Cleavage stimulation factor subunit 2

Overview
NameCleavage stimulation factor subunit 2
Smed IDSMED30023657
Length (bp)1350
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Cleavage stimulation factor subunit 2 (SMED30023657) t-SNE clustered cells

Violin plots show distribution of expression levels for Cleavage stimulation factor subunit 2 (SMED30023657) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Cleavage stimulation factor subunit 2 (SMED30023657) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Cleavage stimulation factor subunit 2 (SMED30023657) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023657

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023657h1SMcG0022432 SmedASXL_003706SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023657h1SMcG0022432 SmedASXL_003706SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
neoblastSMED30023657h1SMcG0022432 dd_Smed_v4_3081_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Human
Match: CSTF2 (cleavage stimulation factor subunit 2 [Source:HGNC Symbol;Acc:HGNC:2484])

HSP 1 Score: 233.417 bits (594), Expect = 2.563e-71
Identity = 109/185 (58.92%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   11 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Human
Match: CSTF2 (cleavage stimulation factor subunit 2 [Source:HGNC Symbol;Acc:HGNC:2484])

HSP 1 Score: 223.016 bits (567), Expect = 4.133e-70
Identity = 107/185 (57.84%), Postives = 143/185 (77.30%), Query Frame = 3
Query:  135 TRSIF----VGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            ++ IF    VGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:    2 SKEIFPFCRVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 184          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Human
Match: CSTF2 (cleavage stimulation factor subunit 2 [Source:HGNC Symbol;Acc:HGNC:2484])

HSP 1 Score: 233.802 bits (595), Expect = 4.227e-70
Identity = 109/185 (58.92%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   11 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Human
Match: CSTF2 (cleavage stimulation factor subunit 2 [Source:HGNC Symbol;Acc:HGNC:2484])

HSP 1 Score: 234.187 bits (596), Expect = 5.578e-70
Identity = 109/185 (58.92%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   11 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Human
Match: CSTF2T (cleavage stimulation factor subunit 2 tau variant [Source:HGNC Symbol;Acc:HGNC:17086])

HSP 1 Score: 222.631 bits (566), Expect = 1.803e-65
Identity = 103/185 (55.68%), Postives = 144/185 (77.84%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E+         P  +SPYG+ +DP+ A  +I++AVASLPPEQ+F++M+QMK C+Q++  EAR +LLQNPQLAYALLQAQ++M+I++P++A+ +L R
Sbjct:   11 MDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAA--PIIDSPYGDPIDPEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Celegans
Match: cpf-2 (Cleavage and Polyadenylation Factor [Source:UniProtKB/TrEMBL;Acc:O45577])

HSP 1 Score: 178.718 bits (452), Expect = 4.896e-52
Identity = 81/185 (43.78%), Postives = 134/185 (72.43%), Query Frame = 3
Query:  126 DKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRS 680
            D++ RS+FVGNI Y+ +E+ + ++FS+AG V+  ++V+DRE+GKPKGYGF E+     A  A+RNL+  + +GR LR+  AAG  N  E   ++N    P +E+PYG + D  +A   ISQ VASL PE++F++M+Q+++ +++NP+E  + L+++PQ+AYA+LQA ++M+IV+P+ A+ +L R+
Sbjct:   14 DRSQRSVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAEVAIRNLNGYELSGRILRVDSAAGGMNMEEFGSSSNAP-APVEENPYGPECDAGKAPERISQTVASLAPEKMFELMKQLQESLKNNPSELHKFLVEHPQIAYAVLQAAVVMRIVDPQTALGLLHRN 197          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Celegans
Match: cpf-2 (Cleavage and Polyadenylation Factor [Source:UniProtKB/TrEMBL;Acc:O45577])

HSP 1 Score: 178.718 bits (452), Expect = 4.896e-52
Identity = 81/185 (43.78%), Postives = 134/185 (72.43%), Query Frame = 3
Query:  126 DKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRS 680
            D++ RS+FVGNI Y+ +E+ + ++FS+AG V+  ++V+DRE+GKPKGYGF E+     A  A+RNL+  + +GR LR+  AAG  N  E   ++N    P +E+PYG + D  +A   ISQ VASL PE++F++M+Q+++ +++NP+E  + L+++PQ+AYA+LQA ++M+IV+P+ A+ +L R+
Sbjct:   14 DRSQRSVFVGNISYDVSEDTIRSIFSKAGNVLSIKMVHDRETGKPKGYGFIEFPDIQTAEVAIRNLNGYELSGRILRVDSAAGGMNMEEFGSSSNAP-APVEENPYGPECDAGKAPERISQTVASLAPEKMFELMKQLQESLKNNPSELHKFLVEHPQIAYAVLQAAVVMRIVDPQTALGLLHRN 197          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Celegans
Match: R06C1.4 (pep chromosome:WBcel235:I:11930704:11931757:1 gene:WBGene00011059.1 transcript:R06C1.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:R06C1.4)

HSP 1 Score: 79.337 bits (194), Expect = 3.266e-18
Identity = 33/76 (43.42%), Postives = 52/76 (68.42%), Query Frame = 3
Query:  141 SIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPA 368
            S++VGN+PY+ TEE++   F+  G V   R+VYDRE+G+P+G+ F E++  A A  A+  L+ + +NGR LR+  A
Sbjct:    7 SVYVGNVPYQGTEEEIGNYFAAVGHVNNVRIVYDRETGRPRGFAFVEFSEEAGAQRAVEQLNGVAFNGRNLRVNYA 82          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Celegans
Match: rbm-3.2 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:O45713])

HSP 1 Score: 79.337 bits (194), Expect = 3.930e-18
Identity = 35/81 (43.21%), Postives = 51/81 (62.96%), Query Frame = 3
Query:  141 SIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQN 383
            S++VGN P++ TE+ L   FSQAG V   R+V DRE+G+P+G+ F E+   A A  A+   + +D+NGR LR+  A    N
Sbjct:    5 SVYVGNAPFQTTEDDLGNYFSQAGNVSNVRIVCDRETGRPRGFAFVEFTEEAAAQRAVDQFNGVDFNGRALRVNLAQNRNN 85          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Celegans
Match: rbm-3.1 (RNA Binding Motif protein homolog [Source:UniProtKB/TrEMBL;Acc:O45712])

HSP 1 Score: 74.3294 bits (181), Expect = 2.198e-16
Identity = 31/76 (40.79%), Postives = 49/76 (64.47%), Query Frame = 3
Query:  141 SIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPA 368
            S++VGN P++ TEE+L   FS  G +   R+V DRE+G+P+G+ F E+     A  A+  ++  ++NGRPLR+  A
Sbjct:    6 SVYVGNAPFQTTEEELGNFFSSIGQINNVRIVCDRETGRPRGFAFIEFAEEGSAQRAVEQMNGAEFNGRPLRVNLA 81          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Fly
Match: CstF64 (gene:FBgn0027841 transcript:FBtr0083660)

HSP 1 Score: 217.624 bits (553), Expect = 7.705e-66
Identity = 104/194 (53.61%), Postives = 142/194 (73.20%), Query Frame = 3
Query:  114 QDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIP 695
            Q  +DK+ RS+FVGNIPYEATEEKL  +FS+ GPV+  +LV+DRESGKPKG+GFCEY     A SA+RNL+  +  GR LR+  A  E++  E+         P  E+PYGE  +P+ A   I++ VASLPPEQ++++M+QMK CI SNP+EARQ+L+ NPQLAYALLQA ++M+IV+P+ A+ ML ++N+  P
Sbjct:    8 QSIMDKSMRSVFVGNIPYEATEEKLKEIFSEVGPVLSLKLVFDRESGKPKGFGFCEYKDQETALSAMRNLNGYEIGGRTLRVDNACTEKSRMEM---QQLLQGPQVENPYGEPCEPEDAPELITKTVASLPPEQMYELMKQMKLCIVSNPSEARQMLMLNPQLAYALLQAMVVMRIVDPQQALGMLFKANQMPP 198          

HSP 2 Score: 52.373 bits (124), Expect = 4.532e-7
Identity = 25/42 (59.52%), Postives = 35/42 (83.33%), Query Frame = 3
Query: 1077 SGEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            + ++EKAALIMQVL LSDE++A+LP +QR SI +LK Q+ K+
Sbjct:  375 ASDQEKAALIMQVLQLSDEQIAQLPSEQRVSIVMLKEQIAKS 416          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Fly
Match: CG10466 (gene:FBgn0032822 transcript:FBtr0332178)

HSP 1 Score: 61.2326 bits (147), Expect = 5.202e-11
Identity = 38/122 (31.15%), Postives = 57/122 (46.72%), Query Frame = 3
Query:   99 YHNIMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQ 464
            +H++ +D     +  IFV   PY  TE  L+ +FSQ G V+   L+ D ++GK KG+ F  Y        A+ NL+ I    R LR+   A                KPP+E+   EK+D +
Sbjct:   26 WHDMYKD-----SAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVA--------------DYKPPKEN---EKMDEE 125          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Fly
Match: CG10466 (gene:FBgn0032822 transcript:FBtr0081291)

HSP 1 Score: 61.2326 bits (147), Expect = 5.202e-11
Identity = 38/122 (31.15%), Postives = 57/122 (46.72%), Query Frame = 3
Query:   99 YHNIMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQ 464
            +H++ +D     +  IFV   PY  TE  L+ +FSQ G V+   L+ D ++GK KG+ F  Y        A+ NL+ I    R LR+   A                KPP+E+   EK+D +
Sbjct:   26 WHDMYKD-----SAWIFVAGFPYTLTEGDLVCVFSQYGEVVNINLIRDSKTGKSKGFCFLCYEDQRSTVLAVDNLNGIKILDRTLRVDHVA--------------DYKPPKEN---EKMDEE 125          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Fly
Match: CG3335 (gene:FBgn0036018 transcript:FBtr0076383)

HSP 1 Score: 63.5438 bits (153), Expect = 2.110e-10
Identity = 37/103 (35.92%), Postives = 55/103 (53.40%), Query Frame = 3
Query:  114 QDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAG-EQNSAEVAMTNNTTM 419
            +D++ ++ R IF  N+ Y  TEE L  LF Q GPV+   L  D+ + K KG+G   Y  P  A  A   LD  D++GR L + P+   E+N  E    N+ ++
Sbjct:  357 EDDISESGR-IFFRNLAYTTTEEDLRKLFEQFGPVVEVNLPLDKLTRKIKGFGTVTYMMPEHALKAFNTLDGTDFHGRLLHLLPSKDIEKNPKEDLDENDASL 458          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Fly
Match: Spx (gene:FBgn0015818 transcript:FBtr0070894)

HSP 1 Score: 56.9954 bits (136), Expect = 1.562e-8
Identity = 31/97 (31.96%), Postives = 51/97 (52.58%), Query Frame = 3
Query:  108 IMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVA 398
            I + N D T   I+ G +  + +E  L  LF QAGPV+   +  DR +   +GYGF E+ S   A   ++ ++ I   G+P+R+  A+  Q + +V 
Sbjct:    6 IAERNQDAT---IYAGGLDDKVSETLLWELFVQAGPVVNVHMPKDRVTQMHQGYGFVEFLSEEDADYGIKIMNMIKLYGKPIRVNKASAHQKNLDVG 99          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Zebrafish
Match: cstf2 (cleavage stimulation factor, 3' pre-RNA, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-031118-2])

HSP 1 Score: 226.868 bits (577), Expect = 1.755e-68
Identity = 108/185 (58.38%), Postives = 146/185 (78.92%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+   P++A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ ML R
Sbjct:   19 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDGCMPEEAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKMLHR 201          

HSP 2 Score: 51.6026 bits (122), Expect = 1.344e-6
Identity = 25/42 (59.52%), Postives = 34/42 (80.95%), Query Frame = 3
Query: 1077 SGEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            S + EKAALIMQVL L+ E++A LP +QR+SI +LK Q++KT
Sbjct:  443 SQDHEKAALIMQVLQLTPEQIAMLPAEQRQSILILKEQIQKT 484          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Zebrafish
Match: cstf2 (cleavage stimulation factor, 3' pre-RNA, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-031118-2])

HSP 1 Score: 226.868 bits (577), Expect = 2.914e-68
Identity = 108/185 (58.38%), Postives = 146/185 (78.92%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+   P++A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ ML R
Sbjct:   19 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDGCMPEEAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKMLHR 201          

HSP 2 Score: 51.6026 bits (122), Expect = 1.413e-6
Identity = 25/42 (59.52%), Postives = 34/42 (80.95%), Query Frame = 3
Query: 1077 SGEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            S + EKAALIMQVL L+ E++A LP +QR+SI +LK Q++KT
Sbjct:  463 SQDHEKAALIMQVLQLTPEQIAMLPAEQRQSILILKEQIQKT 504          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Zebrafish
Match: cstf2 (cleavage stimulation factor, 3' pre-RNA, subunit 2 [Source:ZFIN;Acc:ZDB-GENE-031118-2])

HSP 1 Score: 98.9821 bits (245), Expect = 1.650e-22
Identity = 45/79 (56.96%), Postives = 57/79 (72.15%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYN---SPAVAASALRNLDNIDYNGRP 350
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     P V  S  + +  +  NG P
Sbjct:   19 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQPLPQPNVPVSQPQPMPGLHVNGAP 97          

HSP 2 Score: 51.9878 bits (123), Expect = 6.547e-7
Identity = 25/42 (59.52%), Postives = 34/42 (80.95%), Query Frame = 3
Query: 1077 SGEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            S + EKAALIMQVL L+ E++A LP +QR+SI +LK Q++KT
Sbjct:  294 SQDHEKAALIMQVLQLTPEQIAMLPAEQRQSILILKEQIQKT 335          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Zebrafish
Match: rbm39b (RNA binding motif protein 39b [Source:ZFIN;Acc:ZDB-GENE-050327-97])

HSP 1 Score: 60.4622 bits (145), Expect = 1.987e-9
Identity = 25/73 (34.25%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  144 IFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIG 362
            ++VG++ +  TE+ L  +F   G + G +L+ D E+G+ KGYGF  +     A  AL  L+  +  GRP+++G
Sbjct:  266 LYVGSLHFNITEDMLRGIFEPFGKIEGIQLMMDSETGRSKGYGFISFADAECAKKALEQLNGFELAGRPMKVG 338          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Zebrafish
Match: rbm39b (RNA binding motif protein 39b [Source:ZFIN;Acc:ZDB-GENE-050327-97])

HSP 1 Score: 60.4622 bits (145), Expect = 1.987e-9
Identity = 25/73 (34.25%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  144 IFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIG 362
            ++VG++ +  TE+ L  +F   G + G +L+ D E+G+ KGYGF  +     A  AL  L+  +  GRP+++G
Sbjct:  266 LYVGSLHFNITEDMLRGIFEPFGKIEGIQLMMDSETGRSKGYGFISFADAECAKKALEQLNGFELAGRPMKVG 338          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 233.417 bits (594), Expect = 1.259e-70
Identity = 110/191 (57.59%), Postives = 149/191 (78.01%), Query Frame = 3
Query:  105 NIMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            N+    +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+ V P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:    5 NVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDPVSPEDAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 233.032 bits (593), Expect = 1.924e-70
Identity = 110/191 (57.59%), Postives = 149/191 (78.01%), Query Frame = 3
Query:  105 NIMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            N+    +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+ V P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:    5 NVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDPVSPEDAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 233.417 bits (594), Expect = 2.005e-70
Identity = 110/191 (57.59%), Postives = 149/191 (78.01%), Query Frame = 3
Query:  105 NIMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            N+    +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+ V P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:    5 NVRDPAVDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDPVSPEDAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 219.935 bits (559), Expect = 3.492e-66
Identity = 106/178 (59.55%), Postives = 140/178 (78.65%), Query Frame = 3
Query:  144 IFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            I VGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+ V P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   17 IAVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDPVSPEDAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 192          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Xenopus
Match: mcm3ap (minichromosome maintenance complex component 3 associated protein [Source:Xenbase;Acc:XB-GENE-981006])

HSP 1 Score: 219.935 bits (559), Expect = 1.742e-65
Identity = 106/178 (59.55%), Postives = 140/178 (78.65%), Query Frame = 3
Query:  144 IFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            I VGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+ V P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   17 IAVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDPVSPEDAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 192          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Mouse
Match: Cstf2 (cleavage stimulation factor, 3' pre-RNA subunit 2 [Source:MGI Symbol;Acc:MGI:1343054])

HSP 1 Score: 234.187 bits (596), Expect = 5.872e-71
Identity = 109/185 (58.92%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   11 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGESISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Mouse
Match: Cstf2 (cleavage stimulation factor, 3' pre-RNA subunit 2 [Source:MGI Symbol;Acc:MGI:1343054])

HSP 1 Score: 234.572 bits (597), Expect = 9.807e-71
Identity = 109/185 (58.92%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   11 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGESISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Mouse
Match: Cstf2 (cleavage stimulation factor, 3' pre-RNA subunit 2 [Source:MGI Symbol;Acc:MGI:1343054])

HSP 1 Score: 234.187 bits (596), Expect = 2.211e-70
Identity = 109/185 (58.92%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   11 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGESISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Mouse
Match: Cstf2t (cleavage stimulation factor, 3' pre-RNA subunit 2, tau [Source:MGI Symbol;Acc:MGI:1932622])

HSP 1 Score: 222.631 bits (566), Expect = 1.603e-65
Identity = 103/185 (55.68%), Postives = 144/185 (77.84%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E+         P  +SPYG+ +DP+ A  +I++AVASLPPEQ+F++M+QMK C+Q++  EAR +LLQNPQLAYALLQAQ++M+I++P++A+ +L R
Sbjct:   11 MDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAA--PIIDSPYGDPIDPEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Mouse
Match: Cstf2 (cleavage stimulation factor, 3' pre-RNA subunit 2 [Source:MGI Symbol;Acc:MGI:1343054])

HSP 1 Score: 186.808 bits (473), Expect = 1.011e-56
Identity = 88/155 (56.77%), Postives = 119/155 (76.77%), Query Frame = 3
Query:  213 PVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            P +  RLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   25 PALRLRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGESISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 177          
BLAST of Cleavage stimulation factor subunit 2 vs. UniProt/SwissProt
Match: sp|Q8HXM1|CSTF2_BOVIN (Cleavage stimulation factor subunit 2 OS=Bos taurus OX=9913 GN=CSTF2 PE=2 SV=1)

HSP 1 Score: 234.187 bits (596), Expect = 1.371e-69
Identity = 109/185 (58.92%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   11 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. UniProt/SwissProt
Match: sp|Q8BIQ5|CSTF2_MOUSE (Cleavage stimulation factor subunit 2 OS=Mus musculus OX=10090 GN=Cstf2 PE=1 SV=2)

HSP 1 Score: 234.187 bits (596), Expect = 1.547e-69
Identity = 109/185 (58.92%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   11 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGESISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. UniProt/SwissProt
Match: sp|Q5RDA3|CSTF2_PONAB (Cleavage stimulation factor subunit 2 OS=Pongo abelii OX=9601 GN=CSTF2 PE=2 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 2.009e-69
Identity = 109/185 (58.92%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   11 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. UniProt/SwissProt
Match: sp|P33240|CSTF2_HUMAN (Cleavage stimulation factor subunit 2 OS=Homo sapiens OX=9606 GN=CSTF2 PE=1 SV=1)

HSP 1 Score: 233.802 bits (595), Expect = 2.030e-69
Identity = 109/185 (58.92%), Postives = 147/185 (79.46%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ GPV+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYGE + P+ A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ +L R
Sbjct:   11 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGPVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPVIESPYGETISPEDAPESISKAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. UniProt/SwissProt
Match: sp|Q9H0L4|CSTFT_HUMAN (Cleavage stimulation factor subunit 2 tau variant OS=Homo sapiens OX=9606 GN=CSTF2T PE=1 SV=1)

HSP 1 Score: 222.631 bits (566), Expect = 8.658e-65
Identity = 103/185 (55.68%), Postives = 144/185 (77.84%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E+         P  +SPYG+ +DP+ A  +I++AVASLPPEQ+F++M+QMK C+Q++  EAR +LLQNPQLAYALLQAQ++M+I++P++A+ +L R
Sbjct:   11 MDRSLRSVFVGNIPYEATEEQLKDIFSEVGSVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEELKSLGPAA--PIIDSPYGDPIDPEDAPESITRAVASLPPEQMFELMKQMKLCVQNSHQEARNMLLQNPQLAYALLQAQVVMRIMDPEIALKILHR 193          
BLAST of Cleavage stimulation factor subunit 2 vs. TrEMBL
Match: A0A430QTU6 (Cleavage stimulation factor subunit 2 (Fragment) OS=Schistosoma bovis OX=6184 GN=DC041_0011437 PE=4 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 1.917e-101
Identity = 150/196 (76.53%), Postives = 179/196 (91.33%), Query Frame = 3
Query:  108 IMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIP 695
            + ++  +KT RSIFVGNIPYEATEEKL+ LFS+AGPVIGFRLVYDRESGKPKGYGFCEYN+PA+AASALRNL NI++NGRPLRIGPAAGEQNSAE+A++ N ++ PP ESPYG+ +DPQ A  AIS+AVASLPPEQ++++M+QMK CIQ+NPNEAR +LLQNPQLAYALLQAQI+MKIV+PKVAIAML RS++QIP
Sbjct:    6 LTKEAAEKTARSIFVGNIPYEATEEKLIELFSKAGPVIGFRLVYDRESGKPKGYGFCEYNNPAIAASALRNLQNIEFNGRPLRIGPAAGEQNSAELALS-NPSVGPPLESPYGDNIDPQAAPEAISRAVASLPPEQMYELMKQMKLCIQNNPNEARNMLLQNPQLAYALLQAQIVMKIVDPKVAIAMLNRSHDQIP 200          
BLAST of Cleavage stimulation factor subunit 2 vs. TrEMBL
Match: A0A4Z2DXC3 (Cleavage stimulation factor subunit 2 OS=Schistosoma japonicum OX=6182 GN=EWB00_010395 PE=4 SV=1)

HSP 1 Score: 313.923 bits (803), Expect = 1.890e-100
Identity = 150/196 (76.53%), Postives = 179/196 (91.33%), Query Frame = 3
Query:  108 IMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIP 695
            + ++  +KT RSIFVGNIPYEATEEKL+ LFS+AGPVIGFRLVYDRESGKPKGYGFCEYN+PA+AASALRNL NI++NGRPLRIGPAAGEQNSAE+A++ N ++ PP ESPYG+ +DPQ A  AIS+AVASLPPEQ++++M+QMK CIQ+NPNEAR +LLQNPQLAYALLQAQI+MKIV+PKVAIAML RS++QIP
Sbjct:    6 LTKEAAEKTARSIFVGNIPYEATEEKLIELFSKAGPVIGFRLVYDRESGKPKGYGFCEYNNPAIAASALRNLQNIEFNGRPLRIGPAAGEQNSAELALS-NPSVGPPLESPYGDNIDPQAAPEAISRAVASLPPEQMYELMKQMKLCIQNNPNEARNMLLQNPQLAYALLQAQIVMKIVDPKVAIAMLNRSHDQIP 200          
BLAST of Cleavage stimulation factor subunit 2 vs. TrEMBL
Match: C1L409 (Cleavage stimulation factor, 3' pre-RNA, subunit 2, 64kDa OS=Schistosoma japonicum OX=6182 PE=2 SV=1)

HSP 1 Score: 313.538 bits (802), Expect = 1.610e-99
Identity = 150/196 (76.53%), Postives = 179/196 (91.33%), Query Frame = 3
Query:  108 IMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIP 695
            + ++  +KT RSIFVGNIPYEATEEKL+ LFS+AGPVIGFRLVYDRESGKPKGYGFCEYN+PA+AASALRNL NI++NGRPLRIGPAAGEQNSAE+A++ N ++ PP ESPYG+ +DPQ A  AIS+AVASLPPEQ++++M+QMK CIQ+NPNEAR +LLQNPQLAYALLQAQI+MKIV+PKVAIAML RS++QIP
Sbjct:    6 LTKEAAEKTARSIFVGNIPYEATEEKLIELFSKAGPVIGFRLVYDRESGKPKGYGFCEYNNPAIAASALRNLQNIEFNGRPLRIGPAAGEQNSAELALS-NPSVGPPLESPYGDNIDPQAAPEAISRAVASLPPEQMYELMKQMKLCIQNNPNEARNMLLQNPQLAYALLQAQIVMKIVDPKVAIAMLNRSHDQIP 200          

HSP 2 Score: 61.2326 bits (147), Expect = 2.001e-6
Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = 3
Query: 1080 GEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            GE+EK  LIMQVL LSDE++A LP+DQRRSI +LK QL KT
Sbjct:  371 GEQEKVTLIMQVLQLSDEQLALLPEDQRRSIMILKEQLGKT 411          
BLAST of Cleavage stimulation factor subunit 2 vs. TrEMBL
Match: A0A183K741 (RRM domain-containing protein OS=Schistosoma curassoni OX=6186 GN=SCUD_LOCUS10817 PE=4 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.836e-99
Identity = 150/196 (76.53%), Postives = 179/196 (91.33%), Query Frame = 3
Query:  108 IMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIP 695
            + ++  +KT RSIFVGNIPYEATEEKL+ LFS+AGPVIGFRLVYDRESGKPKGYGFCEYN+PA+AASALRNL NI++NGRPLRIGPAAGEQNSAE+A++ N ++ PP ESPYG+ +DPQ A  AIS+AVASLPPEQ++++M+QMK CIQ+NPNEAR +LLQNPQLAYALLQAQI+MKIV+PKVAIAML RS++QIP
Sbjct:    6 LTKEAAEKTARSIFVGNIPYEATEEKLIELFSKAGPVIGFRLVYDRESGKPKGYGFCEYNNPAIAASALRNLQNIEFNGRPLRIGPAAGEQNSAELALS-NPSVGPPLESPYGDNIDPQAAPEAISRAVASLPPEQMYELMKQMKLCIQNNPNEARNMLLQNPQLAYALLQAQIVMKIVDPKVAIAMLNRSHDQIP 200          

HSP 2 Score: 61.2326 bits (147), Expect = 2.049e-6
Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = 3
Query: 1080 GEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            GE+EK  LIMQVL LSDE++A LP+DQRRSI +LK QL KT
Sbjct:  370 GEQEKVTLIMQVLQLSDEQLALLPEDQRRSIMILKEQLGKT 410          
BLAST of Cleavage stimulation factor subunit 2 vs. TrEMBL
Match: A0A183LHX5 (RRM domain-containing protein OS=Schistosoma margrebowiei OX=48269 GN=SMRZ_LOCUS3400 PE=4 SV=1)

HSP 1 Score: 313.153 bits (801), Expect = 1.896e-99
Identity = 150/196 (76.53%), Postives = 179/196 (91.33%), Query Frame = 3
Query:  108 IMQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIP 695
            + ++  +KT RSIFVGNIPYEATEEKL+ LFS+AGPVIGFRLVYDRESGKPKGYGFCEYN+PA+AASALRNL NI++NGRPLRIGPAAGEQNSAE+A++ N ++ PP ESPYG+ +DPQ A  AIS+AVASLPPEQ++++M+QMK CIQ+NPNEAR +LLQNPQLAYALLQAQI+MKIV+PKVAIAML RS++QIP
Sbjct:    6 LTKEAAEKTARSIFVGNIPYEATEEKLIELFSKAGPVIGFRLVYDRESGKPKGYGFCEYNNPAIAASALRNLQNIEFNGRPLRIGPAAGEQNSAELALS-NPSVGPPLESPYGDNIDPQAAPEAISRAVASLPPEQMYELMKQMKLCIQNNPNEARNMLLQNPQLAYALLQAQIVMKIVDPKVAIAMLNRSHDQIP 200          

HSP 2 Score: 61.2326 bits (147), Expect = 2.105e-6
Identity = 29/41 (70.73%), Postives = 34/41 (82.93%), Query Frame = 3
Query: 1080 GEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            GE+EK  LIMQVL LSDE++A LP+DQRRSI +LK QL KT
Sbjct:  370 GEQEKVTLIMQVLQLSDEQLALLPEDQRRSIMILKEQLGKT 410          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Cavefish
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:103042269])

HSP 1 Score: 224.557 bits (571), Expect = 1.742e-67
Identity = 107/185 (57.84%), Postives = 145/185 (78.38%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+    ++A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ ML R
Sbjct:   18 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDNCPTEEAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKMLHR 200          

HSP 2 Score: 51.2174 bits (121), Expect = 1.474e-6
Identity = 25/42 (59.52%), Postives = 34/42 (80.95%), Query Frame = 3
Query: 1077 SGEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            S + EKAALIMQVL L+ E++A LP +QR+SI +LK Q++KT
Sbjct:  469 SQDHEKAALIMQVLQLTPEQIAMLPPEQRQSILILKEQIQKT 510          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Cavefish
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:103042269])

HSP 1 Score: 224.942 bits (572), Expect = 2.466e-67
Identity = 107/185 (57.84%), Postives = 145/185 (78.38%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+    ++A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ ML R
Sbjct:   18 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDNCPTEEAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKMLHR 200          

HSP 2 Score: 51.2174 bits (121), Expect = 1.546e-6
Identity = 25/42 (59.52%), Postives = 34/42 (80.95%), Query Frame = 3
Query: 1077 SGEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            S + EKAALIMQVL L+ E++A LP +QR+SI +LK Q++KT
Sbjct:  489 SQDHEKAALIMQVLQLTPEQIAMLPPEQRQSILILKEQIQKT 530          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Cavefish
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:103042269])

HSP 1 Score: 219.935 bits (559), Expect = 4.365e-66
Identity = 104/180 (57.78%), Postives = 142/180 (78.89%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAI 662
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+    ++A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+
Sbjct:   18 VDRSLRSVFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDNCPTEEAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIAL 195          

HSP 2 Score: 50.8322 bits (120), Expect = 1.936e-6
Identity = 25/42 (59.52%), Postives = 34/42 (80.95%), Query Frame = 3
Query: 1077 SGEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            S + EKAALIMQVL L+ E++A LP +QR+SI +LK Q++KT
Sbjct:  427 SQDHEKAALIMQVLQLTPEQIAMLPPEQRQSILILKEQIQKT 468          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Cavefish
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:103042269])

HSP 1 Score: 211.846 bits (538), Expect = 1.107e-62
Identity = 103/176 (58.52%), Postives = 137/176 (77.84%), Query Frame = 3
Query:  150 VGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            VGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+    ++A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ ML R
Sbjct:    4 VGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDNCPTEEAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKMLHR 177          

HSP 2 Score: 51.6026 bits (122), Expect = 1.152e-6
Identity = 25/42 (59.52%), Postives = 34/42 (80.95%), Query Frame = 3
Query: 1077 SGEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            S + EKAALIMQVL L+ E++A LP +QR+SI +LK Q++KT
Sbjct:  467 SQDHEKAALIMQVLQLTPEQIAMLPPEQRQSILILKEQIQKT 508          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Cavefish
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:103042269])

HSP 1 Score: 211.846 bits (538), Expect = 1.685e-62
Identity = 103/176 (58.52%), Postives = 137/176 (77.84%), Query Frame = 3
Query:  150 VGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTR 677
            VGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+    ++A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ ML R
Sbjct:    4 VGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDNCPTEEAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKMLHR 177          

HSP 2 Score: 51.6026 bits (122), Expect = 1.229e-6
Identity = 25/42 (59.52%), Postives = 34/42 (80.95%), Query Frame = 3
Query: 1077 SGEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            S + EKAALIMQVL L+ E++A LP +QR+SI +LK Q++KT
Sbjct:  487 SQDHEKAALIMQVLQLTPEQIAMLPPEQRQSILILKEQIQKT 528          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Sea Lamprey
Match: rbm34 (RNA binding motif protein 34 [Source:ZFIN;Acc:ZDB-GENE-040718-77])

HSP 1 Score: 64.3142 bits (155), Expect = 1.696e-11
Identity = 29/74 (39.19%), Postives = 45/74 (60.81%), Query Frame = 3
Query:  138 RSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRI 359
            RS+F+GN+PY+  E+++ + F   GPV   R+V DRESG  KG+G+  +        AL +LD  +  GR +R+
Sbjct:  213 RSVFIGNLPYDVEEDRIRSHFEPCGPVESVRVVRDRESGMGKGFGYILFKGTDAVLLAL-HLDGSEMAGRKVRV 285          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Sea Lamprey
Match: snrnp70 (small nuclear ribonucleoprotein 70 (U1) [Source:ZFIN;Acc:ZDB-GENE-040825-2])

HSP 1 Score: 55.4546 bits (132), Expect = 2.731e-9
Identity = 24/70 (34.29%), Postives = 39/70 (55.71%), Query Frame = 3
Query:  138 RSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGR 347
            +++FV  I Y+ +E KL   F   GP+    ++Y++ SGKP+GY F EY       SA ++ D    +G+
Sbjct:  103 KTLFVARINYDTSESKLRREFEVYGPIRRITMIYNKVSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGK 172          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Sea Lamprey
Match: snrnp70 (small nuclear ribonucleoprotein 70 (U1) [Source:ZFIN;Acc:ZDB-GENE-040825-2])

HSP 1 Score: 55.0694 bits (131), Expect = 3.189e-9
Identity = 24/70 (34.29%), Postives = 39/70 (55.71%), Query Frame = 3
Query:  138 RSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGR 347
            +++FV  I Y+ +E KL   F   GP+    ++Y++ SGKP+GY F EY       SA ++ D    +G+
Sbjct:  102 KTLFVARINYDTSESKLRREFEVYGPIRRITMIYNKVSGKPRGYAFIEYEHERDMHSAYKHADGKKIDGK 171          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Sea Lamprey
Match: pabpn1 (poly(A) binding protein, nuclear 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2401])

HSP 1 Score: 55.4546 bits (132), Expect = 4.349e-9
Identity = 26/85 (30.59%), Postives = 48/85 (56.47%), Query Frame = 3
Query:  111 MQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGP 365
             ++ ++   RSI+VGN+ Y AT E+L   F   G V    ++ D+ +G PKG+ + E++      +A+  LD+  + GR +++ P
Sbjct:   89 FEEKMEADARSIYVGNVDYHATAEELEAHFHGCGSVNRVTILCDKFTGHPKGFAYIEFSEKESIRTAMA-LDDSLFRGRQIKVLP 172          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Sea Lamprey
Match: RBM39 (RNA binding motif protein 39 [Source:HGNC Symbol;Acc:HGNC:15923])

HSP 1 Score: 56.9954 bits (136), Expect = 4.643e-9
Identity = 24/72 (33.33%), Postives = 43/72 (59.72%), Query Frame = 3
Query:  144 IFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRI 359
            ++VG++ +  TE  LM +F   G +   +L+ D E+G+ KG+GF  ++S   A  AL  L+  +  GRP+++
Sbjct:  274 LYVGSLHFNITEAMLMGIFEPFGKIDNIQLMMDPETGRSKGFGFITFSSADCAKKALEQLNGFELAGRPMKV 345          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Yeast
Match: RNA15 (Component of the cleavage and polyadenylation factor I (CF I); CF 1, composed of the CF 1A complex (Rna14p, Rna15p, Clp1p, Pcf11p) and Hrp1, is involved in cleavage and polyadenylation of mRNA 3' ends; interacts with the A-rich polyadenylation signal in complex with Rna14p and Hrp1p; mutant displays reduced transcription elongation in the G-less-based run-on (GLRO) assay; required for gene looping and maintenance of genome stability [Source:SGD;Acc:S000003012])

HSP 1 Score: 78.1814 bits (191), Expect = 1.519e-16
Identity = 58/226 (25.66%), Postives = 101/226 (44.69%), Query Frame = 3
Query:  135 TRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGE-----------------------------------QNSAEVAMTNNTTMKPPQESPYGEKVDPQQA--GIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIPQT 701
            +R +++G+IPY+ TEE+++ L S  GPVI  ++++D ++G+ KGY F E+     +ASA+RNL+      R L+ G ++                                     QNS      N  + K P E P G  V+       + IS  +A  P E     +Q+ ++  +++P +A  LL   PQL++   +  +   I +    I + +R  E+   T
Sbjct:   17 SRVVYLGSIPYDQTEEQILDLCSNVGPVINLKMMFDPQTGRSKGYAFIEFRDLESSASAVRNLNGYQLGSRFLKCGYSSNSDISGVSQQQQQQYNNINGNNNNNGNNNNNSNGPDFQNSGN---ANFLSQKFP-ELPSGIDVNINMTTPAMMISSELAKKPKEVQLKFLQKFQEWTRAHPEDAVSLLELCPQLSFVTAELLLTNGICKVDDLIPLASRPQEEASAT 238          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Yeast
Match: SGN1 (Cytoplasmic RNA-binding protein; contains an RNA recognition motif (RRM); may have a role in mRNA translation, as suggested by genetic interactions with genes encoding proteins involved in translational initiation [Source:SGD;Acc:S000001440])

HSP 1 Score: 63.1586 bits (152), Expect = 7.766e-12
Identity = 29/65 (44.62%), Postives = 40/65 (61.54%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALR 317
            L+  +RSIFVGNI  + T E++   F   G +    L+YDR +G PKGYG+ E+ SPA    AL+
Sbjct:   59 LEADSRSIFVGNITPDVTPEQIEDHFKDCGQIKRITLLYDRNTGTPKGYGYIEFESPAYREKALQ 123          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Yeast
Match: NSR1 (Nucleolar protein that binds nuclear localization sequences; required for pre-rRNA processing and ribosome biogenesis; binds to single stranded telomeric DNA and mRNA; methylated by Hmt1p; interaction with Top1p and nucleolar localization are negatively regulated by polyphosphorylation [Source:SGD;Acc:S000003391])

HSP 1 Score: 58.151 bits (139), Expect = 1.164e-9
Identity = 22/71 (30.99%), Postives = 43/71 (60.56%), Query Frame = 3
Query:  141 SIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPL 353
            +IFVG + +   +E L   F   G VIG R++Y+R + + +GYG+ ++ + + A  A++ +   + +GRP+
Sbjct:  169 TIFVGRLSWSIDDEWLKKEFEHIGGVIGARVIYERGTDRSRGYGYVDFENKSYAEKAIQEMQGKEIDGRPI 239          

HSP 2 Score: 45.8246 bits (107), Expect = 8.357e-6
Identity = 21/73 (28.77%), Postives = 43/73 (58.90%), Query Frame = 3
Query:  141 SIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRI 359
            ++F+GN+ + A  + +  LF++ G V+  R+    E+ +PKG+G+ ++++   A  AL  L     + RP+R+
Sbjct:  268 TLFLGNLSFNADRDAIFELFAKHGEVVSVRIPTHPETEQPKGFGYVQFSNMEDAKKALDALQGEYIDNRPVRL 340          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Yeast
Match: PUB1 (Poly (A)+ RNA-binding protein; abundant mRNP-component protein that binds mRNA and is required for stability of many mRNAs; component of glucose deprivation induced stress granules, involved in P-body-dependent granule assembly; implicated in regulation of translation; carries Q/N-rich domain at C- terminus, identified as candidate prion; human homolog Tia1 is critical for normal synaptic plasticity; protein abundance increases in response to DNA replication stress [Source:SGD;Acc:S000004961])

HSP 1 Score: 55.4546 bits (132), Expect = 7.795e-9
Identity = 26/79 (32.91%), Postives = 43/79 (54.43%), Query Frame = 3
Query:  135 TRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAA 371
            T ++FVG++     +E L   F      +   +++D ++G  +GYGF  + S   A +A+ ++   D NGRPLRI  AA
Sbjct:  161 TFNLFVGDLNVNVDDETLRNAFKDFPSYLSGHVMWDMQTGSSRGYGFVSFTSQDDAQNAMDSMQGQDLNGRPLRINWAA 239          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Yeast
Match: NOP13 (Nucleolar protein found in preribosomal complexes; contains an RNA recognition motif (RRM); relative distribution to the nucleolus increases upon DNA replication stress [Source:SGD;Acc:S000005119])

HSP 1 Score: 54.6842 bits (130), Expect = 1.202e-8
Identity = 23/75 (30.67%), Postives = 43/75 (57.33%), Query Frame = 3
Query:  135 TRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRI 359
            +R +FVGN+ ++ T++ L   F   G ++  R+    +SGK KG+ F ++ +   + +AL++       GRPLR+
Sbjct:  238 SRILFVGNLSFDVTDDLLRKHFQHCGDIVKIRMATFEDSGKCKGFAFIDFKNEEGSTNALKDKSCRKIAGRPLRM 312          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Nematostella
Match: EDO37342 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SFY3])

HSP 1 Score: 70.0922 bits (170), Expect = 8.891e-13
Identity = 34/81 (41.98%), Postives = 52/81 (64.20%), Query Frame = 3
Query:  120 NLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIG 362
            +LDK T  +FV N+P++A E ++  LFS+ G V   RLV +R +GKPKGYG+ EY   + A++A+  LD  +  GR + + 
Sbjct:  690 SLDKHT--LFVSNLPFDAKESEIEELFSKHGVVKQVRLVTNR-AGKPKGYGYVEYEQESSASTAVLTLDKTEVKGRTISVA 767          

HSP 2 Score: 54.299 bits (129), Expect = 6.715e-8
Identity = 26/77 (33.77%), Postives = 44/77 (57.14%), Query Frame = 3
Query:  138 RSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPA 368
            R +F+ N+ +  TE+ L   FS+ G V+  R+V +  +G+ KGY + E+N+ +   +AL  +D     GRP+ I P 
Sbjct:  601 RKVFISNLLFSITEDHLRDKFSKLGEVLDVRIVKNM-AGRSKGYAYVEFNNESTVQAAL-AMDREKMEGRPMFISPC 675          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Nematostella
Match: EDO35243 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SM09])

HSP 1 Score: 58.9214 bits (141), Expect = 2.997e-11
Identity = 30/80 (37.50%), Postives = 44/80 (55.00%), Query Frame = 3
Query:  141 SIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQ 380
            S+FVGN+    TEE L  LF QAGP+   R+  D+ +G+ + +GF E++SP     A   LD I    R + + P +  Q
Sbjct:    4 SVFVGNLDSRVTEEILWELFLQAGPLENVRIPTDKNTGQQRSFGFVEFSSPVSVHYASELLDGIRLYDRAINVKPQSNNQ 83          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Nematostella
Match: EDO40536 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6X1])

HSP 1 Score: 60.4622 bits (145), Expect = 5.651e-11
Identity = 35/88 (39.77%), Postives = 50/88 (56.82%), Query Frame = 3
Query:  144 IFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTN 407
            +FVG +    TE +L T FS  GPV   R+V DR +G  KG+GF  + S    A  L   +NID+ GR LR+  A  ++ S++  +TN
Sbjct:   19 VFVGGLARGTTELELETFFSNFGPVADVRIVCDRRTGLNKGFGFITF-SLEEPAKKLIEQNNIDFKGRSLRLRQAIRKKGSSQY-LTN 104          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Nematostella
Match: EDO33926 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SQW0])

HSP 1 Score: 62.7734 bits (151), Expect = 1.110e-10
Identity = 26/89 (29.21%), Postives = 49/89 (55.06%), Query Frame = 3
Query:  144 IFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNN 410
            ++VG++ +  TE  +  +F   G V   +L+YD E+ + KGYGF ++     A  A+  ++  +  GRPL+IGP     +S+  +  ++
Sbjct:  217 LYVGSLHFNITEAMVKAVFEPFGTVDSVQLIYDSETNRSKGYGFVQFREAEAAKRAMEQMNGFELAGRPLKIGPVTERGDSSAYSFLDD 305          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Nematostella
Match: EDO29724 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T2U1])

HSP 1 Score: 56.225 bits (134), Expect = 2.879e-10
Identity = 23/74 (31.08%), Postives = 42/74 (56.76%), Query Frame = 3
Query:  147 FVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPA 368
            ++GN+ Y   E+ L   F     V+  +++ DRE+G+P+G+GF  + S      A+   D  D++GRP+++  A
Sbjct:    8 YIGNLSYSVDEQALEEKF-HGCDVVDVKVITDRETGRPRGFGFVTFGSKEEMEKAIDEFDGQDFDGRPMKVNQA 80          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Medaka
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:101163985])

HSP 1 Score: 230.72 bits (587), Expect = 5.095e-70
Identity = 109/187 (58.29%), Postives = 148/187 (79.14%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSN 683
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+ V P++A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ ML R+ 
Sbjct:   24 MDRSLRSVFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDGVPPEEAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKMLHRTT 208          

HSP 2 Score: 50.0618 bits (118), Expect = 3.228e-6
Identity = 24/40 (60.00%), Postives = 33/40 (82.50%), Query Frame = 3
Query: 1083 EKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            + EKAALIMQVL L+ E++A LP +QR+SI +LK Q++KT
Sbjct:  450 DHEKAALIMQVLQLTPEQIAMLPLEQRQSILILKEQIQKT 489          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Medaka
Match: cstf2 (cleavage stimulation factor subunit 2 [Source:NCBI gene;Acc:101163985])

HSP 1 Score: 230.72 bits (587), Expect = 8.389e-70
Identity = 109/187 (58.29%), Postives = 148/187 (79.14%), Query Frame = 3
Query:  123 LDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSN 683
            +D++ RS+FVGNIPYEATEE+L  +FS+ G V+ FRLVYDRE+GKPKGYGFCEY     A SA+RNL+  +++GR LR+  AA E+N  E  + +  T  P  ESPYG+ V P++A  +IS+AVASLPPEQ+F++M+QMK C+Q++P EAR +LLQNPQLAYALLQAQ++M+IV+P++A+ ML R+ 
Sbjct:   24 MDRSLRSVFVGNIPYEATEEQLKDIFSEVGLVVSFRLVYDRETGKPKGYGFCEYQDQETALSAMRNLNGREFSGRALRVDNAASEKNKEE--LKSLGTGAPIIESPYGDGVPPEEAPESISRAVASLPPEQMFELMKQMKLCVQNSPQEARNMLLQNPQLAYALLQAQVVMRIVDPEIALKMLHRTT 208          

HSP 2 Score: 50.447 bits (119), Expect = 2.947e-6
Identity = 24/40 (60.00%), Postives = 33/40 (82.50%), Query Frame = 3
Query: 1083 EKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKKT 1202
            + EKAALIMQVL L+ E++A LP +QR+SI +LK Q++KT
Sbjct:  470 DHEKAALIMQVLQLTPEQIAMLPLEQRQSILILKEQIQKT 509          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Medaka
Match: rbm39b (RNA-binding protein 39 [Source:NCBI gene;Acc:101167788])

HSP 1 Score: 63.1586 bits (152), Expect = 2.571e-10
Identity = 27/85 (31.76%), Postives = 47/85 (55.29%), Query Frame = 3
Query:  144 IFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVA 398
            ++VG++ +  TEE L  +F   G + G +L+ D E+G+ KGYGF  +     A  AL  L+  +  GRP+++G      +S+  +
Sbjct:  231 LYVGSLHFNITEEMLRGIFEPFGKIEGIQLMMDSETGRSKGYGFISFADAECAKKALEQLNGFELAGRPMKVGHVTERSDSSTAS 315          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Medaka
Match: rbm39b (RNA-binding protein 39 [Source:NCBI gene;Acc:101167788])

HSP 1 Score: 63.1586 bits (152), Expect = 2.625e-10
Identity = 27/85 (31.76%), Postives = 47/85 (55.29%), Query Frame = 3
Query:  144 IFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVA 398
            ++VG++ +  TEE L  +F   G + G +L+ D E+G+ KGYGF  +     A  AL  L+  +  GRP+++G      +S+  +
Sbjct:  249 LYVGSLHFNITEEMLRGIFEPFGKIEGIQLMMDSETGRSKGYGFISFADAECAKKALEQLNGFELAGRPMKVGHVTERSDSSTAS 333          
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Medaka
Match: PABPN1L (PABPN1 like, cytoplasmic [Source:NCBI gene;Acc:101170990])

HSP 1 Score: 61.6178 bits (148), Expect = 2.787e-10
Identity = 30/84 (35.71%), Postives = 50/84 (59.52%), Query Frame = 3
Query:  114 QDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGP 365
            ++ +D   RS++VGN+ Y AT ++L   F+  GPV    ++ DR SG PKG+ + E++  + A SA+  L    + GR L++ P
Sbjct:   71 EERMDADNRSVYVGNVDYGATADELEIHFNGCGPVNRVTILCDRFSGHPKGFAYIEFSDRSAAQSAV-GLHETMFRGRVLKVLP 153          
BLAST of Cleavage stimulation factor subunit 2 vs. Planmine SMEST
Match: SMESG000009931.1 (SMESG000009931.1)

HSP 1 Score: 491.5 bits (1264), Expect = 7.967e-175
Identity = 272/272 (100.00%), Postives = 272/272 (100.00%), Query Frame = 3
Query:  111 MQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIPQTVIEAXXXXXXXXXXXXXXXXXXXXXXXXXEHMQQHNSNGMPPNPAMFRQGMPIHMAPQNVPMPAQMPPFNAFQGP 926
            MQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIPQTVIEAPQNLPNPNMPPQMFMNQQQYPPNMNEHMQQHNSNGMPPNPAMFRQGMPIHMAPQNVPMPAQMPPFNAFQGP
Sbjct:    1 MQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIPQTVIEAPQNLPNPNMPPQMFMNQQQYPPNMNEHMQQHNSNGMPPNPAMFRQGMPIHMAPQNVPMPAQMPPFNAFQGP 272          
BLAST of Cleavage stimulation factor subunit 2 vs. Planmine SMEST
Match: SMESG000048684.1 (SMESG000048684.1)

HSP 1 Score: 158.303 bits (399), Expect = 6.841e-45
Identity = 84/165 (50.91%), Postives = 107/165 (64.85%), Query Frame = 3
Query:  207 AGPVIGFRLVYDRESGKPKGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIPQT 701
            AG +  F L+ D+E+ K +G   CEY  P++A +A++  +NI YNGR LR+       NS                     K     +   ISQAVASLPP+Q++++M+QMK CIQ+NPNEAR +LLQNPQLAYALLQAQI+MKIV+PKVAIAML RS EQIP T
Sbjct:   43 AGAISKFELIDDQETLKFRGMASCEYYHPSMALNAVKMFNNISYNGRQLRVVLKDSVSNS---------------------KASEHVSDSVISQAVASLPPDQMYELMKQMKLCIQNNPNEARNMLLQNPQLAYALLQAQIVMKIVDPKVAIAMLNRSLEQIPNT 186          
BLAST of Cleavage stimulation factor subunit 2 vs. Planmine SMEST
Match: SMESG000048684.1 (SMESG000048684.1)

HSP 1 Score: 142.895 bits (359), Expect = 9.624e-40
Identity = 76/142 (53.52%), Postives = 94/142 (66.20%), Query Frame = 3
Query:  276 CEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIPQT 701
            CEY  P++A +A++  +NI YNGR LR+       NS                     K     +   ISQAVASLPP+Q++++M+QMK CIQ+NPNEAR +LLQNPQLAYALLQAQI+MKIV+PKVAIAML RS EQIP T
Sbjct:    4 CEYYHPSMALNAVKMFNNISYNGRQLRVVLKDSVSNS---------------------KASEHVSDSVISQAVASLPPDQMYELMKQMKLCIQNNPNEARNMLLQNPQLAYALLQAQIVMKIVDPKVAIAMLNRSLEQIPNT 124          
BLAST of Cleavage stimulation factor subunit 2 vs. Planmine SMEST
Match: SMESG000031637.1 (SMESG000031637.1)

HSP 1 Score: 143.665 bits (361), Expect = 1.011e-39
Identity = 76/142 (53.52%), Postives = 94/142 (66.20%), Query Frame = 3
Query:  276 CEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIPQT 701
            CEY  P++A +A++  +NI YNGR LR+       NS                     K     +   ISQAVASLPP+Q++++M+QMK CIQ+NPNEAR +LLQNPQLAYALLQAQI+MKIV+PKVAIAML RS EQIP T
Sbjct:    4 CEYYHPSMALNAVKMFNNISYNGRQLRVVLKDSVSNS---------------------KASEHVSDSVISQAVASLPPDQMYELMKQMKLCIQNNPNEARNMLLQNPQLAYALLQAQIVMKIVDPKVAIAMLNRSLEQIPNT 124          
BLAST of Cleavage stimulation factor subunit 2 vs. Planmine SMEST
Match: SMESG000048684.1 (SMESG000048684.1)

HSP 1 Score: 142.895 bits (359), Expect = 2.225e-39
Identity = 76/142 (53.52%), Postives = 94/142 (66.20%), Query Frame = 3
Query:  276 CEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNNTTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSNPNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIPQT 701
            CEY  P++A +A++  +NI YNGR LR+       NS                     K     +   ISQAVASLPP+Q++++M+QMK CIQ+NPNEAR +LLQNPQLAYALLQAQI+MKIV+PKVAIAML RS EQIP T
Sbjct:    4 CEYYHPSMALNAVKMFNNISYNGRQLRVVLKDSVSNS---------------------KASEHVSDSVISQAVASLPPDQMYELMKQMKLCIQNNPNEARNMLLQNPQLAYALLQAQIVMKIVDPKVAIAMLNRSLEQIPNT 124          

HSP 2 Score: 58.5362 bits (140), Expect = 1.845e-9
Identity = 27/44 (61.36%), Postives = 33/44 (75.00%), Query Frame = 3
Query: 1068 FGRSGEKEKAALIMQVLNLSDEEVAKLPDDQRRSIEVLKNQLKK 1199
            F    E EKAALI+QVL LSD ++A LP+DQRRSI +LK QL +
Sbjct:  217 FNTQNEDEKAALILQVLRLSDHQIALLPEDQRRSILILKEQLNR 260          
The following BLAST results are available for this feature:
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CSTF22.563e-7158.92cleavage stimulation factor subunit 2 [Source:HGNC... [more]
CSTF24.133e-7057.84cleavage stimulation factor subunit 2 [Source:HGNC... [more]
CSTF24.227e-7058.92cleavage stimulation factor subunit 2 [Source:HGNC... [more]
CSTF25.578e-7058.92cleavage stimulation factor subunit 2 [Source:HGNC... [more]
CSTF2T1.803e-6555.68cleavage stimulation factor subunit 2 tau variant ... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cpf-24.896e-5243.78Cleavage and Polyadenylation Factor [Source:UniPr... [more]
cpf-24.896e-5243.78Cleavage and Polyadenylation Factor [Source:UniPr... [more]
R06C1.43.266e-1843.42pep chromosome:WBcel235:I:11930704:11931757:1 gene... [more]
rbm-3.23.930e-1843.21RNA Binding Motif protein homolog [Source:UniProt... [more]
rbm-3.12.198e-1640.79RNA Binding Motif protein homolog [Source:UniProt... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CstF647.705e-6653.61gene:FBgn0027841 transcript:FBtr0083660[more]
CG104665.202e-1131.15gene:FBgn0032822 transcript:FBtr0332178[more]
CG104665.202e-1131.15gene:FBgn0032822 transcript:FBtr0081291[more]
CG33352.110e-1035.92gene:FBgn0036018 transcript:FBtr0076383[more]
Spx1.562e-831.96gene:FBgn0015818 transcript:FBtr0070894[more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cstf21.755e-6858.38cleavage stimulation factor, 3' pre-RNA, subunit 2... [more]
cstf22.914e-6858.38cleavage stimulation factor, 3' pre-RNA, subunit 2... [more]
cstf21.650e-2256.96cleavage stimulation factor, 3' pre-RNA, subunit 2... [more]
rbm39b1.987e-934.25RNA binding motif protein 39b [Source:ZFIN;Acc:ZDB... [more]
rbm39b1.987e-934.25RNA binding motif protein 39b [Source:ZFIN;Acc:ZDB... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mcm3ap1.259e-7057.59minichromosome maintenance complex component 3 ass... [more]
mcm3ap1.924e-7057.59minichromosome maintenance complex component 3 ass... [more]
mcm3ap2.005e-7057.59minichromosome maintenance complex component 3 ass... [more]
mcm3ap3.492e-6659.55minichromosome maintenance complex component 3 ass... [more]
mcm3ap1.742e-6559.55minichromosome maintenance complex component 3 ass... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Cstf25.872e-7158.92cleavage stimulation factor, 3' pre-RNA subunit 2 ... [more]
Cstf29.807e-7158.92cleavage stimulation factor, 3' pre-RNA subunit 2 ... [more]
Cstf22.211e-7058.92cleavage stimulation factor, 3' pre-RNA subunit 2 ... [more]
Cstf2t1.603e-6555.68cleavage stimulation factor, 3' pre-RNA subunit 2,... [more]
Cstf21.011e-5656.77cleavage stimulation factor, 3' pre-RNA subunit 2 ... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q8HXM1|CSTF2_BOVIN1.371e-6958.92Cleavage stimulation factor subunit 2 OS=Bos tauru... [more]
sp|Q8BIQ5|CSTF2_MOUSE1.547e-6958.92Cleavage stimulation factor subunit 2 OS=Mus muscu... [more]
sp|Q5RDA3|CSTF2_PONAB2.009e-6958.92Cleavage stimulation factor subunit 2 OS=Pongo abe... [more]
sp|P33240|CSTF2_HUMAN2.030e-6958.92Cleavage stimulation factor subunit 2 OS=Homo sapi... [more]
sp|Q9H0L4|CSTFT_HUMAN8.658e-6555.68Cleavage stimulation factor subunit 2 tau variant ... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A430QTU61.917e-10176.53Cleavage stimulation factor subunit 2 (Fragment) O... [more]
A0A4Z2DXC31.890e-10076.53Cleavage stimulation factor subunit 2 OS=Schistoso... [more]
C1L4091.610e-9976.53Cleavage stimulation factor, 3' pre-RNA, subunit 2... [more]
A0A183K7411.836e-9976.53RRM domain-containing protein OS=Schistosoma curas... [more]
A0A183LHX51.896e-9976.53RRM domain-containing protein OS=Schistosoma margr... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cstf21.742e-6757.84cleavage stimulation factor subunit 2 [Source:NCBI... [more]
cstf22.466e-6757.84cleavage stimulation factor subunit 2 [Source:NCBI... [more]
cstf24.365e-6657.78cleavage stimulation factor subunit 2 [Source:NCBI... [more]
cstf21.107e-6258.52cleavage stimulation factor subunit 2 [Source:NCBI... [more]
cstf21.685e-6258.52cleavage stimulation factor subunit 2 [Source:NCBI... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rbm341.696e-1139.19RNA binding motif protein 34 [Source:ZFIN;Acc:ZDB-... [more]
snrnp702.731e-934.29small nuclear ribonucleoprotein 70 (U1) [Source:ZF... [more]
snrnp703.189e-934.29small nuclear ribonucleoprotein 70 (U1) [Source:ZF... [more]
pabpn14.349e-930.59poly(A) binding protein, nuclear 1 [Source:ZFIN;Ac... [more]
RBM394.643e-933.33RNA binding motif protein 39 [Source:HGNC Symbol;A... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
RNA151.519e-1625.66Component of the cleavage and polyadenylation fact... [more]
SGN17.766e-1244.62Cytoplasmic RNA-binding protein; contains an RNA r... [more]
NSR11.164e-930.99Nucleolar protein that binds nuclear localization ... [more]
PUB17.795e-932.91Poly (A)+ RNA-binding protein; abundant mRNP-compo... [more]
NOP131.202e-830.67Nucleolar protein found in preribosomal complexes;... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO373428.891e-1341.98Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO352432.997e-1137.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO405365.651e-1139.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO339261.110e-1029.21Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO297242.879e-1031.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
cstf25.095e-7058.29cleavage stimulation factor subunit 2 [Source:NCBI... [more]
cstf28.389e-7058.29cleavage stimulation factor subunit 2 [Source:NCBI... [more]
rbm39b2.571e-1031.76RNA-binding protein 39 [Source:NCBI gene;Acc:10116... [more]
rbm39b2.625e-1031.76RNA-binding protein 39 [Source:NCBI gene;Acc:10116... [more]
PABPN1L2.787e-1035.71PABPN1 like, cytoplasmic [Source:NCBI gene;Acc:101... [more]
back to top
BLAST of Cleavage stimulation factor subunit 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000009931.17.967e-175100.00SMESG000009931.1[more]
SMESG000048684.16.841e-4550.91SMESG000048684.1[more]
SMESG000048684.19.624e-4053.52SMESG000048684.1[more]
SMESG000031637.11.011e-3953.52SMESG000031637.1[more]
SMESG000048684.12.225e-3953.52SMESG000048684.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023657 ID=SMED30023657|Name=Cleavage stimulation factor subunit 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1350bp
TTAAAAACATACAACATTTAAATTTGTATTTTTATTTTTTAAATTAATAC
AACTTTATATTTGGTAGTCAATTATAAACTAAATCCTTTTTATTAATTTA
TCACAATATAATGCAAGACAACCTTGATAAAACAACTCGATCCATATTTG
TTGGAAATATTCCATATGAAGCCACAGAAGAAAAGCTTATGACTTTATTT
AGTCAAGCTGGCCCAGTAATAGGATTTAGATTAGTTTATGATAGGGAATC
CGGGAAACCCAAAGGCTATGGATTTTGTGAATATAATAGTCCGGCAGTTG
CAGCTAGTGCATTGAGAAATTTAGATAATATAGATTATAATGGTCGCCCA
TTGAGAATAGGCCCGGCGGCAGGGGAACAGAACAGTGCAGAAGTGGCTAT
GACTAATAATACTACAATGAAACCACCTCAAGAAAGTCCTTATGGTGAAA
AGGTTGATCCCCAACAAGCTGGTATTGCAATTAGTCAAGCTGTAGCTAGT
TTGCCACCGGAACAATTATTCGATATGATGCAGCAAATGAAACAATGTAT
ACAAAGTAATCCAAATGAAGCTAGACAATTGCTTTTACAAAATCCTCAAT
TGGCTTATGCATTGCTCCAAGCCCAAATTATAATGAAAATCGTTGAACCG
AAAGTAGCAATAGCGATGTTAACTCGCAGTAATGAACAAATTCCTCAAAC
TGTTATTGAGGCTCCTCAAAACCTTCCCAATCCCAATATGCCACCACAAA
TGTTCATGAATCAACAGCAATATCCACCGAACATGAATGAGCATATGCAG
CAGCACAATTCCAACGGAATGCCTCCGAATCCAGCAATGTTTCGTCAGGG
AATGCCAATTCATATGGCTCCTCAAAACGTTCCAATGCCTGCTCAAATGC
CACCGTTTAATGCATTTCAAGGCCCCCCAATGGTCAATAATTTCGCTCCT
CCTCCAATCTTTCCCCATCAACCCGGTAATTCAATCGAGCAGAATATGCG
GCCAGTTGAAATTAAAACCGAAGCTTCCGTTAGACCGGAAGTATCGGCGG
CTGATGTTATGAATTACTTCGGTAGGAGTGGCGAGAAGGAGAAGGCAGCT
TTGATAATGCAAGTTCTCAATCTTAGCGACGAAGAAGTTGCAAAATTGCC
CGATGATCAACGAAGGAGCATTGAAGTTTTAAAAAATCAATTAAAGAAGA
CTTAATATTTGATATAAATATATTCTTTTTGTTTATTGTTAATCAATTGT
GGCCATTACTATTTATATTAAATGTCTTTAATTTCTTTAAATTTGATTGG
TTAATAAGTAAAATAATTCGTGTGCTTTATGATTTTATGTTAGTTCGGAC
back to top

protein sequence of SMED30023657-orf-1

>SMED30023657-orf-1 ID=SMED30023657-orf-1|Name=SMED30023657-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=365bp
MQDNLDKTTRSIFVGNIPYEATEEKLMTLFSQAGPVIGFRLVYDRESGKP
KGYGFCEYNSPAVAASALRNLDNIDYNGRPLRIGPAAGEQNSAEVAMTNN
TTMKPPQESPYGEKVDPQQAGIAISQAVASLPPEQLFDMMQQMKQCIQSN
PNEARQLLLQNPQLAYALLQAQIIMKIVEPKVAIAMLTRSNEQIPQTVIE
APQNLPNPNMPPQMFMNQQQYPPNMNEHMQQHNSNGMPPNPAMFRQGMPI
HMAPQNVPMPAQMPPFNAFQGPPMVNNFAPPPIFPHQPGNSIEQNMRPVE
IKTEASVRPEVSAADVMNYFGRSGEKEKAALIMQVLNLSDEEVAKLPDDQ
RRSIEVLKNQLKKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003723RNA binding
GO:0003676nucleic acid binding
GO:0000166nucleotide binding
Vocabulary: cellular component
TermDefinition
GO:0005847mRNA cleavage and polyadenylation specificity factor complex
Vocabulary: biological process
TermDefinition
GO:0006378mRNA polyadenylation
GO:0031124mRNA 3'-end processing
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0002109X1 cell
PLANA:0002111X2 cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR000504RRM_dom
IPR026896CSTF_C
IPR025742CSTF2_hinge
IPR012677Nucleotide-bd_a/b_plait_sf