RUN domain protein

Overview
NameRUN domain protein
Smed IDSMED30023625
Length (bp)2714
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of RUN domain protein (SMED30023625) t-SNE clustered cells

Violin plots show distribution of expression levels for RUN domain protein (SMED30023625) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of RUN domain protein (SMED30023625) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for RUN domain protein (SMED30023625) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023625

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
posterior sideSMED30023625h1SMcG0001397 dd_Smed_v4_6417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30023625h1SMcG0001397 dd_Smed_v4_6417_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30023625h1SMcG0001397 dd_Smed_v6_6417_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of RUN domain protein vs. TrEMBL
Match: A0A4S2L9W9 (RUN domain-containing protein OS=Opisthorchis felineus OX=147828 GN=CRM22_010015 PE=4 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.865e-13
Identity = 71/250 (28.40%), Postives = 111/250 (44.40%), Query Frame = 1
Query: 1432 IPRNWGLSKDNDILAMFEF---PRRSSNDFKVVEYDEENNFRLGGIVNNAITAIKLA----SESVSSIQEVA----TICDKF-----IRCKDSNRQSTSALLLAVDTIIALISDGLYSDSMRNKKSQTVLATGFKMTQKLWMFVEESCR-GTLIKDPSQKLALSNLLKQVKQTCGLTSTVSRSKEWAIQLKLQIFIVLAIKNNLLYVWVKAVVANDTILHRFFNSNSFLRQARTSYSNALSAVVVEMRHL 2130
            IPRNWGL      LA F     P R +N    V    + + R   +VN+ I A++      S + +SI   A    T  D            + RQ    LL  V  +  L+SDGL         ++ +  T  K   +LW  VEESCR G L+   + ++ LS+ + QVK    +T           ++K + FI   +    L +W+ AVVAN ++L RF+  ++F+RQ R +     + ++  +  L
Sbjct: 1020 IPRNWGLYGQETPLAEFNPRNSPGRDTNQPGEVPRQSDVDVRYHAMVNDVIKAVQETVAYYSNATTSIPASAGNGCTTADPLPYSAIAALGSAGRQ---PLLAVVGPLTVLLSDGLL------PPTKPIFIT--KPRTRLWQMVEESCRPGPLLSGVAYRV-LSDAVSQVKALTSIT---------LEKVKFKAFICACLNAKALPMWLNAVVANASLLSRFYCEDAFVRQCRATQRGLHADLLTHLEQL 1248          
BLAST of RUN domain protein vs. TrEMBL
Match: A0A0V0J5M7 (RUN domain-containing protein OS=Schistocephalus solidus OX=70667 GN=TR148794 PE=4 SV=1)

HSP 1 Score: 83.9593 bits (206), Expect = 1.595e-12
Identity = 67/250 (26.80%), Postives = 112/250 (44.80%), Query Frame = 1
Query: 1420 DLRPIPRNWGL-SKDNDILAMFE-FPRRSSNDFKVVEYDEENNFRLGGIVNNAITAIKLASESVSSI-QEVATIC---DKFIRCKDSNRQSTS-------ALLLAVDTIIALISDGLYSDSMRNKKSQTVLATGFKMTQKLWMFVEESCRGTLIKDPSQKLALSNLLKQVKQTCGLTSTVSRSKEWAIQLKLQIFIVLAIKNNLLYVWVKAVVANDTILHRFFNSNSFLRQARTSYSNALSAVVVEMRHL 2130
            D R IPR+WGL  +D   LA F+ F     ND        + + R   +V + I A++   E+V+   Q VAT C            NR S+S        LL  +  ++ L+SDGL         ++ +     +   ++W+ VEESC+ +          L+N L QVK   G  S  +R          + F+ + + N  L +W+  +V+ND +L RF+   +F+RQ R++     + ++  +  L
Sbjct:  949 DARAIPRHWGLYGQDPPPLAEFKPFDVAEQNDVSSSTRPSDVDIRYHAMVMDVIKAVQ---ETVAYFCQPVATSCVSDATLASSTGGNRGSSSLSTLSRGGLLGVIFPLMTLLSDGLL------PPARPLFTKPLRT--RIWLLVEESCKQSAYLTGVAYYILNNALSQVKALPGAPSEKAR---------FKAFVCVCLNNRALPMWLNCMVSNDPLLKRFYCEGAFIRQCRSTLRGLYADLLTHIEQL 1178          
BLAST of RUN domain protein vs. TrEMBL
Match: A0A1S8WVM8 (RUN domain protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_05661 PE=4 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 1.939e-12
Identity = 69/250 (27.60%), Postives = 112/250 (44.80%), Query Frame = 1
Query: 1432 IPRNWGLSKDNDILAMFE---FPRRSSNDFKVVEYDEENNFRLGGIVNNAITAIKLA----SESVSSIQEVA----TICDKF-----IRCKDSNRQSTSALLLAVDTIIALISDGLYSDSMRNKKSQTVLATGFKMTQKLWMFVEESCR-GTLIKDPSQKLALSNLLKQVKQTCGLTSTVSRSKEWAIQLKLQIFIVLAIKNNLLYVWVKAVVANDTILHRFFNSNSFLRQARTSYSNALSAVVVEMRHL 2130
            IPRNWGL      LA F     P R +N    +    + + R   +VN+ I A++      S + +S  + A    T  D            + RQ    LL  V  +  L+SDGL         ++ +  T  K   +LW  VEESCR G L+   + ++ LS+ + QVK    +T           ++K + FI   +    L +W+ AVVAN+++L RF+  ++F+RQ R +     + ++  +  L
Sbjct: 1096 IPRNWGLYGQETPLAEFNPRNSPGRDTNQPGELPRQSDVDVRYHAMVNDVIKAVQETVAYYSTATTSNPDAAGNGCTTADPLPYSAIAALGSAGRQ---PLLAVVGPLTVLLSDGLL------PPTKPIFIT--KPRTRLWQMVEESCRPGPLLSGVAYRV-LSDAVSQVKALTSIT---------LEKVKFKAFICACLNAKALPMWLNAVVANESLLSRFYCEDAFVRQCRATQRGLHADLLTHLEQL 1324          
BLAST of RUN domain protein vs. TrEMBL
Match: G7YIH2 (RUN and SH3 domain-containing protein 1 OS=Clonorchis sinensis OX=79923 GN=CLF_108767 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.687e-12
Identity = 66/250 (26.40%), Postives = 110/250 (44.00%), Query Frame = 1
Query: 1432 IPRNWGLSKDNDILAMFEF---PRRSSNDFKVVEYDEENNFRLGGIVNNAITAIK-----LASESVSSIQEVATICDK--------FIRCKDSNRQSTSALLLAVDTIIALISDGLYSDSMRNKKSQTVLATGFKMTQKLWMFVEESCR-GTLIKDPSQKLALSNLLKQVKQTCGLTSTVSRSKEWAIQLKLQIFIVLAIKNNLLYVWVKAVVANDTILHRFFNSNSFLRQARTSYSNALSAVVVEMRHL 2130
            IPRNWGL      LA F     P R +N    V    + + R   +VN+ I A++      ++ +  +       C+               + RQ    LL  V  +  L+SDGL         ++ +  T  K   +LW  VEESCR G L+   + ++ LS+ + QVK    +T           ++K + FI   +    L +W+ AVVAN+++L RF+  ++F+RQ R +     + ++  +  L
Sbjct: 1020 IPRNWGLYGQETPLAEFNPRNSPGRDTNQPGEVPRQSDVDVRYHAMVNDVIKAVQETVAYYSTATSGNPDPAGNGCNAADPLPYSAIAALGSAGRQ---PLLAVVAPLTVLLSDGLL------PPTKPIFIT--KPRTRLWQMVEESCRPGPLLSGVAYRV-LSDAVSQVKALTSIT---------LEKVKFKAFICACLNAKALPMWLNAVVANESLLSRFYCEDAFVRQCRATQRGLHADLLTHLEQL 1248          
BLAST of RUN domain protein vs. TrEMBL
Match: A0A419PEM5 (RUN and SH3 domain-containing protein 1 OS=Clonorchis sinensis OX=79923 GN=RUSC1 PE=4 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 2.687e-12
Identity = 66/250 (26.40%), Postives = 110/250 (44.00%), Query Frame = 1
Query: 1432 IPRNWGLSKDNDILAMFEF---PRRSSNDFKVVEYDEENNFRLGGIVNNAITAIK-----LASESVSSIQEVATICDK--------FIRCKDSNRQSTSALLLAVDTIIALISDGLYSDSMRNKKSQTVLATGFKMTQKLWMFVEESCR-GTLIKDPSQKLALSNLLKQVKQTCGLTSTVSRSKEWAIQLKLQIFIVLAIKNNLLYVWVKAVVANDTILHRFFNSNSFLRQARTSYSNALSAVVVEMRHL 2130
            IPRNWGL      LA F     P R +N    V    + + R   +VN+ I A++      ++ +  +       C+               + RQ    LL  V  +  L+SDGL         ++ +  T  K   +LW  VEESCR G L+   + ++ LS+ + QVK    +T           ++K + FI   +    L +W+ AVVAN+++L RF+  ++F+RQ R +     + ++  +  L
Sbjct: 1020 IPRNWGLYGQETPLAEFNPRNSPGRDTNQPGEVPRQSDVDVRYHAMVNDVIKAVQETVAYYSTATSGNPDPAGNGCNAADPLPYSAIAALGSAGRQ---PLLAVVAPLTVLLSDGLL------PPTKPIFIT--KPRTRLWQMVEESCRPGPLLSGVAYRV-LSDAVSQVKALTSIT---------LEKVKFKAFICACLNAKALPMWLNAVVANESLLSRFYCEDAFVRQCRATQRGLHADLLTHLEQL 1248          
BLAST of RUN domain protein vs. Planmine SMEST
Match: SMESG000078693.1 (SMESG000078693.1)

HSP 1 Score: 1466.83 bits (3796), Expect = 0.000e+0
Identity = 742/745 (99.60%), Postives = 743/745 (99.73%), Query Frame = 1
Query:   58 MNFSNISCEYFYDEEYDVAITEGSYNQPFVNSLNNNCYPSYFGDGDRLYSEFDPNESDLWSESALKQSGNNNYSELCCDKIDTNVYKCASSDNVIETSNYSLTKNLPFLNQPRQNLFNYHLCYETRRESITNPVTGQQFFLNNFDIRKQFARKYNSKTFFDSGKCSAATSDSFIHPVRNYRPNSENNLHETSLEEXXXXXXXXXXXXXXXQLWRKLKQAFSNKKLKWKHLLNDNSKNKLCRSYSAPSLEYXXXXXXXXXXCNRYSTTIVELYNLLNDLVEESTESVFAATQKSYYDVSCQFPELQPIQIDNGKFNRKSKKDLNIDYPGIGKLKLPHRLRTPIYQLVADTGIFNKLKFLEQISNNDNPSQSKNRRSRSVHRSGQCKKNSIGESELENVKNGICQIKTPIRSSSESRKKLPINSNIKDSGCPLKNTTNTHNNQLFIIEENKSLSFADLRPIPRNWGLSKDNDILAMFEFPRRSSNDFKVVEYDEENNFRLGGIVNNAITAIKLASESVSSIQEVATICDKFIRCKDSNRQSTSALLLAVDTIIALISDGLYSDSMRNKKSQTVLATGFKMTQKLWMFVEESCRGTLIKDPSQKLALSNLLKQVKQTCGLTSTVSRSKEWAIQLKLQIFIVLAIKNNLLYVWVKAVVANDTILHRFFNSNSFLRQARTSYSNALSAVVVEMRHLCMPGSSRIYNVSKPISSKSRNQATGQSSNSSTDNSLVKSRIPRSNKRPSNASVK 2292
            MNFSNISCEYFYDEEYDVAITEGSYNQPFVNSLNNNCYPSYFGDGDRLYSEFDPNESDLWSESALKQSGNNNYSELCCDKIDTNVYKCASSDNVIETSNYSLTKNLPFLNQPRQNLFNYHLCYETRRESITNPVTGQQFFLNNFDIRKQFARKYNSKTFFDSGKCSAATSDSFIHPVRNYRPNSENNLHETSLEENNISNCS NNKKSSKQLWRKLKQAFSNKKLKWKHLLNDNSKNKLCRSYSAPSLEYNNENNKEI+KCNRYSTTIVELYNLLNDLVEESTESVFAATQKSYYDVSCQFPELQ IQIDNGKFNRKSKKDLNIDYPGIGKLKLPHRLRTPIYQLVADTGIFNKLKFLEQISNNDNPSQSKNRRSRSVHRSGQCKKNSIGESELENVKNGICQIKTPIRSSSESRKKLPINSNIKDSGCPLKNTTNTHNNQLFIIEENKSLSFADLRPIPRNWGLSKDNDILAMFEFPRRSSNDFKVVEYDEENNFRLGGIVNNAITAIKLASESVSSIQEVATICDKFIRCKDSNRQSTSALLLAVDTIIALISDGLYSDSMRNKKSQTVLATGFKMTQKLWMFVEESCRGTLIKDPSQKLALSNLLKQVKQTCGLTSTVSRSKEWAIQLKLQIFIVLAIKNNLLYVWVKAVVANDTILHRFFNSNSFLRQARTSYSNALSAVVVEMRHLCMPGSSRIYNVSKPISSKSRNQATGQSSNSSTDNSLVKSRIPRSNKRPSNASVK
Sbjct:    1 MNFSNISCEYFYDEEYDVAITEGSYNQPFVNSLNNNCYPSYFGDGDRLYSEFDPNESDLWSESALKQSGNNNYSELCCDKIDTNVYKCASSDNVIETSNYSLTKNLPFLNQPRQNLFNYHLCYETRRESITNPVTGQQFFLNNFDIRKQFARKYNSKTFFDSGKCSAATSDSFIHPVRNYRPNSENNLHETSLEENNISNCSINNKKSSKQLWRKLKQAFSNKKLKWKHLLNDNSKNKLCRSYSAPSLEYNNENNKEIMKCNRYSTTIVELYNLLNDLVEESTESVFAATQKSYYDVSCQFPELQSIQIDNGKFNRKSKKDLNIDYPGIGKLKLPHRLRTPIYQLVADTGIFNKLKFLEQISNNDNPSQSKNRRSRSVHRSGQCKKNSIGESELENVKNGICQIKTPIRSSSESRKKLPINSNIKDSGCPLKNTTNTHNNQLFIIEENKSLSFADLRPIPRNWGLSKDNDILAMFEFPRRSSNDFKVVEYDEENNFRLGGIVNNAITAIKLASESVSSIQEVATICDKFIRCKDSNRQSTSALLLAVDTIIALISDGLYSDSMRNKKSQTVLATGFKMTQKLWMFVEESCRGTLIKDPSQKLALSNLLKQVKQTCGLTSTVSRSKEWAIQLKLQIFIVLAIKNNLLYVWVKAVVANDTILHRFFNSNSFLRQARTSYSNALSAVVVEMRHLCMPGSSRIYNVSKPISSKSRNQATGQSSNSSTDNSLVKSRIPRSNKRPSNASVK 745          
BLAST of RUN domain protein vs. Planmine SMEST
Match: SMESG000081547.1 (SMESG000081547.1)

HSP 1 Score: 157.532 bits (397), Expect = 3.722e-39
Identity = 180/682 (26.39%), Postives = 306/682 (44.87%), Query Frame = 1
Query:  355 YSLTKNLPFLNQPRQN-LFNYHLCYETRRESITNPVTGQQFFLNNFDIRKQFARKYNSK-----TFFDSGKCSAATSDSFIHPVRNYRPNSENNLHETSLEEXXXXXXXXXXXXXXXQLWRKLKQAFSNKKLKWK--HLLNDNSKNKLCRSYSAPSLEYXXXXXXXXXXCNRYSTTIVELYNLLNDLVEE------STESVFAATQKSYYDVSCQFPELQPIQIDNGKFNRKSKKDLN---IDYPGIGKLKLPHRLRTPIYQLVADTGIFNKLKFLE-------------QISNNDNPSQS------------KNRRSRSVHRSGQCKKNSIGESELENVKNGICQIKT-PIRSSSESRKKLPINSNIKDSGCPLKNTTNTHNNQLFIIEENKSLSFADLRPIPRNWGLSKD-----NDILAMFEFPRRSS----NDFKVVEYDEENNFRLGGIVNNAITAIKLASE--SVSSIQEVATICDKFIRCKDSNRQSTSALL---------------LAVDTIIALISDGLYSDSMRNKKSQTVLATGFKMTQKLWMFVEESCRGTLIKDPSQKLALSNLLKQVKQTCGLTSTVSRSKEWAIQLKLQIFIVLAIKNNLLYVWVKAVVANDTILHRFFNSNSFLRQARTSYSNALSAVVVEMRHLCMPGSSR--IY-NVSKPISSK 2184
            YSL   +P  N   +N L NYHL +  +   I +         N   I ++F +  N K        DSGK S  T DS +  +   +P     L ETS     +   S         LWR++K   +     W+   +     K      YS   + +   N++   K   YS +++E++N + D  +        ++       K   + SCQFP     ++ N + +  S +  N    DYPGIG++ +P   R      +  + + + L FL+             ++ + D  SQS            +++ S + H    C +    E + +  K  IC+ K+  I +    RK +  +       CP    ++ H     I++E        ++ IP+ WGL         D++A+FE  RR S    +         ++  R  G+VN  + A+K  S+  SV ++  +   C   +   +S+ QS  A+L                A+D +I L+SDGL   S  NKK +   ++  K   +LW+ VEE+CR    ++ S+K  L+ LL++V+Q   + + +S +K+   QL+L+ FI  A+K+ LL+VW+++VVAN+T L RF+   +FLRQAR+  S+AL+A+ V ++ L    +S+  +Y N S PI++K
Sbjct:  152 YSLQSRVPLFNVNNKNILVNYHLHFAPQDSFINSSYVASNCAENGI-IEQKFKQISNDKHSSSSNLIDSGKYSGTTVDSILQHITEQKPLF---LRETSTNNQTLKPDSI--------LWRQIKFLMNYYYTGWRLLKMFKQFRKKVKTEPYSTDEIVFYRTNSQLKRK-QSYSCSVLEIFNSIKDCGKRLENNSSKSDEQKLLVNKPIQNFSCQFPPKH--RVPNQRNHIISPQRTNNQIYDYPGIGRIGMPKPTRLSSSAFLT-SNLHSHLSFLQSSLTNHHSDITSNRLYDGDQISQSPRSLCSLNCQKNQSKNSDATHTLKPCLRK---EDDSDESKEVICRPKSNKIATDHFKRKSVSFD-------CP--GLSSEH-----IMQE--------MKEIPKKWGLLGSESRLIGDMMAVFECGRRDSLVGASGLSENCSGNDDATRFRGMVNEVLRAVKQISDRLSVGTMNGIEKPCSLEM---NSSFQSQLAILCEMVSNGDGLESPLATAIDNLITLMSDGLVVTSFSNKKVRISSSSANKAAMRLWLLVEETCRNPGSQNTSRKAELAQLLREVRQ---IITNISSTKDH--QLRLRAFIANALKSGLLHVWIRSVVANETALQRFYCPEAFLRQARSGQSDALAALTVSLKALTSTQNSQTPLYNNQSAPIANK 784          
The following BLAST results are available for this feature:
BLAST of RUN domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A4S2L9W95.865e-1328.40RUN domain-containing protein OS=Opisthorchis feli... [more]
A0A0V0J5M71.595e-1226.80RUN domain-containing protein OS=Schistocephalus s... [more]
A0A1S8WVM81.939e-1227.60RUN domain protein (Fragment) OS=Opisthorchis vive... [more]
G7YIH22.687e-1226.40RUN and SH3 domain-containing protein 1 OS=Clonorc... [more]
A0A419PEM52.687e-1226.40RUN and SH3 domain-containing protein 1 OS=Clonorc... [more]
back to top
BLAST of RUN domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of RUN domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000078693.10.000e+099.60SMESG000078693.1[more]
SMESG000081547.13.722e-3926.39SMESG000081547.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023625 ID=SMED30023625|Name=RUN domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2714bp
GTAAAGTTTAACTATTTAAAAATCTTTTATATATCTCAATAAAAATGATA
ATAAATAATGAATTTTTCTAACATAAGCTGTGAGTATTTTTATGATGAAG
AATATGATGTTGCAATAACAGAAGGAAGCTACAATCAACCATTTGTTAAC
TCACTTAATAATAATTGCTATCCATCATATTTCGGTGATGGCGATCGACT
TTACTCAGAATTCGACCCTAATGAATCAGATTTATGGTCTGAAAGTGCTT
TGAAACAAAGTGGAAATAATAACTATTCTGAACTGTGCTGTGATAAAATC
GACACTAATGTATATAAATGTGCTAGTTCTGATAATGTTATTGAGACATC
AAATTATTCTTTGACGAAAAACCTTCCGTTTCTAAACCAGCCACGGCAAA
ATTTATTCAATTATCATTTATGTTATGAAACACGTCGGGAATCAATAACA
AATCCAGTAACAGGGCAACAATTTTTTCTAAATAATTTTGATATACGTAA
ACAATTTGCAAGAAAATATAACAGTAAAACATTTTTTGATTCTGGAAAAT
GTAGTGCAGCAACAAGTGATAGTTTTATCCATCCAGTTAGAAACTATAGA
CCAAATTCGGAAAATAATCTTCACGAAACATCCCTTGAAGAAAACAACAT
TTCGAATTGTTCAACAAACAACAAAAAATCTTCTAAACAACTTTGGCGGA
AATTGAAACAAGCGTTTTCTAATAAAAAATTAAAATGGAAACATTTATTA
AATGACAACTCTAAAAATAAGCTTTGTCGGTCCTATTCAGCACCGTCATT
GGAATATAACAATGAAAATAATAAAGAAATCATCAAGTGCAATCGATATT
CGACTACCATAGTGGAATTGTACAATTTATTGAACGATCTTGTTGAAGAA
TCCACAGAAAGTGTGTTTGCTGCGACACAAAAAAGCTATTACGATGTCAG
TTGTCAGTTCCCGGAATTGCAACCGATTCAAATCGATAATGGGAAATTTA
ATAGAAAGTCCAAGAAAGATTTAAATATCGATTATCCAGGAATAGGTAAA
CTGAAATTGCCACATCGGCTGAGAACACCGATTTATCAATTGGTAGCAGA
TACAGGAATATTTAACAAATTAAAATTCCTCGAACAAATATCAAACAATG
ACAACCCATCTCAATCAAAAAACAGACGCAGTCGCTCAGTCCACCGATCT
GGACAGTGCAAAAAGAATTCGATCGGTGAAAGTGAACTAGAGAATGTTAA
AAATGGAATTTGTCAAATCAAAACTCCAATTAGATCATCATCAGAATCCC
GGAAGAAATTGCCCATAAACTCAAATATCAAAGATTCCGGATGTCCTTTG
AAAAACACCACTAATACCCACAATAATCAATTGTTTATTATCGAAGAGAA
CAAAAGCCTAAGTTTTGCTGATCTCAGACCGATACCTAGAAACTGGGGTT
TATCGAAGGATAATGATATACTGGCGATGTTTGAATTCCCTAGACGTTCT
TCTAACGACTTTAAAGTCGTAGAATATGATGAAGAAAACAATTTCAGATT
AGGAGGAATTGTAAACAATGCAATAACGGCAATTAAACTGGCATCTGAGA
GTGTTTCTAGTATTCAAGAAGTCGCTACAATTTGTGATAAATTTATCCGA
TGTAAAGATTCGAATCGTCAGAGCACTTCTGCTCTGCTGTTGGCTGTGGA
CACGATTATCGCTCTAATATCCGACGGGTTATATTCCGATAGTATGAGAA
ATAAAAAATCACAAACTGTTTTGGCAACCGGATTTAAAATGACTCAGAAA
TTGTGGATGTTTGTCGAAGAATCTTGCCGAGGAACACTTATCAAGGATCC
ATCTCAAAAGCTAGCATTAAGTAACTTACTGAAGCAAGTGAAACAAACAT
GTGGATTAACAAGTACCGTTTCAAGATCTAAAGAATGGGCAATTCAATTG
AAATTGCAAATATTTATTGTTTTGGCTATCAAAAACAATCTCCTTTATGT
TTGGGTGAAAGCTGTTGTGGCAAATGACACAATTTTGCATCGGTTTTTTA
ATTCCAACAGCTTTTTGCGCCAAGCACGCACAAGTTATTCTAATGCACTT
TCAGCCGTTGTCGTTGAAATGCGTCATCTGTGCATGCCTGGTAGTTCTAG
GATTTACAATGTCAGTAAGCCTATTTCATCGAAATCCCGTAACCAAGCCA
CTGGCCAGTCCTCGAATTCATCCACAGACAATTCTCTAGTGAAATCTAGG
ATTCCCCGATCAAATAAAAGACCTTCAAACGCGTCGGTTAAAAGTTGAAT
AATCTGATCTGTTGATTCATATTTCTGCTTTGCGTCTATAAAGATGTAGC
GTGTTTTATACAGCATTTTCGGACAAATACTTTAGTGAACTATTTACTTT
CTGTTTTTTGTTTTCTGGTGACAGATTTTTCGAAAAATATGGTTTCTGGG
GTAACTTCTAAAACCACAGCATATGGATCCTGAACTGAAACTGATATTTT
GTTTTTTAAACTTTATTCGTCTGTAATGTTAGCAGAACCAAGTCAATGTT
TTTATTTGCGGCAAATCATTTTTTTAAAAAATATTTTGTAAAATGCACCG
TTTTTTAATGAAAACTATTGAGGCTGTTTTATAGAATAATAAAGCAGGCG
TTAAATCGGTAGATAGTGATTTGTAATGAGATTTTACATATATGAAATAA
ATTATTAATGCGGA
back to top

protein sequence of SMED30023625-orf-1

>SMED30023625-orf-1 ID=SMED30023625-orf-1|Name=SMED30023625-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=747bp
MNFSNISCEYFYDEEYDVAITEGSYNQPFVNSLNNNCYPSYFGDGDRLYS
EFDPNESDLWSESALKQSGNNNYSELCCDKIDTNVYKCASSDNVIETSNY
SLTKNLPFLNQPRQNLFNYHLCYETRRESITNPVTGQQFFLNNFDIRKQF
ARKYNSKTFFDSGKCSAATSDSFIHPVRNYRPNSENNLHETSLEENNISN
CSTNNKKSSKQLWRKLKQAFSNKKLKWKHLLNDNSKNKLCRSYSAPSLEY
NNENNKEIIKCNRYSTTIVELYNLLNDLVEESTESVFAATQKSYYDVSCQ
FPELQPIQIDNGKFNRKSKKDLNIDYPGIGKLKLPHRLRTPIYQLVADTG
IFNKLKFLEQISNNDNPSQSKNRRSRSVHRSGQCKKNSIGESELENVKNG
ICQIKTPIRSSSESRKKLPINSNIKDSGCPLKNTTNTHNNQLFIIEENKS
LSFADLRPIPRNWGLSKDNDILAMFEFPRRSSNDFKVVEYDEENNFRLGG
IVNNAITAIKLASESVSSIQEVATICDKFIRCKDSNRQSTSALLLAVDTI
IALISDGLYSDSMRNKKSQTVLATGFKMTQKLWMFVEESCRGTLIKDPSQ
KLALSNLLKQVKQTCGLTSTVSRSKEWAIQLKLQIFIVLAIKNNLLYVWV
KAVVANDTILHRFFNSNSFLRQARTSYSNALSAVVVEMRHLCMPGSSRIY
NVSKPISSKSRNQATGQSSNSSTDNSLVKSRIPRSNKRPSNASVKS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR037213Run_dom_sf
IPR004012Run_dom
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR037213RUN domain superfamilyGENE3DG3DSA:1.20.58.900coord: 501..692
e-value: 3.9E-13
score: 51.1
IPR004012RUN domainPFAMPF02759RUNcoord: 549..676
e-value: 2.3E-6
score: 27.6
IPR004012RUN domainPROSITEPS50826RUNcoord: 537..696
score: 15.061
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 363..389
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 704..746