scaffold:Pmarinus_7.0:GL489792:1491:6881:-1 ge... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CMR25.339e-2224.02Putative protein of unknown function; deletion cau... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO289467.099e-11359.27Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO289451.299e-3245.80Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000002992.20.000e+049.86disco-interacting protein 2 homolog C [Source:NCBI... [more]
dip2ca0.000e+050.03disco interacting protein 2 homolog C [Source:NCBI... [more]
ENSORLT00000028714.10.000e+049.30disco-interacting protein 2 homolog C [Source:NCBI... [more]
ENSORLT00000034729.10.000e+051.25disco-interacting protein 2 homolog C [Source:NCBI... [more]
dip2ba0.000e+046.49disco-interacting protein 2 homolog B-A [Source:NC... [more]
back to top
BLAST of Disco-interacting protein 2 homolog C vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000017043.10.000e+099.94SMESG000017043.1[more]
SMESG000017043.10.000e+099.05SMESG000017043.1[more]
SMESG000053080.10.000e+030.47SMESG000053080.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023662 ID=SMED30023662|Name=Disco-interacting protein 2 homolog C|organism=Schmidtea mediterranea sexual|type=transcript|length=5245bp
GTTAAATATTCAATTAATAAACATATTTAAAAGCTATTAAATTAAAAATA
AAAATATTTCGGAAGTCTAATGATATTATAATGGACTTATCAAATCATGC
TGAATATTCAAATGAAATATTAGAAAAAATCAGGGAGTTAGAATTAGAGT
TAAGTGAAGGTGATATAACAGAAAAAGGTTTTCTTAAGAAAAAAGCACTG
CTATTGCAAAAATATAGCAAAGATCAAAATGTGGAGATTTCCGATCACAA
TATAACTCATGGATATCCTGGAATAATGAATCCTCCACAAATCGACATGA
AGGGAGATTCAATAAATGAAGCACCAGTGACCAGAAAGAAAGACGGCAGA
CGTTATACTAGAGACGAAAGCCGTTATCGTTCAGCTCAATCAAGACATTT
GGAATTGCGTGACTCGTATTCGGGTGGAGACATTCGGGAGGAAGCAGTTA
GGGAGGCACTAGCGAAACACAAAGGTCAGGAAGCTCTAGTGCCGAGCAAA
CGGAAAGAACCATTGAGTATTTCCTCAGAAGATGACCCTAAGCGGATTAG
TGGACTCGGGGGCCCGAGCTTCCGAAACCCCGAAAGCCGACTTCAGGAGC
ACGATTCCGACTCGGAAGACGATGAAGAAGATGACACGACGAATCTTTCG
TCAGATGGATCAACGAGACATCGGATAAAATTGATTGATACCCCTTCTGC
TCCATCGTCACAGGCTGCATCTCACAAATCACCGCGAGTGTCTAGAAGAG
ACGCAGCGACATCTCAACAACAATCCTCGAACCTTCCACGACCTCAACCC
AGACCGAGACTCACAGTTGTCGTTAAGGATTCAGAATCTATCGCTTCTAA
TAGTAGACAAAGCCGATTTCAAAATGGCGCGCACGGTGTACCACCAGATG
TCACCAGTCACACGCCTAATGCGCTAAAGGATCAGAACTCGGTCACCACA
GAGAGTATTACATCATCCATTGGAGATAATATTCGGCGCAGTCGCGATGA
TGCCAGTTGTCCAAGTCAAACCGGCTCAGTAAACAGCCTACAGACTGGAG
GCACGAATAACGGTGCCGTTGAAAATGGACTCGTATCGAGCAGAGTGTCA
GAAAAAATCCAACAACTCGTGCAAACTCTCAAGCGTCCGAAACGACGTCC
ATTACCAGAATATTTCCAAGAAGACGAAAATTTAGCAGTCCTCACGACAT
TTGAAGATCCGAATGCTCCTAAACCAAAAGGAACAGTTATAGAGCCGGCA
ATAGGGGAATCACTAAATATGCTATCAGGTCTACCTCGAAGTCTCGAAAG
CGCCCTCCAGTCATATGCGCAGGCACACGGCAAGCAATCAGTCATGTCAT
GCATTGATAGCAATGGCAGAGTTAATGGAATCTCGCTTACATACACGAAA
TTATTACAAAGAGCCAATCGAATTGCGTACCTTCTTCTTAACAAACTTGG
ACATCGAGGAGAGCACAGTCTTAAACCGAGAGATCGAGTTGCTCTCGTAT
TTGCAAATAACGACCCAATTAATTTCATTTGTGCTTTTTATGGCTGTATA
ATGGCTAGTGTTGTTCCATTGTCTATTGAAGTTCCATTGATGAGACGCGA
TGCCAGCTGTCAAAGCATGGGGTTTTTATTGAACAGTCAAGAGATTCGAA
TAGTTCTCACAAGTGAAATGTGTTATAAGTCTCTGCCAAGAACTACAAAT
GGAGAAATAGAATCATTTTCTGGATGGCCAAAAGTGCAATGGATTAATAT
TGATCATCATGCTGCTAGTAAACCGAGCAGAGATTGGCAACCACCTGAGA
GGTTATCCGATGACGAATGCTTATATATTGAATATTCATATGCTGCAAAA
GACGGTAGTGTACGCGGGGTCACAGTTAGTCGAAGAGCGGCGTTAGAACA
TTGTCGAACACTTGCCACAGTATGTCGATACGCTGAAGGAGAAACTTTAG
TTTGTGTCAGTGAATTGAAGCGTGAAACTGGTTTGTGGCACTCAGTTCTT
ACTGCAATTTATACTGGATTGCATGTCGTATTTATACCCTATGCAGTTTT
AAAAGTCGATCCTGCAATATGGTTGAAGCAAATTACAAGACACAAAGCCG
CTGCAGCCATTGTAAAATCTAGAGATATGCACTGGGCATTACTTGCAGAA
AAAGAGCACAGCCTAATCAATTTATCTTGTTTACGAGTATTACTAGTGTC
AGACGGAAGCAATCCATGGTCTCTTAATACGTGTGATAATTTCATTTCGG
CATTCAGACAAAAAGGACTTCGTTCGACAGCTTTATGTCCATGTGCCGGA
AGTAGCGAAACAATGACGCTAAGTTTGAGACGCCCAACTGCAGGATATGG
AGTTGAAGATTCATTTGATGTATCAAGTGGAATAAACGAATCTCTCGAGA
GTGGGTGTGCTTCTCCTGGGGGTCGAGGAGTGTTATCAATGCACAGTTTG
AGTTATGGTCTTGTTAGGGTAGATTCAGAAAACTCTCTCACTAGTCTCAC
ATTACAAGATTGTGGACAAATATTACCTGGAGGCAAAGCTGTGGTAATCA
AACCGAACGGTTCTCCATATTTGTGTCACACTGATGAGGTTGGCGAAGTC
TGCCTGCAAGCATCATATACTGGATCTGGTTACTGGGGGCTCCAAGGACA
GACAAATGTATATTTCAAGGTGCAGCCTCTAGATTCATGCGGCAACATCG
TTGATCCAAATGGTCCTGGTTATGTTCGTTCCGGACTCCTTGGATTTTTA
GGACCCGCTAAATCTGGTGGGCTTTTATTTATTTGTGGATCTGTGCAAGG
TCTAATGACAGTCAGTGGTCGTAGACATAACGCAGATGATATAATAGCCA
CAGTATTAGCAGTAGAGCCAATGAAGATTGTTTTTCGTGGCCGTATAGCC
GTTTTTTCGATTCCTTTGTTGCGAGATGAACGAATTGTCATAGTTGCTGA
ATTAAGAAATGGATTCAGTGAAGAAGCCGCTTTCAAATGGATGTCCAGAG
TCATTCAAGCCGTCGATTCAATTCACCAAGCAGCAGTTTACTGCATCGTA
TTAGTACCTCACAATTACTTGCCCAAAACCCCTCTCGGTGGAATTCATGT
TTATGACACTAAGCGAAGATTTCTCGAAGGTCGTCTGTCTGCATGTAATG
TCCTATTGTGTCCTCATGGAGCCATTACAAATCTTCCAAAACCCAGGGAT
ATGCCGTCTGGTCAGGTCGGTCCGTCTGCAATGATGGTAGGTCATTTGGT
ACAAGGAAACCGTCTGGCATGGGCTCAAGGAAGAGATATTTCAGTAGAAA
TCGAAAGCAAAACTATATCACAAATTTTAATTGATAGAGCTATTAATACA
CCTAACAGCCGCCTGTTTTGTCAGCTGAATACTCGTATGCAGGAAGTATC
GAGTTTCACATTTAGTCAGTTACAGCGTCGAGCAGAACGTATTGCATGTT
ATTTGGTCGAAAAAAGGAAAATACCCGCTAAAACTCTAATAGCTCTGTTA
TATTCTCCCGGAATCGAATTGGTCTGTGCAGTTTATGCATGCATGCTTTG
TGGATGCATTCCAGTAACAATCAAACCACCGTCAACACCGACAGGGGTTA
ATAACACTGGCAATCAGAATTCAACTCTAGCTTTCAATACATCTCAAACC
ATTAGCTCTTCGTCGACATCTGTTGATGCTGTTGCATCAACTCTCGAAGC
AGCTCGTCAAATTATGAATGCGTGTAATTGTTCGATCGTATTGACTTGTG
GTGCAGTTATCAAAGTGATCAAAGCTCAGAGAGTCACTCTTACAGACGGA
CAAAATATGATTGATACAGATGATCTCCCGAAAAAACGATTAGTTTCTCA
TGATTTTTATCGCCCTCAGTCTTTGGATGAAGTAGCTTATATAGATTTCA
GTTGGTCTCCACAAGGAGTTCCTATTGGTGTTCGTCAGACACATTCCGCA
CTCCTTCACATTTGTCAAGCTCAGAAATTACAGTGCGAATTTTATCCATC
TCGAGAAGTCGTATTATCATTGGATCCGTATTCTGGCCTTGGTTTCACAC
TTTGGTGCCTATCCGGGGTTTATTGTGGTCATTTGAGTTACTTCGTGCCT
CCTCAATTGCTTGAGTCTCAACCTGATCTCTGGTTGACTGCCTGTAGTAC
AAAGCAAGTCCGTGACACATTCTGCTCCTATTCTGCGATTGAATTGTCAA
CTAAATATTTAGCCAACAGTATTCCGGCTTTGAAGCAAAGGGGAATATCG
TTGAATTGTTTACGATCGCTTGTTATTGTTGCGGAAGAAAGACCTCGTGT
ACAATCTACTAGTAATTTTTGCAAATTATTTTCCGTATTGGGCTTAAACT
CCCGCGCTGTCAGTACCTCATTTGGTTGTCGAGTGAATATCGCTATATGT
CTACAAGGTGCAAGTAGTCCAGACACGAGCAACGTTTATGTTGATCAGGT
CTCATTACGCAATGACAGGGTTAAGCTTTTAGAAAAGGGCAGTCCACATA
GTTTGTGCTTGCTAGAATCTGGTAAATTGTTGCCAGGAGTTCGAATCGCA
ATTGCCCACCCTGAAACTATGGGACAATGTGCTGATTCACACCTTGGAGA
GATTTGGGTCAGTTCACCTTTCAATTCGTCTGATTTGATAGTTCCGAACG
ATAACGGCGAAGCTAAGAAACAACTTTCTATGAAATTAGCCACAGGAGAA
ATTGATGGAGTTTACGCTCGTACTGGTTATTTAGGATTCGTGCGCCGCAC
AGAATTAACTCAGTCAGATGGAGAGCGCCATGATGCAGTGTTTGTCGTCG
GTGCTCTGGAAAACACTATAATGTTACGGGGCATGCGATACCATCCTATC
GACATCGAATCCACCGTAATGCGTTGTCATAAAAGCAAGATAGCAGAATG
TGTCGTATTTACCTGGTCGAATCTATTGGTCGTTGTTGTCGAACTCAATG
GCGAAGATTGGGAAGCCGTCGATCTCGTCCATTTAGTCACATCGAGTGTT
CTCGAAGAGCATTATCTCATTGTCGGTGTCGTGGTAGTCGTCGACAGAGG
CACGATTCAAGTGAACTCACGAGGTGAAAAGGAACGCGTACAGTTGCGAG
ACATGTTTGTCAATGATAAACTCGATCCGATGTATGTTTCCTACAACATG
TGACGCAAAACCGATGATTGATTGATTATTTCTCCTCCTACTTTCGCTAT
ATCGCTGCTTTTTTCAATCTCAATTCCTCCTCCTCCTCCTCCTCG
back to top

protein sequence of SMED30023662-orf-1

>SMED30023662-orf-1 ID=SMED30023662-orf-1|Name=SMED30023662-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=1691bp
MDLSNHAEYSNEILEKIRELELELSEGDITEKGFLKKKALLLQKYSKDQN
VEISDHNITHGYPGIMNPPQIDMKGDSINEAPVTRKKDGRRYTRDESRYR
SAQSRHLELRDSYSGGDIREEAVREALAKHKGQEALVPSKRKEPLSISSE
DDPKRISGLGGPSFRNPESRLQEHDSDSEDDEEDDTTNLSSDGSTRHRIK
LIDTPSAPSSQAASHKSPRVSRRDAATSQQQSSNLPRPQPRPRLTVVVKD
SESIASNSRQSRFQNGAHGVPPDVTSHTPNALKDQNSVTTESITSSIGDN
IRRSRDDASCPSQTGSVNSLQTGGTNNGAVENGLVSSRVSEKIQQLVQTL
KRPKRRPLPEYFQEDENLAVLTTFEDPNAPKPKGTVIEPAIGESLNMLSG
LPRSLESALQSYAQAHGKQSVMSCIDSNGRVNGISLTYTKLLQRANRIAY
LLLNKLGHRGEHSLKPRDRVALVFANNDPINFICAFYGCIMASVVPLSIE
VPLMRRDASCQSMGFLLNSQEIRIVLTSEMCYKSLPRTTNGEIESFSGWP
KVQWINIDHHAASKPSRDWQPPERLSDDECLYIEYSYAAKDGSVRGVTVS
RRAALEHCRTLATVCRYAEGETLVCVSELKRETGLWHSVLTAIYTGLHVV
FIPYAVLKVDPAIWLKQITRHKAAAAIVKSRDMHWALLAEKEHSLINLSC
LRVLLVSDGSNPWSLNTCDNFISAFRQKGLRSTALCPCAGSSETMTLSLR
RPTAGYGVEDSFDVSSGINESLESGCASPGGRGVLSMHSLSYGLVRVDSE
NSLTSLTLQDCGQILPGGKAVVIKPNGSPYLCHTDEVGEVCLQASYTGSG
YWGLQGQTNVYFKVQPLDSCGNIVDPNGPGYVRSGLLGFLGPAKSGGLLF
ICGSVQGLMTVSGRRHNADDIIATVLAVEPMKIVFRGRIAVFSIPLLRDE
RIVIVAELRNGFSEEAAFKWMSRVIQAVDSIHQAAVYCIVLVPHNYLPKT
PLGGIHVYDTKRRFLEGRLSACNVLLCPHGAITNLPKPRDMPSGQVGPSA
MMVGHLVQGNRLAWAQGRDISVEIESKTISQILIDRAINTPNSRLFCQLN
TRMQEVSSFTFSQLQRRAERIACYLVEKRKIPAKTLIALLYSPGIELVCA
VYACMLCGCIPVTIKPPSTPTGVNNTGNQNSTLAFNTSQTISSSSTSVDA
VASTLEAARQIMNACNCSIVLTCGAVIKVIKAQRVTLTDGQNMIDTDDLP
KKRLVSHDFYRPQSLDEVAYIDFSWSPQGVPIGVRQTHSALLHICQAQKL
QCEFYPSREVVLSLDPYSGLGFTLWCLSGVYCGHLSYFVPPQLLESQPDL
WLTACSTKQVRDTFCSYSAIELSTKYLANSIPALKQRGISLNCLRSLVIV
AEERPRVQSTSNFCKLFSVLGLNSRAVSTSFGCRVNIAICLQGASSPDTS
NVYVDQVSLRNDRVKLLEKGSPHSLCLLESGKLLPGVRIAIAHPETMGQC
ADSHLGEIWVSSPFNSSDLIVPNDNGEAKKQLSMKLATGEIDGVYARTGY
LGFVRRTELTQSDGERHDAVFVVGALENTIMLRGMRYHPIDIESTVMRCH
KSKIAECVVFTWSNLLVVVVELNGEDWEAVDLVHLVTSSVLEEHYLIVGV
VVVVDRGTIQVNSRGEKERVQLRDMFVNDKLDPMYVSYNM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR042099AMP-dep_Synthh-like_sf
IPR037337Dip2-like_dom
IPR010506DMAP1-bd
IPR000873AMP-dep_Synth/Lig
Vocabulary: molecular function
TermDefinition
GO:0003824catalytic activity
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR010506DMAP1-binding domainPFAMPF06464DMAP_bindingcoord: 14..140
e-value: 3.3E-11
score: 44.0
IPR042099AMP-dependent synthetase-like superfamilyGENE3DG3DSA:3.40.50.12780coord: 396..905
e-value: 3.0E-58
score: 199.7
NoneNo IPR availableGENE3DG3DSA:3.30.300.30coord: 1577..1689
e-value: 1.6E-11
score: 46.4
coord: 906..1027
e-value: 2.7E-15
score: 58.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 129..327
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 129..150
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 278..299
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 223..239
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 250..265
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 75..113
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 79..113
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 307..327
NoneNo IPR availablePANTHERPTHR22754DISCO-INTERACTING PROTEIN 2 DIP2 -RELATEDcoord: 96..1690
NoneNo IPR availablePANTHERPTHR22754:SF34DISCO-INTERACTING PROTEIN 2 HOMOLOG Acoord: 96..1690
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 396..1016
NoneNo IPR availableSUPERFAMILYSSF56801Acetyl-CoA synthetase-likecoord: 1072..1678
IPR000873AMP-dependent synthetase/ligasePFAMPF00501AMP-bindingcoord: 1098..1580
e-value: 8.2E-35
score: 120.2
coord: 432..903
e-value: 1.0E-20
score: 73.8
IPR037337Dip2-like domainCDDcd05905Dip2coord: 1099..1686
e-value: 9.38384E-174
score: 534.235
IPR037337Dip2-like domainCDDcd05905Dip2coord: 424..1024
e-value: 2.29706E-170
score: 525.376