Heat shock factor-binding protein

Overview
NameHeat shock factor-binding protein
Smed IDSMED30023628
Length (bp)407
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023628

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023628 dd_Smed_v4_15016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023628 dd_Smed_v4_15016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023628 dd_Smed_v4_15016_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Heat shock factor-binding protein vs. Ensembl Human
Match: HSBP1 (heat shock factor binding protein 1 [Source:HGNC Symbol;Acc:HGNC:5203])

HSP 1 Score: 56.9954 bits (136), Expect = 3.138e-11
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 1
Query:  121 NDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
             DP+++Q+L+  +Q +LQQMQD FQ M+D+I  R                             +DDM  +ID++E+++A+LMTQAG++
Sbjct:    4 TDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGR-----------------------------IDDMSSRIDDLEKNIADLMTQAGVE 62          
BLAST of Heat shock factor-binding protein vs. Ensembl Human
Match: HSBP1 (heat shock factor binding protein 1 [Source:HGNC Symbol;Acc:HGNC:5203])

HSP 1 Score: 56.9954 bits (136), Expect = 3.138e-11
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 1
Query:  121 NDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
             DP+++Q+L+  +Q +LQQMQD FQ M+D+I  R                             +DDM  +ID++E+++A+LMTQAG++
Sbjct:    4 TDPKTVQDLTSVVQTLLQQMQDKFQTMSDQIIGR-----------------------------IDDMSSRIDDLEKNIADLMTQAGVE 62          
BLAST of Heat shock factor-binding protein vs. Ensembl Fly
Match: CG5446 (gene:FBgn0032429 transcript:FBtr0333094)

HSP 1 Score: 63.929 bits (154), Expect = 3.316e-14
Identity = 38/105 (36.19%), Postives = 63/105 (60.00%), Query Frame = 1
Query:   82 KMSAAVKEN-NINTN-DPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGIDLQ 390
            +M + + +N ++N+N DP+++QEL++Y+Q +LQ +QD FQ M+D+I TR                             +DDMG +ID++E+S+A+LM QAGI+ Q
Sbjct:    7 EMDSDLDQNYSLNSNADPKNMQELTIYVQNLLQNVQDKFQTMSDQIITR-----------------------------IDDMGNRIDDLEKSIADLMNQAGIEGQ 82          
BLAST of Heat shock factor-binding protein vs. Ensembl Fly
Match: CG5446 (gene:FBgn0032429 transcript:FBtr0080388)

HSP 1 Score: 63.929 bits (154), Expect = 3.316e-14
Identity = 38/105 (36.19%), Postives = 63/105 (60.00%), Query Frame = 1
Query:   82 KMSAAVKEN-NINTN-DPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGIDLQ 390
            +M + + +N ++N+N DP+++QEL++Y+Q +LQ +QD FQ M+D+I TR                             +DDMG +ID++E+S+A+LM QAGI+ Q
Sbjct:    7 EMDSDLDQNYSLNSNADPKNMQELTIYVQNLLQNVQDKFQTMSDQIITR-----------------------------IDDMGNRIDDLEKSIADLMNQAGIEGQ 82          
BLAST of Heat shock factor-binding protein vs. Ensembl Fly
Match: CG5446 (gene:FBgn0032429 transcript:FBtr0333093)

HSP 1 Score: 50.8322 bits (120), Expect = 3.244e-9
Identity = 33/94 (35.11%), Postives = 51/94 (54.26%), Query Frame = 1
Query:  112 INTN-DPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGIDLQ 390
            +N+N DP+++QEL++Y       +QD FQ M+D+I TR                             +DDMG +ID++E+S+A+LM QAGI+ Q
Sbjct:   18 LNSNADPKNMQELTIY------NVQDKFQTMSDQIITR-----------------------------IDDMGNRIDDLEKSIADLMNQAGIEGQ 76          
BLAST of Heat shock factor-binding protein vs. Ensembl Zebrafish
Match: hsbp1b (heat shock factor binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1721])

HSP 1 Score: 56.6102 bits (135), Expect = 2.726e-11
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 1
Query:  121 NDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
             DP+S+Q+L+  +Q +LQQMQD FQ M+D+I  R                             +D+M  +ID++E+++A+LMTQAG++
Sbjct:    4 TDPKSVQDLTAVVQTLLQQMQDKFQTMSDQIIGR-----------------------------IDEMSTRIDDLEKNIADLMTQAGVE 62          
BLAST of Heat shock factor-binding protein vs. Ensembl Zebrafish
Match: hsbp1a (heat shock factor binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-050320-136])

HSP 1 Score: 54.299 bits (129), Expect = 2.286e-10
Identity = 29/91 (31.87%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  112 INTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
            ++  DP+S Q+L++ +Q +LQQMQD FQ M+D+I  R                             +D+M  +ID++E+++++LMTQAG++
Sbjct:    1 MSEKDPKSSQDLTVVVQTLLQQMQDKFQTMSDQIIGR-----------------------------IDEMSTRIDDLEKNISDLMTQAGVE 62          
BLAST of Heat shock factor-binding protein vs. Ensembl Zebrafish
Match: hsbp1a (heat shock factor binding protein 1a [Source:ZFIN;Acc:ZDB-GENE-050320-136])

HSP 1 Score: 54.299 bits (129), Expect = 2.286e-10
Identity = 29/91 (31.87%), Postives = 51/91 (56.04%), Query Frame = 1
Query:  112 INTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
            ++  DP+S Q+L++ +Q +LQQMQD FQ M+D+I  R                             +D+M  +ID++E+++++LMTQAG++
Sbjct:    1 MSEKDPKSSQDLTVVVQTLLQQMQDKFQTMSDQIIGR-----------------------------IDEMSTRIDDLEKNISDLMTQAGVE 62          
BLAST of Heat shock factor-binding protein vs. Ensembl Zebrafish
Match: hsbp1b (heat shock factor binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1721])

HSP 1 Score: 43.1282 bits (100), Expect = 2.395e-6
Identity = 25/76 (32.89%), Postives = 40/76 (52.63%), Query Frame = 1
Query:  157 LQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
            +Q +LQQMQD FQ M+D+I  R                             +D+M  +ID++E+++A+LMTQAG++
Sbjct:    2 VQTLLQQMQDKFQTMSDQIIGR-----------------------------IDEMSTRIDDLEKNIADLMTQAGVE 48          
BLAST of Heat shock factor-binding protein vs. Ensembl Xenopus
Match: hsbp1 (heat shock factor binding protein 1 [Source:NCBI gene;Acc:496903])

HSP 1 Score: 59.3066 bits (142), Expect = 2.697e-12
Identity = 31/91 (34.07%), Postives = 52/91 (57.14%), Query Frame = 1
Query:  112 INTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
            ++  DP+++Q+L++ +Q +LQQMQD FQ M+D+I  R                             +DDM  +ID++E+++A+LMTQAG+D
Sbjct:    1 MSETDPKTVQDLTVVVQNLLQQMQDKFQTMSDQIIGR-----------------------------IDDMSTRIDDLEKNIADLMTQAGVD 62          
BLAST of Heat shock factor-binding protein vs. Ensembl Mouse
Match: Hsbp1 (heat shock factor binding protein 1 [Source:MGI Symbol;Acc:MGI:1915446])

HSP 1 Score: 55.4546 bits (132), Expect = 8.606e-11
Identity = 29/88 (32.95%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  121 NDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
             DP+++Q+++L ++ +LQQMQD FQ M+D+I  R                             +DDM  +ID++E+++A+LMTQAG++
Sbjct:    4 TDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGR-----------------------------IDDMSSRIDDLEKNIADLMTQAGVE 62          
BLAST of Heat shock factor-binding protein vs. Ensembl Mouse
Match: Hsbp1 (heat shock factor binding protein 1 [Source:MGI Symbol;Acc:MGI:1915446])

HSP 1 Score: 55.4546 bits (132), Expect = 8.606e-11
Identity = 29/88 (32.95%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  121 NDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
             DP+++Q+++L ++ +LQQMQD FQ M+D+I  R                             +DDM  +ID++E+++A+LMTQAG++
Sbjct:    4 TDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGR-----------------------------IDDMSSRIDDLEKNIADLMTQAGVE 62          
BLAST of Heat shock factor-binding protein vs. UniProt/SwissProt
Match: sp|Q8K3X8|HSBP1_RAT (Heat shock factor-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Hsbp1 PE=3 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 5.293e-10
Identity = 29/88 (32.95%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  121 NDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
             DP+++Q+++L ++ +LQQMQD FQ M+D+I  R                             +DDM  +ID++E+++A+LMTQAG++
Sbjct:    4 TDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGR-----------------------------IDDMSSRIDDLEKNIADLMTQAGVE 62          
BLAST of Heat shock factor-binding protein vs. UniProt/SwissProt
Match: sp|Q9CQZ1|HSBP1_MOUSE (Heat shock factor-binding protein 1 OS=Mus musculus OX=10090 GN=Hsbp1 PE=1 SV=1)

HSP 1 Score: 55.4546 bits (132), Expect = 6.020e-10
Identity = 29/88 (32.95%), Postives = 50/88 (56.82%), Query Frame = 1
Query:  121 NDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
             DP+++Q+++L ++ +LQQMQD FQ M+D+I  R                             +DDM  +ID++E+++A+LMTQAG++
Sbjct:    4 TDPKTMQDITLVVETLLQQMQDKFQIMSDQIIGR-----------------------------IDDMSSRIDDLEKNIADLMTQAGVE 62          
BLAST of Heat shock factor-binding protein vs. TrEMBL
Match: A0A1L8GF50 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18024934mg PE=4 SV=1)

HSP 1 Score: 78.9518 bits (193), Expect = 2.805e-16
Identity = 39/88 (44.32%), Postives = 60/88 (68.18%), Query Frame = 1
Query:  121 NDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
             DP+++Q+L++ +Q +LQQMQD FQ M+D+I  RNILL          F L      F++  LLDDM  +ID++E+++A+LMTQAG++
Sbjct:    4 TDPKTVQDLTVVVQNLLQQMQDKFQTMSDQIIGRNILLV--------TFLLARLYRSFSLTKLLDDMSTRIDDLEKNIADLMTQAGVE 83          
BLAST of Heat shock factor-binding protein vs. TrEMBL
Match: A0A1L8GL11 (Uncharacterized protein OS=Xenopus laevis OX=8355 GN=XELAEV_18022656mg PE=4 SV=1)

HSP 1 Score: 75.0998 bits (183), Expect = 1.203e-14
Identity = 38/91 (41.76%), Postives = 61/91 (67.03%), Query Frame = 1
Query:  112 INTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
            ++  DP+++Q+L++ +Q +LQQMQD FQ M+D+I  RNILL Y                 F++  LLDDM  +ID++E+++A+LMTQAG++
Sbjct:    1 MSETDPKTVQDLTVVVQNLLQQMQDKFQTMSDQIIGRNILLLYRS---------------FSLTKLLDDMSTRIDDLEKNIADLMTQAGVE 76          
BLAST of Heat shock factor-binding protein vs. TrEMBL
Match: A0A195DA13 (Heat shock factor-binding protein 1 OS=Trachymyrmex cornetzi OX=471704 GN=ALC57_18244 PE=4 SV=1)

HSP 1 Score: 74.3294 bits (181), Expect = 1.454e-14
Identity = 38/90 (42.22%), Postives = 62/90 (68.89%), Query Frame = 1
Query:  115 NTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
            N+ DP+++QEL+ Y+Q +LQ MQD FQ M+D+I  RN+ +          F + P S F +   +LD+MG +ID++E+++A+LMTQAG++
Sbjct:   20 NSADPKNMQELTQYVQTLLQNMQDKFQTMSDQIIGRNMHV--------KFFAVLPSSLFIS-EQILDEMGNRIDDLEKNIADLMTQAGVE 100          
BLAST of Heat shock factor-binding protein vs. TrEMBL
Match: A0A151XES6 (Heat shock factor-binding protein 1 OS=Trachymyrmex zeteki OX=64791 GN=ALC60_02438 PE=4 SV=1)

HSP 1 Score: 73.1738 bits (178), Expect = 7.251e-14
Identity = 39/105 (37.14%), Postives = 62/105 (59.05%), Query Frame = 1
Query:  115 NTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFS---------FFFNIPFL------LDDMGQKIDEIERSVANLMTQAGID 384
            N+ DP+++QEL+ Y+Q +LQ MQD FQ M+D+I  RNIL     +        N  S          +  + +L      LD+MG +ID++E+++A+LMTQAG++
Sbjct:   20 NSADPKNMQELTQYVQTLLQNMQDKFQTMSDQIIGRNILFLMLNLKRCCSLSCNWLSVVLIASSFLLYCQVDYLSLNVKILDEMGNRIDDLEKNIADLMTQAGVE 124          
BLAST of Heat shock factor-binding protein vs. TrEMBL
Match: A0A2G9SJP3 (Uncharacterized protein OS=Lithobates catesbeianus OX=8400 GN=AB205_0019410 PE=4 SV=1)

HSP 1 Score: 72.4034 bits (176), Expect = 1.026e-13
Identity = 36/97 (37.11%), Postives = 61/97 (62.89%), Query Frame = 1
Query:  115 NTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXX-------XXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
            ++ DP+++Q+L+  +Q +LQQMQD FQ M+D+I  RNIL +                 C +P  +  ++   LD+M  +ID++E+++A+LMTQAG+D
Sbjct:    3 DSADPKTVQDLTEVVQNLLQQMQDKFQTMSDQIIGRNILSWTQGVYCGDLVSLYKCDLCTSPL-YVLSLIQTLDEMSTRIDDLEKNIADLMTQAGVD 98          
BLAST of Heat shock factor-binding protein vs. Ensembl Cavefish
Match: hsbp1b (heat shock factor binding protein 1b [Source:ZFIN;Acc:ZDB-GENE-040426-1721])

HSP 1 Score: 55.4546 bits (132), Expect = 5.991e-11
Identity = 31/87 (35.63%), Postives = 48/87 (55.17%), Query Frame = 1
Query:  124 DPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
            DP+S+Q+L+  +Q +LQQMQD FQ M+D+I  RNIL                                +ID++E+++A+LMTQAG++
Sbjct:    5 DPKSVQDLTGVVQTLLQQMQDKFQTMSDQIIGRNILFT------------------------------RIDDLEKNIADLMTQAGVE 61          
BLAST of Heat shock factor-binding protein vs. Ensembl Nematostella
Match: EDO35978 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SJY7])

HSP 1 Score: 50.0618 bits (118), Expect = 2.200e-9
Identity = 29/98 (29.59%), Postives = 51/98 (52.04%), Query Frame = 1
Query:   91 AAVKENNINTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
            A  K  + +  +P+++Q+L+ ++Q +L QMQD FQ M+D+I TR                             +D+M  +ID++E+++  LM QAG+D
Sbjct:    2 ADTKIKSGDVENPENLQDLTGFVQTLLTQMQDKFQNMSDQIITR-----------------------------IDEMSNRIDDLEKNIGELMNQAGVD 70          
BLAST of Heat shock factor-binding protein vs. Ensembl Medaka
Match: hsbp1a (heat shock factor binding protein 1 [Source:NCBI gene;Acc:101175153])

HSP 1 Score: 55.0694 bits (131), Expect = 9.413e-11
Identity = 30/88 (34.09%), Postives = 49/88 (55.68%), Query Frame = 1
Query:  121 NDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID 384
             DP+S+Q+L+  +Q +LQQMQD FQ M+D+I  R                             +D+M  +ID++E+++A+LMTQAG++
Sbjct:    4 TDPKSVQDLTNVVQTLLQQMQDKFQTMSDQIIGR-----------------------------IDEMSTRIDDLEKNIADLMTQAGVE 62          
BLAST of Heat shock factor-binding protein vs. Planmine SMEST
Match: SMESG000032253.1 (SMESG000032253.1)

HSP 1 Score: 181.415 bits (459), Expect = 2.241e-60
Identity = 101/102 (99.02%), Postives = 101/102 (99.02%), Query Frame = 1
Query:   85 MSAAVKENNINTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGIDLQ 390
            MSAAVKENNINTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFYYYIHIIYIFCLN FSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGIDLQ
Sbjct:    1 MSAAVKENNINTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFYYYIHIIYIFCLNSFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGIDLQ 102          

HSP 2 Score: 55.8398 bits (133), Expect = 5.587e-11
Identity = 27/27 (100.00%), Postives = 27/27 (100.00%), Query Frame = -3
Query:    1 NNINTNDPQSIQELSLYLQGMLQQMQD 81
            NNINTNDPQSIQELSLYLQGMLQQMQD
Sbjct:    8 NNINTNDPQSIQELSLYLQGMLQQMQD 34          
BLAST of Heat shock factor-binding protein vs. Planmine SMEST
Match: SMESG000030373.1 (SMESG000030373.1)

HSP 1 Score: 45.8246 bits (107), Expect = 1.859e-7
Identity = 20/58 (34.48%), Postives = 34/58 (58.62%), Query Frame = 1
Query:   97 VKENNINTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILLFXXXXXXXXXFC 270
             +++     DPQ+ QEL+ Y++ ++QQMQDN  ++++KI   NILL          +C
Sbjct:    9 ARDSKFGIADPQTPQELAHYIERIMQQMQDNVDRVSEKINNNNILLLVSRNLNFISYC 66          
The following BLAST results are available for this feature:
BLAST of Heat shock factor-binding protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
HSBP13.138e-1134.09heat shock factor binding protein 1 [Source:HGNC S... [more]
HSBP13.138e-1134.09heat shock factor binding protein 1 [Source:HGNC S... [more]
back to top
BLAST of Heat shock factor-binding protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Heat shock factor-binding protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 3
Match NameE-valueIdentityDescription
CG54463.316e-1436.19gene:FBgn0032429 transcript:FBtr0333094[more]
CG54463.316e-1436.19gene:FBgn0032429 transcript:FBtr0080388[more]
CG54463.244e-935.11gene:FBgn0032429 transcript:FBtr0333093[more]
back to top
BLAST of Heat shock factor-binding protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
hsbp1b2.726e-1134.09heat shock factor binding protein 1b [Source:ZFIN;... [more]
hsbp1a2.286e-1031.87heat shock factor binding protein 1a [Source:ZFIN;... [more]
hsbp1a2.286e-1031.87heat shock factor binding protein 1a [Source:ZFIN;... [more]
hsbp1b2.395e-632.89heat shock factor binding protein 1b [Source:ZFIN;... [more]
back to top
BLAST of Heat shock factor-binding protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hsbp12.697e-1234.07heat shock factor binding protein 1 [Source:NCBI g... [more]
back to top
BLAST of Heat shock factor-binding protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Hsbp18.606e-1132.95heat shock factor binding protein 1 [Source:MGI Sy... [more]
Hsbp18.606e-1132.95heat shock factor binding protein 1 [Source:MGI Sy... [more]
back to top
BLAST of Heat shock factor-binding protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|Q8K3X8|HSBP1_RAT5.293e-1032.95Heat shock factor-binding protein 1 OS=Rattus norv... [more]
sp|Q9CQZ1|HSBP1_MOUSE6.020e-1032.95Heat shock factor-binding protein 1 OS=Mus musculu... [more]
back to top
BLAST of Heat shock factor-binding protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1L8GF502.805e-1644.32Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A1L8GL111.203e-1441.76Uncharacterized protein OS=Xenopus laevis OX=8355 ... [more]
A0A195DA131.454e-1442.22Heat shock factor-binding protein 1 OS=Trachymyrme... [more]
A0A151XES67.251e-1437.14Heat shock factor-binding protein 1 OS=Trachymyrme... [more]
A0A2G9SJP31.026e-1337.11Uncharacterized protein OS=Lithobates catesbeianus... [more]
back to top
BLAST of Heat shock factor-binding protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hsbp1b5.991e-1135.63heat shock factor binding protein 1b [Source:ZFIN;... [more]
back to top
BLAST of Heat shock factor-binding protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Heat shock factor-binding protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Heat shock factor-binding protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO359782.200e-929.59Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Heat shock factor-binding protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
hsbp1a9.413e-1134.09heat shock factor binding protein 1 [Source:NCBI g... [more]
back to top
BLAST of Heat shock factor-binding protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000032253.12.241e-6099.02SMESG000032253.1[more]
SMESG000030373.11.859e-734.48SMESG000030373.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023628 ID=SMED30023628|Name=Heat shock factor-binding protein|organism=Schmidtea mediterranea sexual|type=transcript|length=407bp
GTCCTGCATTTGTTGAAGCATTCCTTGTAAATATAATGAAAGTTCCTGGA
TCGACTGAGGATCATTTGTGTTTATATTATTAAAATGTCAGCAGCTGTCA
AAGAAAATAATATAAACACAAATGATCCTCAGTCGATCCAGGAACTTTCA
TTATATTTACAAGGAATGCTTCAACAAATGCAGGACAATTTCCAGAAAAT
GACGGACAAGATTACTACAAGAAATATCCTTTTATTTTATTATTATATAC
ATATAATTTATATTTTTTGTTTAAATCCATTTAGTTTTTTCTTTAACATT
CCATTTCTACTAGATGATATGGGCCAGAAAATTGATGAAATAGAACGAAG
CGTAGCCAATCTGATGACCCAAGCTGGAATTGATCTACAATGAATAATAA
ATGCATT
back to top

protein sequence of SMED30023628-orf-1

>SMED30023628-orf-1 ID=SMED30023628-orf-1|Name=SMED30023628-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=103bp
MSAAVKENNINTNDPQSIQELSLYLQGMLQQMQDNFQKMTDKITTRNILL
FYYYIHIIYIFCLNPFSFFFNIPFLLDDMGQKIDEIERSVANLMTQAGID
LQ*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR009643HS1-bd
Vocabulary: molecular function
TermDefinition
GO:0003714transcription corepressor activity
Vocabulary: biological process
TermDefinition
GO:1903507negative regulation of nucleic acid-templated transcription