G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30023651
Length (bp)1271
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30023651) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30023651) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023651

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30023651h1SMcG0006052 SmedASXL_011630SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
body wall musculatureSMED30023651h1SMcG0006052 dd_Smed_v4_21549_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GPR139 (G protein-coupled receptor 139 [Source:HGNC Symbol;Acc:HGNC:19995])

HSP 1 Score: 60.4622 bits (145), Expect = 2.130e-9
Identity = 59/238 (24.79%), Postives = 101/238 (42.44%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKH-----IQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH--FRCQT---------NYSVRNTT--SNAGSVCV 1065
            WI V + IDR++ V  P + H+ S P R +   +S+ I     +IP  W W  I T+  I           +H++     F ++  + P  +  I N     S+I    RR+   N ++      + T +L  +  +F     P     +I+ H     IQ   +   +    ++L +LN+++NFF+YC    RFR          F+CQ          N+S+ ++   S A S C+
Sbjct:  117 WITVPLTIDRYIAVCHPLKYHTVSYPARTRKVIVSVYITCFLTSIPYYW-WPNIWTEDYIS-------TSVHHVLIWIHCFTVY--LVPCSIFFILN-----SIIVYKLRRKS--NFRLRGYSTGKTTAILFTITSIFATLWAPRII--MILYHLYGAPIQNRWLVHIMSDIANMLALLNTAINFFLYCFISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCI 335          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: AGTR2 (angiotensin II receptor type 2 [Source:HGNC Symbol;Acc:HGNC:338])

HSP 1 Score: 53.9138 bits (128), Expect = 3.030e-7
Identity = 53/210 (25.24%), Postives = 93/210 (44.29%), Query Frame = 1
Query:  421 VAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKT------KSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRET--KMLVVVIGVFIVTETP--------SCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH 1002
            +++DR+  V  PF +  R NP +A      +  +A   ++P  + +++++T       + I   P     Q     + + +  + NI+G +I LI       I+      R+ +L  N  G +R TR+   KM   V+  FI+   P        + AW  ++   +   +    L F  +L   NS +N F+YC  G RF+Q L+ VF 
Sbjct:  138 MSVDRYQSVIYPFLSQRR-NPWQASYIVPLVWCMACLSSLPTFY-FRDVRTIEYLGVNACIMAFPPEKYAQ-----WSAGIALMKNILGFIIPLIF------IATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALAWMGVINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFR 334          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: SSTR5 (somatostatin receptor 5 [Source:HGNC Symbol;Acc:HGNC:11334])

HSP 1 Score: 49.6766 bits (117), Expect = 6.341e-6
Identity = 52/203 (25.62%), Postives = 88/203 (43.35%), Query Frame = 1
Query:  418 IVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNP-DLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRE---TKMLVVVIGVFIVTETPSCAWQII--MKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR 1008
            ++++DR++ V  P  +     P+ AKL S +  +L+L  ++P L      +  +     P P  L     +IY ++L        P++++ +   L+ + V  A  R        +G  RR  E   T+M++VV+ VF     P     I+     + Q      +  FV IL+  NS  N  +Y      FRQ+ QKV   R
Sbjct:  132 VMSVDRYLAVVHPLSSARWRRPRVAKLASAAAWVLSLCMSLPLLVFADVQEGGTCNASWPEPVGLWGAVFIIYTAVL----GFFAPLLVICLCYLLIVVKVRAAGVR--------VGCVRRRSERKVTRMVLVVVLVFAGCWLPFFTVNIVNLAVALPQEPASAGLYFFVVILSYANSCANPVLYGFLSDNFRQSFQKVLCLR 322          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-7 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:Q94219])

HSP 1 Score: 70.4774 bits (171), Expect = 5.571e-13
Identity = 60/232 (25.86%), Postives = 112/232 (48.28%), Query Frame = 1
Query:  379 GNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEI-----KTKSIIRLIPNPDL--GQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLI--------------NNQIGSSRRTRETK-MLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILS--FVDI---LTVLNSSLNFFIYCICGLRFRQNLQK 993
             N    G  WI + + IDR++ + +P +  +    +R +   + ++ +A+ ++IPR +E   I        S +  I   +L   + Y  IY  IL  +F  + P ++L      + I++  A  +R+ L               +++  SSR+  ++  MLV+VI  F+V++       ++   + QS   +S L+  FVDI   L VLN S NF+++ + G RFR++ +K
Sbjct:  115 ANTTHTGSVWIVLTLTIDRYLALCQPLKHRAIGKKRRVRRLMIVVSAMAVMFSIPRFFEVHVILICDEDQLSCVATIDRTELFDNRLYWTIYHVILAMVFVTLLPCLILFALTLRITIALRSAIAKRKSLCAPNSDIDTRCKSIKSSRYNSSRKDHKSNIMLVLVIAKFLVSDILPTVIDVLEHVVGQSAFMRSPLASLFVDISNFLIVLNCSSNFWVFFVWGKRFRRSCRK 346          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-18 (FLP-2 receptor; FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EEB1])

HSP 1 Score: 70.0922 bits (170), Expect = 7.290e-13
Identity = 58/252 (23.02%), Postives = 114/252 (45.24%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKS---IIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTET-------PSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRC---QTNYSVRNTTSNAGSVCVTGYLGNSVHQHLSATENDK 1122
            +I V++ ++R+V V RP Q      P++++   L I + A  YN  R +E++ + T+S     + + +P   + Y++ Y +IL+ + + + P  ++   N  + +++ K SK RQ+L   Q    R    T ML++V  VF +  T           +  + +      +   +    ++L VLNS   F IY     ++RQ L  +    C    ++Y+     S   S+ ++   G  + +  S   N +
Sbjct:   99 YIMVMITLERWVAVCRPLQVRVWCTPRKSRNAILVIIVSAFLYNFVRFFEYRFVVTESGALYEKWLRDPGKHRWYYVGYYTILYIVTHFLVPFSVMAFANGHVIVAMCKLSKTRQMLTRQQ---QREQSTTVMLLIVTFVFAICNTLPFLLNVSESIFPTLFQDESTRGLAYWLNDLSNLLVVLNSGTTFIIYFTFSEKYRQTLVFILKNGCCATVSDYNNYTAMSRTASMRISSETGGQIQRQGSKMSNSR 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-18 (FLP-2 receptor; FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:G5EEB1])

HSP 1 Score: 67.3958 bits (163), Expect = 5.048e-12
Identity = 56/244 (22.95%), Postives = 111/244 (45.49%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKS---IIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTET-------PSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRC---QTNYSVRNTTSNAGSVCVTGYLGNSVHQH 1098
            +I V++ ++R+V V RP Q      P++++   L I + A  YN  R +E++ + T+S     + + +P   + Y++ Y +IL+ + + + P  ++   N  + +++ K SK RQ+L   Q    R    T ML++V  VF +  T           +  + +      +   +    ++L VLNS   F IY     ++RQ L  +    C    ++Y+     S   S+ ++   G  + + 
Sbjct:   99 YIMVMITLERWVAVCRPLQVRVWCTPRKSRNAILVIIVSAFLYNFVRFFEYRFVVTESGALYEKWLRDPGKHRWYYVGYYTILYIVTHFLVPFSVMAFANGHVIVAMCKLSKTRQMLTRQQ---QREQSTTVMLLIVTFVFAICNTLPFLLNVSESIFPTLFQDESTRGLAYWLNDLSNLLVVLNSGTTFIIYFTFSEKYRQTLVFILKNGCCATVSDYNNYTAMSRTASMRISSETGGQIQRQ 339          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-3 (FMRFamide Peptide Receptor family; VRFamide receptor 1 [Source:UniProtKB/TrEMBL;Acc:G5EG36])

HSP 1 Score: 65.855 bits (159), Expect = 1.426e-11
Identity = 61/247 (24.70%), Postives = 117/247 (47.37%), Query Frame = 1
Query:  385 VFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEW----------KEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRET-KMLVVVIGVFIVTETPSC---AWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFR---QNLQKVFHFRCQTNYSVRNTTSNAGSVCVTGY 1074
            +F+    W+ V + IDR++ V  PF  ++     RA +    + I ++ YN+ R+WE+          + I+   + +L  NP     + L Y ++   +     P+ +L + N  +A ++I+AS++R+ L    + S +R   T KM+++V+ VF+V    S     W+I+ K      IG  +    ++L V+NS+     Y     RFR   + L  +  +   + ++V +T + +    VT Y
Sbjct:   90 MFQSVSVWLLVSITIDRYLAVCHPFMVNTYCTRNRALITVGVVVIFSVAYNLIRIWEYTINFDVAPENRTIEDLVVPKLRANPH----FLLWYQNVATLVSQFAFPLTVLCVLNIQVARTIIEASEQRREL----VASVKREHSTAKMMIMVVLVFLVCYIFSFILNIWEILDKETFGGDIGWFMNDINNVLIVVNSTSAIVFYYKYSTRFRNQARTLPGIRWYASMSKFNVYDTEATSNRTMVTRY 328          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: frpr-14 (FMRFamide Peptide Receptor family [Source:UniProtKB/TrEMBL;Acc:O16687])

HSP 1 Score: 60.077 bits (144), Expect = 9.539e-10
Identity = 56/219 (25.57%), Postives = 100/219 (45.66%), Query Frame = 1
Query:  376 LGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHS-RSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKT-----KSIIRLIPNP-DLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQS--ILSFVD---ILTVLNSSLNFFIYCICGLRFRQNLQKV 996
            +  VF+    +  V  A+D F++V  P         P+RAK+  + + ++   YNIP  +E +++       +  +++ P    L   Y+ IY + ++  F  IGP+ LLI+ N  +  +V+              GSS    E   + +++ VF       C +  +M +  +  +     ++ FVD   +L V+N + NFF Y I G  FR  L+KV
Sbjct:  118 VAAVFQTSSVYFCVAAAVDCFIMVVLPESVKQLYCTPRRAKITCVVLMLICFIYNIPHFFELEKVDCLDEDGRDSMQICPTDIRLDPAYYAIYYTYMYTTFLAIGPLTLLILLNICVVFTVVTK------------GSSNENGEDDTISLILVVFFFI---FCNFTALMVNFMEIILNDPSMLVYFVDLSNLLVVVNGTANFFCYLIFGTSFRATLKKV 321          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: FMRFaR (gene:FBgn0035385 transcript:FBtr0340706)

HSP 1 Score: 71.2478 bits (173), Expect = 5.728e-13
Identity = 67/237 (28.27%), Postives = 108/237 (45.57%), Query Frame = 1
Query:  340 YLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWE-----WKEIKTKSIIRLIPNPDL--GQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRE----TKMLVVVIGVFIVTETPSCAWQIIMKHIQQ---SCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR 1008
            Y+   I    + +G + +    ++   V ++R+V V  P +A +     RAK+Y +     +L YN+PR WE     + E     I+  +    L   +TY  IY    + I N I P + L I N L+   V +A++ RQ L      S    RE    T +L VVI  F++   P      ++ +I +   S I   I    ++L  +NSS+NF IY I G +F++    +F  R
Sbjct:  187 YVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRANRERQRL------SRSEKREIGLATMLLCVVIVFFMLNFLP------LVLNISEAFYSTIDHKITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKR 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: FMRFaR (gene:FBgn0035385 transcript:FBtr0332085)

HSP 1 Score: 71.2478 bits (173), Expect = 5.728e-13
Identity = 67/237 (28.27%), Postives = 108/237 (45.57%), Query Frame = 1
Query:  340 YLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWE-----WKEIKTKSIIRLIPNPDL--GQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRE----TKMLVVVIGVFIVTETPSCAWQIIMKHIQQ---SCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR 1008
            Y+   I    + +G + +    ++   V ++R+V V  P +A +     RAK+Y +     +L YN+PR WE     + E     I+  +    L   +TY  IY    + I N I P + L I N L+   V +A++ RQ L      S    RE    T +L VVI  F++   P      ++ +I +   S I   I    ++L  +NSS+NF IY I G +F++    +F  R
Sbjct:  187 YVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRANRERQRL------SRSEKREIGLATMLLCVVIVFFMLNFLP------LVLNISEAFYSTIDHKITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKR 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: FMRFaR (gene:FBgn0035385 transcript:FBtr0072980)

HSP 1 Score: 71.2478 bits (173), Expect = 5.728e-13
Identity = 67/237 (28.27%), Postives = 108/237 (45.57%), Query Frame = 1
Query:  340 YLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWE-----WKEIKTKSIIRLIPNPDL--GQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRE----TKMLVVVIGVFIVTETPSCAWQIIMKHIQQ---SCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR 1008
            Y+   I    + +G + +    ++   V ++R+V V  P +A +     RAK+Y +     +L YN+PR WE     + E     I+  +    L   +TY  IY    + I N I P + L I N L+   V +A++ RQ L      S    RE    T +L VVI  F++   P      ++ +I +   S I   I    ++L  +NSS+NF IY I G +F++    +F  R
Sbjct:  187 YVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRANRERQRL------SRSEKREIGLATMLLCVVIVFFMLNFLP------LVLNISEAFYSTIDHKITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKR 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: SPR (gene:FBgn0029768 transcript:FBtr0344824)

HSP 1 Score: 60.8474 bits (146), Expect = 9.483e-10
Identity = 58/250 (23.20%), Postives = 110/250 (44.00%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLW---------EWK-------EIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLI-NNQIGSSRRTRETK----MLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSI--------LSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR--CQTNYSVRNTTSNAGSVC 1062
            W+ + +A+ R++ V     A +     R +  +  IA+LA  + +PR +         EW         ++T   +      DL  T + ++      +F  + P I+L+  N LL  ++ +A +RR++L   N+    ++ RET     ML+VV+ VF++ E P     +   HI  S I + +        +   +   V +  +NF IYC    +FR+  +++F  R   + + S + +  N    C
Sbjct:  184 WLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFLHQLPRFFDRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFR----VLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECKKLRETNCTTLMLIVVVSVFLLAEIPIAV--VTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETFKEIFLGRLMAKKDSSTKYSIVNGARTC 427          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: SPR (gene:FBgn0029768 transcript:FBtr0339781)

HSP 1 Score: 60.8474 bits (146), Expect = 9.483e-10
Identity = 58/250 (23.20%), Postives = 110/250 (44.00%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLW---------EWK-------EIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLI-NNQIGSSRRTRETK----MLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSI--------LSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR--CQTNYSVRNTTSNAGSVC 1062
            W+ + +A+ R++ V     A +     R +  +  IA+LA  + +PR +         EW         ++T   +      DL  T + ++      +F  + P I+L+  N LL  ++ +A +RR++L   N+    ++ RET     ML+VV+ VF++ E P     +   HI  S I + +        +   +   V +  +NF IYC    +FR+  +++F  R   + + S + +  N    C
Sbjct:  184 WLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFLHQLPRFFDRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFR----VLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECKKLRETNCTTLMLIVVVSVFLLAEIPIAV--VTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETFKEIFLGRLMAKKDSSTKYSIVNGARTC 427          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: gpr142 (G protein-coupled receptor 142 [Source:ZFIN;Acc:ZDB-GENE-130603-30])

HSP 1 Score: 61.6178 bits (148), Expect = 5.150e-10
Identity = 58/237 (24.47%), Postives = 105/237 (44.30%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGS-----SRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQS-----ILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR---CQTNYSVRN--TTSNAGSVCVTG 1071
            W  V + +DR+V +  P      S P RA+     +  LAL   +P  W W ++      R+   P+   T  LI+  +    F    P  + ++ N+L+ + + K  ++RQ +  ++ G      SR  + T ML+ V  VF V   P     +++ H+  + +             ++L +LN+++NFF+YC     FR  ++ V  FR         +RN  T +NA +  ++ 
Sbjct:  119 WATVPLTVDRYVALCHPLLHRQISYPARARRIIAVVLTLALASGVPFFW-WSDM-----WRVSHEPNNLDTA-LIWTHVTIIYF---LPCCIFLVLNSLIILRLRK--RQRQQMCQDESGQQLAVPSRLGKTTAMLLAVTSVFAVLWAPRTG--VVLYHLYVTSVHNDWRVHLAYDLANMLAMLNTAVNFFLYCFVSKPFRAAVRDVLLFRGAPLHPRRPLRNQRTPANASTSSISS 341          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: gpr139 (G protein-coupled receptor 139 [Source:NCBI gene;Acc:798482])

HSP 1 Score: 57.7658 bits (138), Expect = 1.042e-8
Identity = 60/241 (24.90%), Postives = 103/241 (42.74%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKH---IQQSCIGQS-----ILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH--FRCQT---------NYSVRNTT--SNAGSVCV 1065
            WI V + IDR++ V  P + H+ S P R +   L++    L  ++P  W W E+        +P    G         +L  +      ++   +F +L AI V K   RR      ++      + T +L+ +  VF V   P     +I+ H   +Q +  G +     +    ++L +LN+ +NFF+YC    RFR+    V    FRC+          N+S+ ++   S A S C+
Sbjct:  116 WITVPLTIDRYIAVCHPLRYHTVSYPARTRKVILAVYAGCLISSVPYYW-WPELWHG-----LPGASPGGRSSSAGQHVLVWVHCATVYLLPCSVFFSLNAIIVRKLRCRRSCF---RLRGYSTGKTTAILLAITSVFAVLWAPRTL--MILYHLYTVQPAMPGPARLLHLVTDVANMLALLNTGVNFFLYCFISKRFRRMAGTVLKAFFRCRKQPPPFYASHNFSITSSPWISPANSHCI 345          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: drd2l (dopamine receptor D2 like [Source:ZFIN;Acc:ZDB-GENE-030910-1])

HSP 1 Score: 50.8322 bits (120), Expect = 1.877e-6
Identity = 29/93 (31.18%), Postives = 47/93 (50.54%), Query Frame = 1
Query:  724 ASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH 1002
            A+K R   +  ++   +  + T+ML +V+GVFI+   P     ++  H    CI  S+ S V  L  LNS++N  IY    + FR+   K+ H
Sbjct:  360 AAKER---VRGRLSQQKERKATQMLAIVLGVFIICWLPFFLTHVLKAHCGSCCISPSLYSAVTWLGYLNSAVNPVIYTTFNIEFRKAFIKILH 449          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: drd2l (dopamine receptor D2 like [Source:ZFIN;Acc:ZDB-GENE-030910-1])

HSP 1 Score: 50.8322 bits (120), Expect = 2.026e-6
Identity = 29/93 (31.18%), Postives = 47/93 (50.54%), Query Frame = 1
Query:  724 ASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH 1002
            A+K R   +  ++   +  + T+ML +V+GVFI+   P     ++  H    CI  S+ S V  L  LNS++N  IY    + FR+   K+ H
Sbjct:  347 AAKER---VRGRLSQQKERKATQMLAIVLGVFIICWLPFFLTHVLKAHCGSCCISPSLYSAVTWLGYLNSAVNPVIYTTFNIEFRKAFIKILH 436          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: rbm38 (RNA binding motif protein 38 [Source:Xenbase;Acc:XB-GENE-489545])

HSP 1 Score: 63.929 bits (154), Expect = 1.507e-10
Identity = 62/239 (25.94%), Postives = 112/239 (46.86%), Query Frame = 1
Query:  418 IVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILF-AIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQII--MKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYSVRNTTSNAGSVCVTGYLG--NSVHQHLSATEND 1119
            +++ DR++ V RP Q+     PK AK  ++++ IL+    +P ++ +  +   +    I  P+  Q +    G IL+ A      P++++ I + L+   V  + KR +V  N + G  R+   TKM+ + +  F++   P  A  II  +  + +S     + SFV  L+  NS LN  IY +    F++ L++V    C+T+  V + T   G   V   L   N + Q   +   D
Sbjct:  128 VLSFDRYLAVVRPIQSAKWRKPKVAKCVNVTVWILSFLVVLPVVF-FSGVPGDTGTCHIAWPEPAQMWRT--GFILYTAALGFFCPLLVICICHLLIVAQVRSSGKRVRVAPNRRQGPERKV--TKMVALTVTAFVLCWFPFYALNIINLLWPLPESPKLYGLYSFVVALSYANSCLNPIIYALLARPFQRGLRRVL---CRTSVRVADGTLKRGDDEVQEELSRVNGISQEGRSVRTD 358          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: gpr139 (G protein-coupled receptor 139 [Source:NCBI gene;Acc:100493863])

HSP 1 Score: 58.9214 bits (141), Expect = 5.075e-9
Identity = 62/239 (25.94%), Postives = 103/239 (43.10%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQS-----ILSFVDILTVLNSSLNFFIYCICGLRFRQ---NLQKVFHFRCQ-------TNYSVRNTT----SNAGSVCV 1065
            WI V + IDR++ V  P   H+ S P R +   +S+ I     +IP  W W  I        I +      +H++     F ++     ++   IF  L +I V K  ++     N ++      + T +L  +  +F +   P     +I+ H+  S I  S     +    ++L +LN+++NFF+YC    RFR       K F F+CQ       TNY+   T+    S A S C+
Sbjct:  112 WITVPLTIDRYIAVCHPLTYHTVSFPARTRKVIVSVYITCFLTSIPYYW-WPNI-------WIEDYTSTSVHHILIWIHCFTVY-----LVPCSIFFVLNSIIVYKLQRKS----NFRLRGYSTGKTTAILFSITSIFAILWAPRII--MILYHLYVSPIHNSWLVHIVTDIANMLALLNTAINFFLYCFISKRFRTMAAGTLKAF-FKCQKQPVQFYTNYNFSITSSPWISPANSHCI 330          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: GPR142 (G protein-coupled receptor 142 [Source:HGNC Symbol;Acc:HGNC:20088])

HSP 1 Score: 57.3806 bits (137), Expect = 1.852e-8
Identity = 50/213 (23.47%), Postives = 100/213 (46.95%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLW---EWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQS-----ILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHF--RCQ 1014
            W+ VI+ +DR+V +  P Q  S S P+R +   + + + +    +P  W    W++ +T  ++ LI    L  T+        F I+ I  P  + +I N+++   + K +  ++  + N        + T +L+ +  VF V   P     +I+ H+  S + +       +   ++L +LN+++NFF+YC    RFR  ++++     RC 
Sbjct:  121 WVTVILTVDRYVALCYPLQYRSFSYPERTRRVIVFVFLSSFVTGVPFYWWSDVWRDPRTPGLLDLI----LKWTH-------CFIIYFI--PCTIFLITNSVIIYRLRKRTGSKKCQLRNG-------KTTAILLGITSVFAVLWAPRTI--VIIIHMYVSSVNKDWKVHLAMDIGNMLALLNTAVNFFLYCFVNRRFRDTVREILGIFRRCH 311          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Gpr139 (G protein-coupled receptor 139 [Source:MGI Symbol;Acc:MGI:2685341])

HSP 1 Score: 63.5438 bits (153), Expect = 1.146e-10
Identity = 60/238 (25.21%), Postives = 102/238 (42.86%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKH-----IQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH--FRCQT---------NYSVRNTT--SNAGSVCV 1065
            WI V + +DR++ V  P + H+ S P R +   LS+ I     +IP  W W  I T+  I           +H++     F ++  + P  +  I N     S+I    RR+   N ++      + T +L  +  +F     P     +I+ H     IQ   +   +L   ++L +LN+++NFF+YC    RFR          F+CQ          N+S+ ++   S A S C+
Sbjct:  109 WITVPLTVDRYIAVCHPLKYHTVSYPARTRKVILSVYITCFLTSIPYYW-WPNIWTEDYIS-------TSMHHVLVWIHCFTVY--LVPCSIFFILN-----SIIVYKLRRKS--NFRLRGYSTGKTTAILFTITSIFATLWAPRII--MILYHLYGAPIQNPWLVHIMLDVANMLALLNTAINFFLYCFISKRFRTMAAATLKALFKCQKQPVQFYTNHNFSITSSPWISPANSHCI 327          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Agtr2 (angiotensin II receptor, type 2 [Source:MGI Symbol;Acc:MGI:87966])

HSP 1 Score: 53.1434 bits (126), Expect = 3.580e-7
Identity = 53/210 (25.24%), Postives = 92/210 (43.81%), Query Frame = 1
Query:  421 VAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKT------KSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRET--KMLVVVIGVFIVTETP--------SCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH 1002
            +++DR+  V  PF +  R NP +A      +  +A   ++P  + +++++T       + I   P     Q     + + +  + NI+G +I LI       I+      R+ +L  N  G +R TR+   KM   V+  FI+   P        +  W  I+   +   +    L F  +L   NS +N F+YC  G RF+Q L+ VF 
Sbjct:  138 MSVDRYQSVIYPFLSQRR-NPWQASYVVPLVWCMACLSSLPTFY-FRDVRTIEYLGVNACIMAFPPEKYAQ-----WSAGIALMKNILGFIIPLIF------IATCYFGIRKHLLKTNSYGKNRITRDQVLKMAAAVVLAFIICWLPFHVLTFLDALTWMGIINSCEVIAVIDLALPFAILLGFTNSCVNPFLYCFVGNRFQQKLRSVFR 334          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Htr1d (5-hydroxytryptamine (serotonin) receptor 1D [Source:MGI Symbol;Acc:MGI:96276])

HSP 1 Score: 52.7582 bits (125), Expect = 4.336e-7
Identity = 40/138 (28.99%), Postives = 61/138 (44.20%), Query Frame = 1
Query:  598 NPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSC-IGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR 1008
            NP L +++    GS LF              FN       +K      +L   +I ++R  + TK L +++G FI+   P     +++   + SC I  ++  F   L  LNS +N  IY +    FRQ  QKV HFR
Sbjct:  254 NPSLHESHTHTVGSPLF--------------FNQ------VKIKLADSILERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDFRQAFQKVVHFR 371          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Htr1d (5-hydroxytryptamine (serotonin) receptor 1D [Source:MGI Symbol;Acc:MGI:96276])

HSP 1 Score: 52.7582 bits (125), Expect = 4.336e-7
Identity = 40/138 (28.99%), Postives = 61/138 (44.20%), Query Frame = 1
Query:  598 NPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSC-IGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR 1008
            NP L +++    GS LF              FN       +K      +L   +I ++R  + TK L +++G FI+   P     +++   + SC I  ++  F   L  LNS +N  IY +    FRQ  QKV HFR
Sbjct:  254 NPSLHESHTHTVGSPLF--------------FNQ------VKIKLADSILERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDFRQAFQKVVHFR 371          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Htr1d (5-hydroxytryptamine (serotonin) receptor 1D [Source:MGI Symbol;Acc:MGI:96276])

HSP 1 Score: 52.7582 bits (125), Expect = 4.336e-7
Identity = 40/138 (28.99%), Postives = 61/138 (44.20%), Query Frame = 1
Query:  598 NPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSC-IGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR 1008
            NP L +++    GS LF              FN       +K      +L   +I ++R  + TK L +++G FI+   P     +++   + SC I  ++  F   L  LNS +N  IY +    FRQ  QKV HFR
Sbjct:  254 NPSLHESHTHTVGSPLF--------------FNQ------VKIKLADSILERKRISAARERKATKTLGIILGAFIICWLPFFVVSLVLPICRDSCWIHPALFDFFTWLGYLNSLINPVIYTVFNEDFRQAFQKVVHFR 371          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9VZW5|FMAR_DROME (FMRFamide receptor OS=Drosophila melanogaster OX=7227 GN=FMRFaR PE=2 SV=1)

HSP 1 Score: 71.2478 bits (173), Expect = 5.742e-12
Identity = 67/237 (28.27%), Postives = 108/237 (45.57%), Query Frame = 1
Query:  340 YLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWE-----WKEIKTKSIIRLIPNPDL--GQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRE----TKMLVVVIGVFIVTETPSCAWQIIMKHIQQ---SCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR 1008
            Y+   I    + +G + +    ++   V ++R+V V  P +A +     RAK+Y +     +L YN+PR WE     + E     I+  +    L   +TY  IY    + I N I P + L I N L+   V +A++ RQ L      S    RE    T +L VVI  F++   P      ++ +I +   S I   I    ++L  +NSS+NF IY I G +F++    +F  R
Sbjct:  187 YVYPFISPAVFPIGMIAQTASIYMTFTVTLERYVAVCHPLKARALCTYGRAKIYFIVCVCFSLAYNMPRFWEVLTVTYPEPGKDVILHCVRPSRLRRSETYINIYIHWCYLIVNYIIPFLTLAILNCLIYRQVKRANRERQRL------SRSEKREIGLATMLLCVVIVFFMLNFLP------LVLNISEAFYSTIDHKITKISNLLITINSSVNFLIYIIFGEKFKRIFLLIFFKR 411          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P0C0W8|GP139_RAT (Probable G-protein coupled receptor 139 OS=Rattus norvegicus OX=10116 GN=Gpr139 PE=2 SV=1)

HSP 1 Score: 63.929 bits (154), Expect = 7.323e-10
Identity = 60/238 (25.21%), Postives = 102/238 (42.86%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKH-----IQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH--FRCQT---------NYSVRNTT--SNAGSVCV 1065
            WI V + +DR++ V  P + H+ S P R +   LS+ I     +IP  W W  I T+  I           +H++     F ++  + P  +  I N     S+I    RR+   N ++      + T +L  +  +F     P     +I+ H     IQ   +   +L   ++L +LN+++NFF+YC    RFR          F+CQ          N+S+ ++   S A S C+
Sbjct:  109 WITVPLTVDRYIAVCHPLKYHTVSYPARTRKVILSVYITCFLTSIPYYW-WPNIWTEDYIS-------TSMHHVLVWIHCFTVY--LVPCSIFFILN-----SIIVYKLRRKS--NFRLRGYSTGKTTAILFTITSIFATLWAPRII--MILYHLYGAPIQNPWLVHIMLDVANMLALLNTAINFFLYCFISKRFRTMAAATLKALFKCQKQPVQFYTNHNFSITSSPWISPANSHCI 327          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q80UC8|GP139_MOUSE (Probable G-protein coupled receptor 139 OS=Mus musculus OX=10090 GN=Gpr139 PE=2 SV=2)

HSP 1 Score: 63.5438 bits (153), Expect = 8.017e-10
Identity = 60/238 (25.21%), Postives = 102/238 (42.86%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKH-----IQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH--FRCQT---------NYSVRNTT--SNAGSVCV 1065
            WI V + +DR++ V  P + H+ S P R +   LS+ I     +IP  W W  I T+  I           +H++     F ++  + P  +  I N     S+I    RR+   N ++      + T +L  +  +F     P     +I+ H     IQ   +   +L   ++L +LN+++NFF+YC    RFR          F+CQ          N+S+ ++   S A S C+
Sbjct:  109 WITVPLTVDRYIAVCHPLKYHTVSYPARTRKVILSVYITCFLTSIPYYW-WPNIWTEDYIS-------TSMHHVLVWIHCFTVY--LVPCSIFFILN-----SIIVYKLRRKS--NFRLRGYSTGKTTAILFTITSIFATLWAPRII--MILYHLYGAPIQNPWLVHIMLDVANMLALLNTAINFFLYCFISKRFRTMAAATLKALFKCQKQPVQFYTNHNFSITSSPWISPANSHCI 327          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q8SWR3|SPR_DROME (Sex peptide receptor OS=Drosophila melanogaster OX=7227 GN=SPR PE=1 SV=1)

HSP 1 Score: 60.8474 bits (146), Expect = 9.505e-9
Identity = 58/250 (23.20%), Postives = 110/250 (44.00%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLW---------EWK-------EIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLI-NNQIGSSRRTRETK----MLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSI--------LSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFR--CQTNYSVRNTTSNAGSVC 1062
            W+ + +A+ R++ V     A +     R +  +  IA+LA  + +PR +         EW         ++T   +      DL  T + ++      +F  + P I+L+  N LL  ++ +A +RR++L   N+    ++ RET     ML+VV+ VF++ E P     +   HI  S I + +        +   +   V +  +NF IYC    +FR+  +++F  R   + + S + +  N    C
Sbjct:  184 WLTLALAVQRYIYVCHAPMARTWCTMPRVRRCTAYIALLAFLHQLPRFFDRTYMPLVIEWNGSPTEVCHLETSMWVHDYIGVDLYYTSYYLFR----VLFVHLLPCIILVTLNILLFAAMRQAQERRKLLFRENRKKECKKLRETNCTTLMLIVVVSVFLLAEIPIAV--VTAMHIVSSLIIEFLDYGLANICIMLTNFFLVFSYPINFGIYCGMSRQFRETFKEIFLGRLMAKKDSSTKYSIVNGARTC 427          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6DWJ6|GP139_HUMAN (Probable G-protein coupled receptor 139 OS=Homo sapiens OX=9606 GN=GPR139 PE=2 SV=1)

HSP 1 Score: 60.4622 bits (145), Expect = 1.023e-8
Identity = 59/238 (24.79%), Postives = 101/238 (42.44%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKH-----IQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH--FRCQT---------NYSVRNTT--SNAGSVCV 1065
            WI V + IDR++ V  P + H+ S P R +   +S+ I     +IP  W W  I T+  I           +H++     F ++  + P  +  I N     S+I    RR+   N ++      + T +L  +  +F     P     +I+ H     IQ   +   +    ++L +LN+++NFF+YC    RFR          F+CQ          N+S+ ++   S A S C+
Sbjct:  117 WITVPLTIDRYIAVCHPLKYHTVSYPARTRKVIVSVYITCFLTSIPYYW-WPNIWTEDYIS-------TSVHHVLIWIHCFTVY--LVPCSIFFILN-----SIIVYKLRRKS--NFRLRGYSTGKTTAILFTITSIFATLWAPRII--MILYHLYGAPIQNRWLVHIMSDIANMLALLNTAINFFLYCFISKRFRTMAAATLKAFFKCQKQPVQFYTNHNFSITSSPWISPANSHCI 335          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A193KUI2 (GCR070 OS=Schmidtea mediterranea OX=79327 GN=gcr070 PE=2 SV=1)

HSP 1 Score: 186.037 bits (471), Expect = 3.080e-51
Identity = 116/270 (42.96%), Postives = 162/270 (60.00%), Query Frame = 1
Query:  286 VYDGIKVIADEYF----KSKILYLNNLI-------MKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIR--LIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLI--NNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSIL-SFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYSVRNTTSN 1047
            VYD + ++   Y+    +  I+Y ++L+       +   WYLGNV R GRNWIAV VA+DRF++V  PF+AH R+   RA++ S SIA     YNIPR W++ +   K   +  +I NP+L   +  +Y  IL  +  I GPMILLI+FN+LL IS+++A   RQ L+   NQ   S +  ETKML+VVIGVF+ TE PS   Q I     ++C    IL    D LT+LNSS+NF IY +CG RFR+NL+K+F F+   +  + N   N
Sbjct:   70 VYDVLFLLLSSYYIVFARGIIIYFSHLLPELSKNFISLTWYLGNVTRYGRNWIAVSVALDRFIMVRNPFRAHQRNTSFRAQIVSASIAFATFVYNIPRFWDYAKAWDKRTCKWIIIMNPNLSNFHKYVYNIILQMLIMIYGPMILLIVFNSLLTISLVRAKNVRQSLMAKQNQARPSGQM-ETKMLIVVIGVFLFTELPSSILQAI---TTKNCFFYRILIPICDGLTILNSSINFVIYSMCGQRFRENLRKMF-FKTNRDQDLLNRQKN 334          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8J5R9 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 3.463e-38
Identity = 86/211 (40.76%), Postives = 132/211 (62.56%), Query Frame = 1
Query:  370 WYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWK-EIKTKSIIRLI-PNPD-LGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHI--QQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNL 987
            WY G+V R GRNW+ ++VA+DR++VV  PF +  RSNP+R+++Y +++   AL YNIP L+E+K E+     ++++ PNP  LG  Y L+Y  I++ +F  +GPM++L  FN LL  S++ AS+ R  +          T ETKMLVV+I VF+ TE P   W I++      Q+     + S   +LT+ NS++NFFIYC+    FR+N+
Sbjct:  120 WYFGSVARTGRNWVILLVALDRYMVVQNPFYSTQRSNPQRSRIYCVAVTCTALVYNIPLLFEYKSELHQCLQLQILQPNPKRLGFVYMLLYKKIMYILFLTVGPMLVLTAFNILLIRSLLIASRIRAAITRETTRR---TEETKMLVVIIAVFVTTEIPGAVWHILLDTSFDDQTWFNSYLYSIGSLLTLFNSAINFFIYCVWSRNFRRNM 327          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8H7D6 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 144.05 bits (362), Expect = 3.178e-35
Identity = 84/214 (39.25%), Postives = 132/214 (61.68%), Query Frame = 1
Query:  364 PA-WYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSI---IRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKH--IQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNL 987
            PA WYLG+  R  RNWI +IVA+DR+ VV  PF +  RSNP+R+++Y +S++  +L YN+P L E+  +  + +   +       LGQ Y L+Y  ++  IF  +GP++ L++FN LL  S++ AS+ R  +      ++RRT +TKMLVV+I VF+ TE P   WQ+++     + +       S   +LT+LNS++NFFIYC+    FR+N+
Sbjct:  109 PAVWYLGSAARTARNWIILIVALDRYTVVQNPFMSGRRSNPRRSRIYCISVSAASLLYNLPLLLEYTVVPHRCLPLNVSQAQPERLGQVYMLVYKKLMHFIFLSLGPVLWLLVFNALLIRSLLVASRIRATITRE---ATRRTEDTKMLVVIIAVFVATELPGAVWQLLLDTNFEKGNWFYSYFYSIGSLLTLLNSAVNFFIYCVWSANFRRNM 319          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1I8G3R4 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 140.969 bits (354), Expect = 9.307e-34
Identity = 83/214 (38.79%), Postives = 131/214 (61.21%), Query Frame = 1
Query:  364 PA-WYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSI---IRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKH--IQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNL 987
            PA WYLG+  R  RNWI +IVA+DR+ VV  PF +  RSNP+R+++Y +S++  +L YN+P L E+  +  + +   +       LG  Y L+Y  ++  IF  +GP++ L++FN LL  S++ AS+ R  +      ++RRT +TKMLVV+I VF+ TE P   WQ+++     + +       S   +LT+LNS++NFFIYC+    FR+N+
Sbjct:  136 PAVWYLGSAARTARNWIILIVALDRYTVVQNPFMSGRRSNPRRSRIYCISVSAASLLYNLPLLLEYTVVPHRCLPLNVSQAQPERLGYVYMLVYKKLMHFIFLSLGPVLWLLVFNALLIRSLLVASRIRATITRE---ATRRTEDTKMLVVIIAVFVATELPGAVWQLLLDTNFEKGNWFYSYFYSIGSLLTLLNSAVNFFIYCVWSANFRRNM 346          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: R7V780 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_215933 PE=4 SV=1)

HSP 1 Score: 96.6709 bits (239), Expect = 5.354e-18
Identity = 67/253 (26.48%), Postives = 129/253 (50.99%), Query Frame = 1
Query:  286 VYDGIKVIADEYFKSKILYLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWK------EIKTKSIIRLIPNPDL-GQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKR--RQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQS--CIGQSILSFVDI---LTVLNSSLNFFIYCICGLRFRQNLQKVFH 1002
            +Y    V  +E     ++  N + + P   L ++ +    WI V++A +R++ + +PFQA       R +L    + +  + YNIPR  E +       +  +++      P L  + Y++IY S+L+ +F  +GP+++LI+ NT L   +++A KR   + L  +  G  +    T +++V+I +F+V ++P+   Q++  +I +     G++   +  I   +   NSSLNF +YCI   +FRQ L+   H
Sbjct:  184 IYSATTVFLEET-NQYLMPFNTVFIHP---LVHISQLSTVWITVLIAFNRYIAICKPFQAPKLCTITRVRLQVFIMFVCIIVYNIPRFLEQQLVYKIDPVTNQTVPENEGTPLLRDKRYNIIYESLLYCLFVFLGPLVILIVLNTCLIRELMRARKRLLERQLPASMTGEDQENNLTLVMIVIILIFLVCQSPAFLNQLLYLNIGEDYYICGKAYFYYYHISNLMVTANSSLNFVVYCIFRKQFRQRLRAFCH 432          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: gpr142 (probable G-protein coupled receptor 142 [Source:NCBI gene;Acc:103030394])

HSP 1 Score: 55.0694 bits (131), Expect = 6.316e-8
Identity = 50/219 (22.83%), Postives = 94/219 (42.92%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILF----AIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQS-----ILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYSVRN 1035
            W  + + +DR+V +  P      S P RA+     +  LAL   +P  W W ++   S     P   L       + +I++    ++F ++  +I L +          + S R+Q  +  ++G     + T ML+ V  VF V   P  A  +++ H+  S + +           ++L +LN+++NFF+YC     FR  ++ V   R    +  R+
Sbjct:  121 WATIPLTVDRYVALCHPLLHRQISYPARARRIISVVLTLALASGVPFFW-WSDVWRVS----RPPDSLDSALIWTHVTIIYFLPCSVFLVLNSLIFLRLQRRQREQRCQEES-RQQRTVAGRLG-----KTTAMLLAVTSVFTVLWAPRTA--VVLYHLYVSSVHRDWRVHLAYDLANMLAMLNTAVNFFLYCFVSKPFRGAVRDVLLLRGAPLHPPRS 326          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000035261.1 (probable G-protein coupled receptor 139 [Source:NCBI gene;Acc:111191700])

HSP 1 Score: 51.9878 bits (123), Expect = 6.088e-7
Identity = 62/218 (28.44%), Postives = 101/218 (46.33%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFA-----IFNIIG---PMILLIIFNTLLAISVIKASK------RRQVLINNQIGSSRRTRETKMLVVVIGV-FIVTETPS----CAWQIIMKHIQ----QSCIGQSILSFV-DILTVLNSSLNFFIYCICGLRFRQNL 987
            W+ V   I+RF+V+          + + A L   +I +L+   +IP  W    I   + + L  N  +      IY   L++     I + +    P++L+IIFN+L+A  ++ +S+      RR +  +   GS RRT    +L+  I V F+V   P     C  + I  H         +  +I+S V ++L  LNSS NF +YC+   RFRQ L
Sbjct:  100 WVVVAFTIERFLVLRATVSCQRPLHARHALLTCTTIILLSHLASIPAGW----INVVAQVNLTLNGQVVSMPRCIYREALYSTVVVWITSFLSSGVPIMLVIIFNSLIAYHLLCSSRLFTKEERRTIQGSKTRGSIRRT---LLLLGTISVAFVVLTLPRFVTYCILRTIYNHKDFDRDDYEMPINIVSDVANMLHNLNSSTNFLLYCMVSRRFRQEL 310          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: GPR139 (G protein-coupled receptor 139 [Source:NCBI gene;Acc:103040306])

HSP 1 Score: 48.521 bits (114), Expect = 6.734e-6
Identity = 51/222 (22.97%), Postives = 89/222 (40.09%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQS------ILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH--FRCQTNYSVRNTTSN 1047
            WI V + +DR++ V  P + H+ S P R +   +++    L  ++P  W W E+    + R           H++  +    ++     ++   +F +L A  V K   RR      ++      + T +L+ +  VF V   P     +   +  Q     S      I    ++L +LN+ +NFF+YC    RFR     V    F C+    V   T N
Sbjct:  103 WITVPLTVDRYIAVCHPLRYHTMSYPARTRRVIVAVYTGCLLSSVPFYW-WPELW-HGLSRGSGESSNSAGQHVLVWAHCTTVY-----LLPCSVFFSLNASIVQKLRGRRSCF---RLRGFSTGKTTAILLAITSVFAVLWAPRTIMVLYHLYSAQPARPSSARLLHLITDLSNMLALLNTGVNFFLYCFISKRFRAMATTVLKSFFCCKKQSPVFYATHN 314          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: oprd1b (opioid receptor, delta 1b [Source:ZFIN;Acc:ZDB-GENE-030131-8473])

HSP 1 Score: 48.521 bits (114), Expect = 7.558e-6
Identity = 62/230 (26.96%), Postives = 109/230 (47.39%), Query Frame = 1
Query:  418 IVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLW---EWKEIKTKSIIRL-IPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQS----ILS--FVDILTVLNSSLNFFIYCICGLRFRQNLQK-VFHFRC---QTNYS-VRNTTSNAGSVC 1062
            ++++DR++ V  P +A     P +AK+ ++ I IL+    IP +         K K++  L  P+PD    Y+     I   IF  + P++++ I   L+ + +    K  ++L  ++       R T+M++VV+  FI+  TP   + I+   ++   I Q     I+S  F   L  +NSSLN  +Y      F++  ++    FR    Q ++S  RNTT    SVC
Sbjct:  144 MMSVDRYIAVCHPVKALEFRTPVKAKIINVFIWILSSAIGIPIMVIAVTRVNDKGKTVCMLKFPDPDW---YYDTVTKICVFIFAFVVPVLVITICYGLMILRL----KSVRLLSGSKEKDRNMRRITRMVLVVVAAFIICWTPIHIFIIVKTLVE---IDQKNPLVIISWHFCIALGYMNSSLNPVLYAFLDENFKRCFREFCLPFRSCMEQNSFSRARNTTQEPISVC 363          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: oprk1 (opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE-030729-1])

HSP 1 Score: 46.9802 bits (110), Expect = 3.793e-6
Identity = 53/215 (24.65%), Postives = 95/215 (44.19%), Query Frame = 1
Query:  418 IVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLI---PNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRE-TKMLVVVIGVFIVTETP-------------------SCAWQI-IMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQ 990
            I+++DR++ V  P +A     P +AKL ++ I IL+    IP +      K + II  I   P+P +     L    I   IF  I P++++++  +L+ + +     R   L++      R  R  T+M+++V+ +F++  TP                   S AW I +      SC+   + +F+D     N    F  +C     FR++LQ
Sbjct:   67 IMSVDRYIAVCHPVKALDFRTPSKAKLINICIWILSSAIGIPVIVMGTAKKEEGIIECILDFPHPAVKWENLL---KICVFIFAFILPVLIIVVCYSLMVLRL-----RTVRLLSGSKEKDRNLRRITRMVLIVVAIFVICWTPIHLFVIIKSRVSISDTPTVSAAWYICVALGYTNSCLNPVLYAFLD----ENFKRCFKEFCFPA-AFRRDLQ 268          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO36610 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI87])

HSP 1 Score: 60.077 bits (144), Expect = 3.642e-10
Identity = 53/227 (23.35%), Postives = 102/227 (44.93%), Query Frame = 1
Query:  367 AWYLGNVFRCGRN-WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSI-----LFAIFNIIGPMILLIIFNTLLAISVIKA-SKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETP------SCAWQ---IIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVF 999
            AW + ++  CG + W   ++++DRF+ +  PF+ H+   P        ++ IL++   +  L  W E+ +      +        Y+ +   +     LF +  + G  + ++  N   A++ ++  SKRR     + I   +  +  K+L +V+G F+V   P         W+   +  + I +       L+FV +L VLNS+LN  IY +    FR+   K+F
Sbjct:   74 AWIVVDIICCGASIWNLAMISVDRFIAIVMPFRYHALMTPMTGVCLIGAVWILSMGMGMLSLINWTELGSPHFHIEVQCRKFDPVYYTVVSVVGFFLPLFIVLLMYG-QVFVVAMNQARAVAALQTDSKRRGR--RSSINLVKEVKAAKILAIVVGCFVVCWFPFFVLTLVSLWEPHALSKETISKDTARGITLTFVYVLPVLNSTLNPIIYALFNRDFRRAFGKIF 297          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO36609 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI86])

HSP 1 Score: 53.9138 bits (128), Expect = 5.069e-8
Identity = 53/240 (22.08%), Postives = 99/240 (41.25%), Query Frame = 1
Query:  367 AWYLGNVFRCGRN-WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPM-ILLIIFNTLLAISVIKASKRRQVLINNQIGSS----------RRTRETKMLVVVIGVFIVTETP------SCAWQIIM------KHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQ 1014
            AW + ++   G + W  VI++IDRF+ +  PF+ H+   P        S+  L+    +     W +         I   +    Y+ +   +LF +     P+ I+ +++  +  +++ +A     +  + Q  +           +  +  K+L +V+G F+V   P         W  I+         Q   I Q+   FV  L VLNS+LN  IY +    FR++  K+F   C+
Sbjct:  104 AWIVVDIMCAGASIWNLVIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDYGKPHFNIFISCANFDPIYYTVLSVVLFFL-----PLFIVFVMYGHVFTVALTQARAVAALQTDRQATTDGGRRGYINFLKEVKAAKVLAIVVGCFVVCWFPYFVLVLVSLWDPILLSRDTISPEQAKGINQT---FVSALPVLNSTLNPIIYALFNKDFRRSFAKIFAQFCR 335          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO35030 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SMQ7])

HSP 1 Score: 53.1434 bits (126), Expect = 9.001e-8
Identity = 50/215 (23.26%), Postives = 95/215 (44.19%), Query Frame = 1
Query:  415 VIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSII--RLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYSVRNTTSNAG 1053
            V +A +R+  +  P   H R++   AK+  +   I ++   IP  +  +  K + +   R   +  L Q Y + +   LF +  I  P  LL+ + + +  S+  A    Q           R   TKML+ +  ++++   P+    +++       +GQ I +   IL V NS++N ++Y +    FR+ L++     CQ  Y V+  +S A 
Sbjct:  107 VSLAYERYSAIVNPINIHKRTSKTSAKILCIIAWITSIMICIPEFFGHQYSKEREVCYQRWPADEWLPQAYSMFW---LFIVGFI--PSTLLVFYYSRIVRSLWFAEHPSQEAHAQMAALRYRKSVTKMLIGISVIYMIGWMPTLFVFVLVYWHTGYQVGQVIGAVTAILVVFNSAVNPYVYALQSKSFRKQLKRYLVCCCQCQYEVQPISSLAA 316          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO36608 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SI85])

HSP 1 Score: 52.7582 bits (125), Expect = 9.240e-8
Identity = 53/229 (23.14%), Postives = 98/229 (42.79%), Query Frame = 1
Query:  367 AWYLGNVFRCGRN-WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILF-----AIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGS---SRRTRETKMLVVVIGVFIVTETP------SCAWQIIMKHIQQSCIGQS---ILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVF 999
            AW + ++   G + W   I++IDRF+ +  PF+ H+   P        S+  L+    +     W +         I   +    Y+ +   +LF      +F + G  +  +  N   A++ ++ + R+      + GS    +  +  K+L +V+G F+V   P         W  I+   +     Q+     +FV +L VLNS+LN FIY +    FR++  K+F
Sbjct:   83 AWIVVDIICAGASIWNLAIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDYGKPHFNIFISCANFDPIYYTVVSVVLFFLPLYIVFVMYG-RVFTVALNHARAVAALQ-TDRQATTDGGRRGSINFLKEVKAAKVLAIVVGCFVVCWFPYFVLVLVSLWDPILLSRETISPEQAKGITQTFVYVLPVLNSTLNPFIYALFNKDFRRSFAKIF 309          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO28321 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T6T3])

HSP 1 Score: 52.7582 bits (125), Expect = 9.493e-8
Identity = 53/229 (23.14%), Postives = 98/229 (42.79%), Query Frame = 1
Query:  367 AWYLGNVFRCGRN-WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILF-----AIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGS---SRRTRETKMLVVVIGVFIVTETP------SCAWQIIMKHIQQSCIGQS---ILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVF 999
            AW + ++   G + W   I++IDRF+ +  PF+ H+   P        S+  L+    +     W +         I   +    Y+ +   +LF      +F + G  +  +  N   A++ ++ + R+      + GS    +  +  K+L +V+G F+V   P         W  I+   +     Q+     +FV +L VLNS+LN FIY +    FR++  K+F
Sbjct:   83 AWIVVDIICAGASIWNLAIISIDRFIAIVLPFRYHALMTPISGFGLIASVWGLSFVMAVLSFINWTDYGKPHFNIFISCANFDPIYYTVVSVVLFFLPLYIVFVMYG-RVFTVALNHARAVAALQ-TDRQATTDGGRRGSINFLKEVKAAKVLAIVVGCFVVCWFPYFVLVLVSLWDPILLSRETISPEQAKGITQTFVYVLPVLNSTLNPFIYALFNKDFRRSFAKIF 309          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: gpr142 (probable G-protein coupled receptor 142 [Source:NCBI gene;Acc:101163443])

HSP 1 Score: 66.6254 bits (161), Expect = 1.236e-11
Identity = 61/242 (25.21%), Postives = 102/242 (42.15%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQS-----ILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYS-VRNTTSNAGSVCVTGYLGNSVHQHLSATE 1113
            W  V + +DR+V +  P      S P RA+    S+  LAL   +P  W W ++   S      +P       LI+  +    F    P  +  + N+L+ I  ++  KRRQ        + R  + T ML+ +  VF V   P  A  +++ H+  S +             ++L +LN+++NFF+YC     FR  ++ V   R  + YS  R   S   +   + Y GN+      +T 
Sbjct:  121 WSTVPLTVDRYVALCHPLLHRQISYPARARRIIASVLALALASGVPFFW-WSDMWRNS------HPPTALDSVLIWTHVTIIYF---LPCSIFFVLNSLI-IHTLRVRKRRQPCQKGHRPAQRLGKTTAMLLAITSVFSVLWAPRTA--VVIYHLYVSSVHSDWRVHLAYDLSNMLAMLNTAVNFFLYCFVSKPFRNVVRDVVLLRRWSLYSGPRQHQSPNNNSISSLYSGNNKRSQRDSTP 349          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000042752.1 (pep primary_assembly:ASM223467v1:24:10229220:10232247:1 gene:ENSORLG00000028764.1 transcript:ENSORLT00000042752.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 57.3806 bits (137), Expect = 1.157e-8
Identity = 67/272 (24.63%), Postives = 120/272 (44.12%), Query Frame = 1
Query:  286 VYDGIKVIADEYFKSKILYLNNL----IMKPAW----------YLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPN------PDLGQTYHLIYGSILFAIFNIIG--PMILLIIFNTLLAISVIKAS----KRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIM--KHIQQS------CIGQSILSFV-DILTVLNSSLNFFIYCICGLRFRQNLQKV 996
            VY     IAD ++   ++ L+      I++P W          +L +   C  +WI V+  I+R++V+         S     KL  ++I +L+   ++P  W    I T  ++ L  +      P      H    ++++    + G  P++L+I+FN L+  ++ +AS    K  Q +++ +       R   +L  +  VF+V   P      I+  KH  +S       I  ++   V ++L  LNSS NF +YC+   RFRQ L +V
Sbjct:   48 VYLSSLAIADTFYLIWVILLDLTLTFWILQPFWHSQPWCGILGFLQHGSLCSSSWIVVVFTIERYLVLKSSTVKQRLSEAGVTKLTCMAIVVLSHLVSVPMGW----INTVKLVNLTVDGENMTLPRCLYREHTYSTAVVWIASFLSGGIPIVLVILFNYLIGYNLCRASNLFTKEEQRVMHGRSTRGMLKRTIFLLGTISVVFVVLSLPRFVTYCILRTKHNDESFDRNDYSIPINVAGDVANMLHNLNSSTNFLLYCVVSHRFRQELVQV 315          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000001710.2 (histamine H3 receptor [Source:NCBI gene;Acc:101166291])

HSP 1 Score: 55.4546 bits (132), Expect = 4.817e-8
Identity = 53/221 (23.98%), Postives = 98/221 (44.34%), Query Frame = 1
Query:  415 VIVAIDRFVVVYRPFQAHSRSNPKR-AKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFA-IFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGS----------SRRTRETKM---LVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYSVR 1032
            V+++ DRF+ V R  +  ++ N  R A L  +++ +LA F   P +  W+ I  +SI+   P  +    ++  +  +L A  F    P + +  FN  + +++ + +K     I+ Q  S          SR +R+ K+   L +++ +F +   P     II       C+          L  LNS++N F+Y +C   FR+   K+    C    SV+
Sbjct:  130 VLISYDRFLSVTRAVKYRAQRNMTRQAVLKMVAVWVLAFFLYGPAIIFWEAIVGQSIV---PAHECYAEFYFTWYFLLSASTFEFFTPFVSVAFFNLSIYLNIHQRNKNWNASISAQTASCMPPGRRTPGSRLSRDKKIAKSLAIIVCIFGICWAPYTLLMIIRAACSGECVANYWYEMTFWLLWLNSAINPFLYPLCHTSFRRAFSKIL---CPKRQSVQ 344          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: drd2l (D(2) dopamine receptor A-like [Source:NCBI gene;Acc:101171193])

HSP 1 Score: 50.447 bits (119), Expect = 2.034e-6
Identity = 26/85 (30.59%), Postives = 44/85 (51.76%), Query Frame = 1
Query:  748 INNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFH 1002
            +  ++   +  + T+ML +V+GVFI+   P     ++  H +  CI  S+ S V  L  LNS++N  IY    + FR+   K+ H
Sbjct:  402 VRGRLSQQKERKATQMLAIVLGVFIICWLPFFLTHVLKAHCRSCCISPSLYSAVTWLGYLNSAVNPVIYTTFNIEFRKAFIKILH 486          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: oprd1a (delta-type opioid receptor [Source:NCBI gene;Acc:101163183])

HSP 1 Score: 48.521 bits (114), Expect = 8.492e-6
Identity = 55/235 (23.40%), Postives = 103/235 (43.83%), Query Frame = 1
Query:  418 IVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIP----RLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRE-TKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFVDILTVL---NSSLNFFIYCICGLRFRQNLQKVFHFRCQTNY------SVRNTTSNAGSVCVTGYLG 1080
            ++++DR++ V  P +A     P +AK+ ++ I IL+    +P     + +  +    + +   P+PD    Y      I   IF  + P++++ +   L+ + +     R   L++      R  R  T+M++VV+  FIV  TP   + I+   ++       +++   +   L   NSSLN  +Y      F++  +  F   C+T        S RNTT    SVC    +G
Sbjct:  144 MMSVDRYIAVCHPVKALGFRTPAKAKMINILIWILSSAIGVPIMIMAVTKVTDTNKTTCMLSFPDPDW---YWDTVIKICVFIFAFVVPVMVITVCYGLMILRL-----RSVRLLSGSKEKDRNMRRITRMVLVVVAAFIVCWTPIHIFIIVRTMVEVDTRNPFVVASWHLCIALGYTNSSLNPVLYAFLDENFKRCFRD-FCLPCRTRVEQNSMTSGRNTTREPVSVCAPAEVG 369          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000046941.1 (SMESG000046941.1)

HSP 1 Score: 634.024 bits (1634), Expect = 0.000e+0
Identity = 368/369 (99.73%), Postives = 368/369 (99.73%), Query Frame = 1
Query:   37 MDINESFYNVIGSNNTCSDGFSIFKFSINAXXXXXXXXXXXXXXXXXXXXXXRDWXXXXXXXXXXXXXXXXXXXXXXXXXXXXVYDGIKVIADEYFKSKILYLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYSVRNTTSNAGSVCVTGYLGNSVHQHLSATENDKFVRETVM 1143
            MDINESFYNVIGSNNTCSDGFSIFKFSINALIGSILILVGIVGNIISIIVLNRDWSRSSMSVLLSGLGMYDILFLILSIYYIIVYDGIKVIADE FKSKILYLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYSVRNTTSNAGSVCVTGYLGNSVHQHLSATENDKFVRETVM
Sbjct:    1 MDINESFYNVIGSNNTCSDGFSIFKFSINALIGSILILVGIVGNIISIIVLNRDWSRSSMSVLLSGLGMYDILFLILSIYYIIVYDGIKVIADEDFKSKILYLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYSVRNTTSNAGSVCVTGYLGNSVHQHLSATENDKFVRETVM 369          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000070898.1 (SMESG000070898.1)

HSP 1 Score: 144.436 bits (363), Expect = 1.910e-40
Identity = 89/207 (43.00%), Postives = 126/207 (60.87%), Query Frame = 1
Query:  442 VVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIR--LIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLI--NNQIGSSRRTRETKMLVVVIGVFIVTETPSCAWQIIMKHIQQSC-IGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYSVRNTTSN 1047
            +V  PF+AH R+   RA++ S SIA     YNIPR W++ +   K   +  +I NP+L   +  +Y  IL  +  I GPMILLI+FN+LL IS+++A   RQ L+   NQ   S +  ETKML+VVIGVF+ TE PS   Q I     ++C I + ++   D LT+LNSS+NF IY +CG RFR+NL+K+F F+   +  + N   N
Sbjct:    1 MVRNPFRAHQRNTSFRAQIVSASIAFATFVYNIPRFWDYAKAWDKRTCKWIIIMNPNLSNFHKYVYNIILQMLIMIYGPMILLIVFNSLLTISLVRAKNVRQSLMAKQNQARPSGQM-ETKMLIVVIGVFLFTELPSSILQAI---TTKNCFIYRILIPICDGLTILNSSINFVIYSMCGQRFRENLRKMF-FKTNRDQDLLNRQKN 202          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000059705.1 (SMESG000059705.1)

HSP 1 Score: 76.6406 bits (187), Expect = 6.252e-15
Identity = 66/258 (25.58%), Postives = 111/258 (43.02%), Query Frame = 1
Query:  370 WYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTK-------SIIRLIPNPDLGQT--YHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKR----RQVLINNQIGSSRRTRE---------------------------------TKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSIL---SFVDILTVLNSSLNFFIYCICGLRFRQNLQKV 996
            W L    +   NW+ V+V ++R+  +  PF A         KL S+    LA+ +NIPR +EW  I  +       S+IR   N  L +   Y ++Y S+ +A+   IGP+  ++  N  L I +IK++      R V  N  I  S R R                                   +++++++ VFI+ E P+   Q +   +  +     ++   S  + L  L SS NF IYC+ G +FR  L+++
Sbjct:  152 WSLAMTIQMTVNWLVVLVTVERYCALKHPFIAKKFFTNGNLKLISILSIALAVVFNIPRFYEWDVINFRIDPCFNYSVIR-ADNSHLRENAIYSILYRSVFYAVLVAIGPVACVLWLNVSL-IKLIKSAGNNLIIRNVSANTSISHSSRQRNQVNGPTYQLFQPAASTSISTAYGQCIQEKNRSVNRLIILLVSVFIICEIPALIHQFLAVFVTSTSHDSPMIYTVSLSNALVTLKSSSNFLIYCLGGKKFRFTLRRL 407          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000020718.1 (SMESG000020718.1)

HSP 1 Score: 71.633 bits (174), Expect = 2.806e-13
Identity = 76/324 (23.46%), Postives = 142/324 (43.83%), Query Frame = 1
Query:  286 VYDGIKVIADEYFKSKILYLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNP---DLGQTYH------LIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGS-----SRRTRE-TKMLVVVIGVFIVTETPSCAWQII----------------MKHIQQSCIGQSILSFVDILTVLNSSLNFFIYCICGLRFRQNLQKVF-------HFRCQTNYSVRNTTSNAGSVCVTGYLGNSVHQHLSATENDKFVRETVM 1143
            ++  +K   D   K KI   N      + Y G        W+ V V ++R +V+  PF+AH+     RA + S+S+A + +  N   ++      +  +     N       ++Y       L+  +I+++      P I +   N ++ I V +A + RQ ++    G      S  TR+ T ML+++ G F++T TP    +++                   I+ +   Q   S  +IL  LN +LNF++YC  G +FR  L+ +F       +F   +N + +N+   A S+ +T +L N   + L+   + +FVR  ++
Sbjct:  132 IFGLLKRWVDYLLKRKIENRNKTFCILSQYFGTSASVLSVWLIVAVTLERAIVISFPFKAHNLIQKSRAIVISISMASVIMILNCHFIFTLDLTNSTQLFESTDNNFVCGFSESYRNFKTVWLLIDAIIYSFL----PFIFIFALNVIILIKVCQARRTRQSMMTLNRGQKSVYRSESTRQLTIMLLMISGTFLITTTPIFIVKMLYVVPKAFSKAIPKTFHAPGIRDAVASQFADSIAEILMHLNHALNFYLYCASGNKFRACLKSLFSKCRLFRYFHYSSNSAAQNSLF-ANSMKMTRHLNND-SKWLNDDHSCQFVRHRIV 449          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000013112.1 (SMESG000013112.1)

HSP 1 Score: 67.781 bits (164), Expect = 2.541e-12
Identity = 63/233 (27.04%), Postives = 108/233 (46.35%), Query Frame = 1
Query:  406 WIAVIVAIDRFVVVYRPFQAHSRSNPKRAKLYSLSIAILALFYNIPRLWEWKEIK-TKSIIRLIPNPDLGQTYHLIYGSILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQI------GSSRRTRE----TKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFV-DILTVLNSSLNFFIYCICGLRFRQNLQKVFHFRCQTNYSVRNTTSNAGSVCVT 1068
            WI V +  +R+  V  P +A    + K++    + I++ ++FYN+PR  E   +    S    + + D    +H  Y S  + +     P+++L   N +L    I+  K  Q+ + N          SRR R     T+M+VVV+ +FI  + P+  + I       + I   I+S + + L +LNS++NF +YC  G +FR+    V    C  N +V N  S   +V  T
Sbjct:   90 WITVGLTCERYFAVCFPLKAQFFISMKKSFWCVILISLFSIFYNVPRWLEEIPMSINNSEHTFVNHSDSTIGFHKFYYSYAYIVIMFFIPLLVLSSMNYML----IRELKNSQLYVLNDTNKSLISSKSRRIRSDNNVTRMIVVVVSIFIFCQFPALIYNIKFGIQPANDISWEIISEIRNFLVILNSAVNFILYCAFGQKFRRTFVHVI-IPCNENENVVNRRSLTNNVTNT 317          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 3
Match NameE-valueIdentityDescription
GPR1392.130e-924.79G protein-coupled receptor 139 [Source:HGNC Symbol... [more]
AGTR23.030e-725.24angiotensin II receptor type 2 [Source:HGNC Symbol... [more]
SSTR56.341e-625.62somatostatin receptor 5 [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
frpr-75.571e-1325.86FMRFamide Peptide Receptor family [Source:UniProt... [more]
frpr-187.290e-1323.02FLP-2 receptor; FMRFamide Peptide Receptor family ... [more]
frpr-185.048e-1222.95FLP-2 receptor; FMRFamide Peptide Receptor family ... [more]
frpr-31.426e-1124.70FMRFamide Peptide Receptor family; VRFamide recept... [more]
frpr-149.539e-1025.57FMRFamide Peptide Receptor family [Source:UniProt... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
FMRFaR5.728e-1328.27gene:FBgn0035385 transcript:FBtr0340706[more]
FMRFaR5.728e-1328.27gene:FBgn0035385 transcript:FBtr0332085[more]
FMRFaR5.728e-1328.27gene:FBgn0035385 transcript:FBtr0072980[more]
SPR9.483e-1023.20gene:FBgn0029768 transcript:FBtr0344824[more]
SPR9.483e-1023.20gene:FBgn0029768 transcript:FBtr0339781[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gpr1425.150e-1024.47G protein-coupled receptor 142 [Source:ZFIN;Acc:ZD... [more]
gpr1391.042e-824.90G protein-coupled receptor 139 [Source:NCBI gene;A... [more]
drd2l1.877e-631.18dopamine receptor D2 like [Source:ZFIN;Acc:ZDB-GEN... [more]
drd2l2.026e-631.18dopamine receptor D2 like [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
rbm381.507e-1025.94RNA binding motif protein 38 [Source:Xenbase;Acc:X... [more]
gpr1395.075e-925.94G protein-coupled receptor 139 [Source:NCBI gene;A... [more]
GPR1421.852e-823.47G protein-coupled receptor 142 [Source:HGNC Symbol... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gpr1391.146e-1025.21G protein-coupled receptor 139 [Source:MGI Symbol;... [more]
Agtr23.580e-725.24angiotensin II receptor, type 2 [Source:MGI Symbol... [more]
Htr1d4.336e-728.995-hydroxytryptamine (serotonin) receptor 1D [Sourc... [more]
Htr1d4.336e-728.995-hydroxytryptamine (serotonin) receptor 1D [Sourc... [more]
Htr1d4.336e-728.995-hydroxytryptamine (serotonin) receptor 1D [Sourc... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VZW5|FMAR_DROME5.742e-1228.27FMRFamide receptor OS=Drosophila melanogaster OX=7... [more]
sp|P0C0W8|GP139_RAT7.323e-1025.21Probable G-protein coupled receptor 139 OS=Rattus ... [more]
sp|Q80UC8|GP139_MOUSE8.017e-1025.21Probable G-protein coupled receptor 139 OS=Mus mus... [more]
sp|Q8SWR3|SPR_DROME9.505e-923.20Sex peptide receptor OS=Drosophila melanogaster OX... [more]
sp|Q6DWJ6|GP139_HUMAN1.023e-824.79Probable G-protein coupled receptor 139 OS=Homo sa... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A193KUI23.080e-5142.96GCR070 OS=Schmidtea mediterranea OX=79327 GN=gcr07... [more]
A0A1I8J5R93.463e-3840.76G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1I8H7D63.178e-3539.25G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A1I8G3R49.307e-3438.79G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
R7V7805.354e-1826.48G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
gpr1426.316e-822.83probable G-protein coupled receptor 142 [Source:NC... [more]
ENSAMXT00000035261.16.088e-728.44probable G-protein coupled receptor 139 [Source:NC... [more]
GPR1396.734e-622.97G protein-coupled receptor 139 [Source:NCBI gene;A... [more]
oprd1b7.558e-626.96opioid receptor, delta 1b [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
oprk13.793e-624.65opioid receptor, kappa 1 [Source:ZFIN;Acc:ZDB-GENE... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO366103.642e-1023.35Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366095.069e-822.08Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO350309.001e-823.26Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO366089.240e-823.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO283219.493e-823.14Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gpr1421.236e-1125.21probable G-protein coupled receptor 142 [Source:NC... [more]
ENSORLT00000042752.11.157e-824.63pep primary_assembly:ASM223467v1:24:10229220:10232... [more]
ENSORLT00000001710.24.817e-823.98histamine H3 receptor [Source:NCBI gene;Acc:101166... [more]
drd2l2.034e-630.59D(2) dopamine receptor A-like [Source:NCBI gene;Ac... [more]
oprd1a8.492e-623.40delta-type opioid receptor [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000046941.10.000e+099.73SMESG000046941.1[more]
SMESG000070898.11.910e-4043.00SMESG000070898.1[more]
SMESG000059705.16.252e-1525.58SMESG000059705.1[more]
SMESG000020718.12.806e-1323.46SMESG000020718.1[more]
SMESG000013112.12.541e-1227.04SMESG000013112.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023651 ID=SMED30023651|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1271bp
GTCTTCGAATTGCATTTTTTTGTAAATAGGTTTTAGATGGATATCAATGA
GTCGTTTTATAATGTCATTGGCTCCAATAATACATGTTCCGATGGCTTTA
GTATTTTTAAATTTTCAATCAACGCTTTGATAGGATCTATTTTGATTCTG
GTCGGAATTGTAGGAAATATTATATCAATCATAGTTCTGAACCGAGATTG
GTCTCGTTCATCGATGAGTGTATTGCTCTCAGGCCTTGGAATGTATGATA
TACTGTTTCTAATCCTCTCCATCTATTACATCATCGTATACGATGGAATA
AAAGTTATTGCCGATGAATATTTCAAATCGAAAATCCTCTATTTAAACAA
TTTAATAATGAAACCCGCTTGGTATCTTGGAAATGTTTTCCGGTGTGGAA
GAAACTGGATTGCTGTAATCGTAGCGATTGATAGATTTGTTGTTGTTTAC
CGACCGTTTCAGGCCCATTCTAGAAGTAATCCAAAAAGAGCTAAACTTTA
TTCACTATCTATTGCGATTCTAGCTCTTTTTTACAACATACCGAGATTAT
GGGAATGGAAAGAGATAAAAACTAAAAGTATCATCCGTTTAATCCCAAAT
CCTGATTTAGGACAAACATACCATCTAATTTATGGTAGTATTTTATTTGC
GATTTTCAACATAATAGGACCAATGATTTTGTTAATTATTTTTAACACTT
TACTTGCAATCAGTGTCATCAAGGCATCAAAACGACGCCAAGTTCTTATC
AACAATCAAATCGGATCTAGCAGACGAACTCGCGAAACGAAAATGCTCGT
CGTTGTTATAGGGGTATTCATTGTTACCGAAACCCCAAGTTGTGCCTGGC
AAATTATAATGAAACATATTCAACAATCGTGTATTGGCCAGTCGATTCTG
TCTTTTGTTGATATTTTGACGGTTCTAAATTCATCTTTGAACTTCTTCAT
TTATTGCATTTGTGGACTGAGATTTCGGCAAAATCTACAAAAAGTGTTTC
ATTTTCGCTGTCAAACGAATTATTCAGTGAGAAACACTACGTCGAATGCC
GGATCAGTTTGCGTCACCGGATATTTGGGAAACTCAGTCCATCAGCATTT
GTCTGCGACTGAAAATGATAAATTTGTCCGTGAAACTGTAATGTAGTTGA
CTTTAACCGCAGATTTTTTTATATGGAAAAAATTATTTATAGATTTATGT
TTACGCTTTTCAAAGTGTTGTAAAATCCTTTATAGGCTATAAAGATAATT
TATGTGCTCCTTGTAACTCCA
back to top

protein sequence of SMED30023651-orf-1

>SMED30023651-orf-1 ID=SMED30023651-orf-1|Name=SMED30023651-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=370bp
MDINESFYNVIGSNNTCSDGFSIFKFSINALIGSILILVGIVGNIISIIV
LNRDWSRSSMSVLLSGLGMYDILFLILSIYYIIVYDGIKVIADEYFKSKI
LYLNNLIMKPAWYLGNVFRCGRNWIAVIVAIDRFVVVYRPFQAHSRSNPK
RAKLYSLSIAILALFYNIPRLWEWKEIKTKSIIRLIPNPDLGQTYHLIYG
SILFAIFNIIGPMILLIIFNTLLAISVIKASKRRQVLINNQIGSSRRTRE
TKMLVVVIGVFIVTETPSCAWQIIMKHIQQSCIGQSILSFVDILTVLNSS
LNFFIYCICGLRFRQNLQKVFHFRCQTNYSVRNTTSNAGSVCVTGYLGNS
VHQHLSATENDKFVRETVM*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0008528G-protein coupled peptide receptor activity
GO:0004930G-protein coupled receptor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000240body wall musculature
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 288..314
score: 27.22
coord: 60..81
score: 18.96
coord: 250..274
score: 23.19
coord: 28..52
score: 23.81
coord: 115..137
score: 16.74
coord: 201..224
score: 13.53
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 44..306
e-value: 1.5E-14
score: 54.0
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 12..333
e-value: 5.7E-48
score: 165.5
NoneNo IPR availablePANTHERPTHR46641FAMILY NOT NAMEDcoord: 14..339
NoneNo IPR availableCDDcd149787tmA_FMRFamide_R-likecoord: 28..315
e-value: 3.85759E-50
score: 168.195
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 17..335
NoneNo IPR availableTMHMMTMhelixcoord: 202..224
NoneNo IPR availableTMHMMTMhelixcoord: 28..50
NoneNo IPR availableTMHMMTMhelixcoord: 290..312
NoneNo IPR availableTMHMMTMhelixcoord: 253..275
NoneNo IPR availableTMHMMTMhelixcoord: 154..172
NoneNo IPR availableTMHMMTMhelixcoord: 62..84
NoneNo IPR availableTMHMMTMhelixcoord: 124..141
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 43..306
score: 22.919