CAP-Gly domain-containing protein

Overview
NameCAP-Gly domain-containing protein
Smed IDSMED30023618
Length (bp)2150
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CAP-Gly domain-containing protein (SMED30023618) t-SNE clustered cells

Violin plots show distribution of expression levels for CAP-Gly domain-containing protein (SMED30023618) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CAP-Gly domain-containing protein (SMED30023618) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CAP-Gly domain-containing protein (SMED30023618) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023618

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023618h1SMcG0013452 dd_Smed_v4_12415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023618h1SMcG0013452 dd_Smed_v4_12415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023618h1SMcG0013452 dd_Smed_v4_12415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
anterior sideSMED30023618h1SMcG0013452 dd_Smed_v4_12415_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023618h1SMcG0013452 dd_Smed_v4_12415_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-175f12.2 (si:ch211-175f12.2 [Source:ZFIN;Acc:ZDB-GENE-110411-220])

HSP 1 Score: 54.299 bits (129), Expect = 1.144e-7
Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 2
Query: 1589 FAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXX-XKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            F P +  D+     V+ +   GRI  G + ++G++    D YLG+ELE+ + G+H+G Y+G RYF C    G FV F+K++M +
Sbjct:  147 FVPHSPMDLKTGHRVRIMLPSGRICTGTLRYLGNMHNSPDHYLGVELEMADNGQHDGTYEGQRYFDCDPGYGAFVPFSKLLMAW 230          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Match: si:ch211-175f12.2 (si:ch211-175f12.2 [Source:ZFIN;Acc:ZDB-GENE-110411-220])

HSP 1 Score: 54.6842 bits (130), Expect = 1.563e-7
Identity = 31/84 (36.90%), Postives = 50/84 (59.52%), Query Frame = 2
Query: 1589 FAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXX-XKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            F P +  D+     V+ +   GRI  G + ++G++    D YLG+ELE+ + G+H+G Y+G RYF C    G FV F+K++M +
Sbjct:  220 FVPHSPMDLKTGHRVRIMLPSGRICTGTLRYLGNMHNSPDHYLGVELEMADNGQHDGTYEGQRYFDCDPGYGAFVPFSKLLMAW 303          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016706.1 (uncharacterized LOC100495307 [Source:NCBI gene;Acc:100495307])

HSP 1 Score: 95.5153 bits (236), Expect = 1.039e-19
Identity = 46/89 (51.69%), Postives = 63/89 (70.79%), Query Frame = 2
Query: 1574 LGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXX-XXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            L R  FAP++ +D+ + D+VKF R  G+ISKG + + G LP R ++YLG+E    E GKH+GI+ G RYF C+ NKGVFV F+KIIM +
Sbjct:  643 LPRRPFAPKSIADLKVGDLVKFSRPAGKISKGTIQYKGCLPGRVEVYLGVELEGSEVGKHDGIFQGTRYFLCKPNKGVFVNFSKIIMAW 731          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Match: ENSXETT00000016691.1 (uncharacterized LOC100495307 [Source:NCBI gene;Acc:100495307])

HSP 1 Score: 93.2041 bits (230), Expect = 2.250e-19
Identity = 54/129 (41.86%), Postives = 75/129 (58.14%), Query Frame = 2
Query: 1466 DDSDNVTFGTNEILSCTDSDSLRIESFSNQLSKFST----LGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXX-XXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            DD  +VT  T  +   +   +   E F    S        L R  FAP++ +D+ + D+VKF R  G+ISKG + + G LP R ++YLG+E    E GKH+GI+ G RYF C+ NKGVFV F+KIIM +
Sbjct:  349 DDFSSVTQNTANVHCVSPHQNYSPEPFCKTESSTRPSALVLPRRPFAPKSIADLKVGDLVKFSRPAGKISKGTIQYKGCLPGRVEVYLGVELEGSEVGKHDGIFQGTRYFLCKPNKGVFVNFSKIIMAW 477          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A267DW63 (CAP-Gly domain-containing protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig019653g2 PE=4 SV=1)

HSP 1 Score: 136.346 bits (342), Expect = 1.860e-29
Identity = 66/94 (70.21%), Postives = 78/94 (82.98%), Query Frame = 2
Query: 1556 LSKFSTLGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            +S FSTLGR  FAP+  +DI   D+VKF RQGGRISKGLVH+IG LP RND+YLG+EL+ EEGKH+G+YDG RYFQC+  KGVFVAFNK+IM Y
Sbjct:  645 VSPFSTLGRHPFAPKRHNDIRTGDLVKFTRQGGRISKGLVHYIGRLPGRNDVYLGVELDHEEGKHDGVYDGRRYFQCKSRKGVFVAFNKLIMCY 738          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A1I8I3Y9 (CAP-Gly domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.152e-29
Identity = 66/94 (70.21%), Postives = 78/94 (82.98%), Query Frame = 2
Query: 1556 LSKFSTLGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            +S FSTLGR  FAP+  +DI   D+VKF RQGGRISKGLVH+IG LP RND+YLG+EL+ EEGKH+G+YDG RYFQC+  KGVFVAFNK+IM Y
Sbjct:  636 VSPFSTLGRHPFAPKRHNDIRTGDLVKFTRQGGRISKGLVHYIGRLPGRNDVYLGVELDHEEGKHDGVYDGRRYFQCKSRKGVFVAFNKLIMCY 729          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A1I8JK76 (CAP-Gly domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 135.576 bits (340), Expect = 2.506e-29
Identity = 66/94 (70.21%), Postives = 78/94 (82.98%), Query Frame = 2
Query: 1556 LSKFSTLGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            +S FSTLGR  FAP+  +DI   D+VKF RQGGRISKGLVH+IG LP RND+YLG+EL+ EEGKH+G+YDG RYFQC+  KGVFVAFNK+IM Y
Sbjct:  566 VSPFSTLGRHPFAPKRHNDIRTGDLVKFTRQGGRISKGLVHYIGRLPGRNDVYLGVELDHEEGKHDGVYDGRRYFQCKSRKGVFVAFNKLIMCY 659          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A1I8GS16 (CAP-Gly domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 135.961 bits (341), Expect = 2.550e-29
Identity = 66/94 (70.21%), Postives = 78/94 (82.98%), Query Frame = 2
Query: 1556 LSKFSTLGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            +S FSTLGR  FAP+  +DI   D+VKF RQGGRISKGLVH+IG LP RND+YLG+EL+ EEGKH+G+YDG RYFQC+  KGVFVAFNK+IM Y
Sbjct:  636 VSPFSTLGRHPFAPKRHNDIRTGDLVKFTRQGGRISKGLVHYIGRLPGRNDVYLGVELDHEEGKHDGVYDGRRYFQCKSRKGVFVAFNKLIMCY 729          
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Match: A0A1I8IZN2 (CAP-Gly domain-containing protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 125.176 bits (313), Expect = 1.201e-28
Identity = 64/107 (59.81%), Postives = 76/107 (71.03%), Query Frame = 2
Query: 1517 DSDSLRIESFSNQLSKFSTLGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            D+   R      Q   F+T GR  FAP+  +DI   D+VKF R GGRISKGLVHF+G LP R D Y+GIEL+ EEGKH+G+YDG RYFQC+  KGVFVAFNK+IM Y
Sbjct:  116 DTSGQRAMEPPIQQQPFATAGRLPFAPKQAADIRSGDLVKFTRYGGRISKGLVHFVGRLPGRTDYYVGIELDQEEGKHDGVYDGRRYFQCKPRKGVFVAFNKLIMCY 222          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Match: si:ch211-175f12.2 (uncharacterized LOC103030656 [Source:NCBI gene;Acc:103030656])

HSP 1 Score: 55.8398 bits (133), Expect = 6.268e-8
Identity = 41/125 (32.80%), Postives = 66/125 (52.80%), Query Frame = 2
Query: 1472 SDNVTFGTNEILSCTDSDSLRIESFSNQLSKF-STLG-RTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXX-XKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            S+++T G     +  DS S    S S     + S +G    F P +  D+     V+ +   GRIS G + ++G L    +++LG+ELE+ E G+  G Y+G  YF C+   G FVAF+K++M +
Sbjct:  172 SNSLTCGQGTFPTAVDSRSTSAMSVSTSAGSWRSGIGPHRVFVPHSPMDLQPGHRVRIMLPSGRISTGTLRYLGPLQGLPEMHLGVELELAENGQQTGTYEGQFYFDCKPGYGAFVAFSKLLMAW 296          
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Match: EDO30311 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T153])

HSP 1 Score: 72.4034 bits (176), Expect = 4.403e-13
Identity = 36/83 (43.37%), Postives = 57/83 (68.67%), Query Frame = 2
Query: 1589 FAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            FAP +  DI +   V   R  G + +G+V ++G LP R D Y+G+EL+  EGKH+G + G R+F+C+ N+G+FV++NK++M Y
Sbjct: 1180 FAPNSPQDIQLGMRVLVTRTRGNVGRGVVKYVGSLPDRTDTYIGVELDSGEGKHDGSFGGKRFFRCKPNRGIFVSYNKVVMCY 1262          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000011534.1 (SMESG000011534.1)

HSP 1 Score: 1075.85 bits (2781), Expect = 0.000e+0
Identity = 579/583 (99.31%), Postives = 580/583 (99.49%), Query Frame = 2
Query:  107 MSLNFNDLNPSMISNNKGDNESSSINWNDDYSQKLANFMKSSNELLKNKKRTQNIISTQAVISNEIDISKKSESPLNSLFFNDFKHVDDEIKTENKPNIAFHEKYLPIFDENGNNSECGNKEIIHKKKNMQHNFQEALRMDDLESQVNKLQKQLTEKNKLIEDLQSELLTVKQKNTTKKCVYRNLATEYCNDFATITATINELPTNSSKVKSEEISGQNTYKEDFCKKNLLEFSSIENYNPDSPVALKNKIKDLESQIQDLQEANEIASHFVSNIKNEESDFSNEVLSDLIGKNQILQDEIHNLRQNAIEVKSDLVLSKVMRNELENLKLGVSALKHQNDXXXXXXXXXXXXXXXXXXXXXXXXXXXXXLIQSEFENSSKPSKHLSYSGKHLLEKNSKLLSNENFLNDKYNRDLSQDSTDSMLSDINHNTESIKFINELVPIRIPKEIINDTCDDSDNVTFGTNEILSCTDSDSLRIESFSNQLSKFSTLGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVYSKNVER 1855
            MSLNFNDLNPSMISNNKGDNESSSINWNDDYSQKLANFMKSSNELLKNKKRTQNIISTQAVISNEIDISKKSESPLNSLFFNDFKHVDDEIKTENKPNIAFHEKYLPIFDEN NNSECGNKEIIHKKKNMQHNFQEALRMDDLESQVNKLQKQLTEKNKLIEDLQSELLTVKQKNTTKKCVYRNLATEYCNDFATITATINELPTNSSKVKSEEISGQNTYKEDFCKKNLLEFSSIENYNPDSPVALKNKIKDLESQIQDLQEANEIASHFVSNIKNEESDFSNEVLSDLIGKNQILQDEIHNLRQNAIEVKSDLVLSKVMRNELENLKLGVSALKHQNDIIIEENIKLKKIVKNHDSKSDKKVKSK KLIQSEFENSSKPSKHLSYSGKHLLEKNSKLLSNENFLNDKYNRDLSQDSTDSMLSDINHNTESIKFINELVPIRIPKEIINDTCDDSDNVTFGTNEILSCTDSDSLRIESFSNQLSKFSTLGRTAFAPRAGSDI INDVVKFIRQGGRISKGLVHFIGHLPKRNDIYLGIELEIEEGKHNGIYDG+RYFQCRENKGVFVAFNKIIMVYSKNVER
Sbjct:    1 MSLNFNDLNPSMISNNKGDNESSSINWNDDYSQKLANFMKSSNELLKNKKRTQNIISTQAVISNEIDISKKSESPLNSLFFNDFKHVDDEIKTENKPNIAFHEKYLPIFDENANNSECGNKEIIHKKKNMQHNFQEALRMDDLESQVNKLQKQLTEKNKLIEDLQSELLTVKQKNTTKKCVYRNLATEYCNDFATITATINELPTNSSKVKSEEISGQNTYKEDFCKKNLLEFSSIENYNPDSPVALKNKIKDLESQIQDLQEANEIASHFVSNIKNEESDFSNEVLSDLIGKNQILQDEIHNLRQNAIEVKSDLVLSKVMRNELENLKLGVSALKHQNDIIIEENIKLKKIVKNHDSKSDKKVKSKKKLIQSEFENSSKPSKHLSYSGKHLLEKNSKLLSNENFLNDKYNRDLSQDSTDSMLSDINHNTESIKFINELVPIRIPKEIINDTCDDSDNVTFGTNEILSCTDSDSLRIESFSNQLSKFSTLGRTAFAPRAGSDISINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYLGIELEIEEGKHNGIYDGVRYFQCRENKGVFVAFNKIIMVYSKNVER 583          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000006189.1 (SMESG000006189.1)

HSP 1 Score: 106.301 bits (264), Expect = 1.732e-23
Identity = 50/112 (44.64%), Postives = 79/112 (70.54%), Query Frame = 2
Query: 1535 IESFSNQLSKFSTLGRT-----------AFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVY 1837
            + +  N+ S+ ST+  T           +F P+  SD+ ++DVVKF+R GG+++ G V FIGHLP R+++ +G+EL  E GKH+G+++G RYFQCR+N+GVF++F+KII+ Y
Sbjct:  648 LSTLENESSEVSTVKNTENYTYPPRYEYSFTPKVASDLHLDDVVKFVRPGGKMATGTVCFIGHLPGRSEVCVGLELGEEAGKHDGLFEGHRYFQCRKNRGVFISFHKIILAY 759          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000031119.1 (SMESG000031119.1)

HSP 1 Score: 78.1814 bits (191), Expect = 8.363e-15
Identity = 37/94 (39.36%), Postives = 64/94 (68.09%), Query Frame = 2
Query: 1565 FSTLGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVYSKN 1846
            FS + R    P    +I + D+V+F R+  R+  G+V FIG LP + DI+LG++LE ++G ++G Y+G RYF+  +N+G+FV+F +++M++  N
Sbjct:  423 FSIVNRKCHVPVHPCNIDVGDIVRFSRETCRVCLGIVKFIGDLPNQKDIFLGLKLERDDGLNDGTYNGQRYFEFEKNRGIFVSFQRVMMIFKYN 516          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000031119.1 (SMESG000031119.1)

HSP 1 Score: 77.411 bits (189), Expect = 1.055e-14
Identity = 37/94 (39.36%), Postives = 64/94 (68.09%), Query Frame = 2
Query: 1565 FSTLGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQCRENKGVFVAFNKIIMVYSKN 1846
            FS + R    P    +I + D+V+F R+  R+  G+V FIG LP + DI+LG++LE ++G ++G Y+G RYF+  +N+G+FV+F +++M++  N
Sbjct:  337 FSIVNRKCHVPVHPCNIDVGDIVRFSRETCRVCLGIVKFIGDLPNQKDIFLGLKLERDDGLNDGTYNGQRYFEFEKNRGIFVSFQRVMMIFKYN 430          
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Match: SMESG000031119.1 (SMESG000031119.1)

HSP 1 Score: 56.9954 bits (136), Expect = 3.439e-8
Identity = 30/73 (41.10%), Postives = 48/73 (65.75%), Query Frame = 2
Query: 1565 FSTLGRTAFAPRAGSDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYXXXXXXXXXXKHNGIYDGIRYFQ 1783
            FS + R    P    +I + D+V+F R+  R+  G+V FIG LP + DI+LG++LE ++G ++G Y+G RYF+
Sbjct:  423 FSIVNRKCHVPVHPCNIDVGDIVRFSRETCRVCLGIVKFIGDLPNQKDIFLGLKLERDDGLNDGTYNGQRYFE 495          
The following BLAST results are available for this feature:
BLAST of CAP-Gly domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:ch211-175f12.21.144e-736.90si:ch211-175f12.2 [Source:ZFIN;Acc:ZDB-GENE-110411... [more]
si:ch211-175f12.21.563e-736.90si:ch211-175f12.2 [Source:ZFIN;Acc:ZDB-GENE-110411... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
ENSXETT00000016706.11.039e-1951.69uncharacterized LOC100495307 [Source:NCBI gene;Acc... [more]
ENSXETT00000016691.12.250e-1941.86uncharacterized LOC100495307 [Source:NCBI gene;Acc... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267DW631.860e-2970.21CAP-Gly domain-containing protein (Fragment) OS=Ma... [more]
A0A1I8I3Y92.152e-2970.21CAP-Gly domain-containing protein OS=Macrostomum l... [more]
A0A1I8JK762.506e-2970.21CAP-Gly domain-containing protein OS=Macrostomum l... [more]
A0A1I8GS162.550e-2970.21CAP-Gly domain-containing protein OS=Macrostomum l... [more]
A0A1I8IZN21.201e-2859.81CAP-Gly domain-containing protein OS=Macrostomum l... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:ch211-175f12.26.268e-832.80uncharacterized LOC103030656 [Source:NCBI gene;Acc... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO303114.403e-1343.37Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CAP-Gly domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CAP-Gly domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000011534.10.000e+099.31SMESG000011534.1[more]
SMESG000006189.11.732e-2344.64SMESG000006189.1[more]
SMESG000031119.18.363e-1539.36SMESG000031119.1[more]
SMESG000031119.11.055e-1439.36SMESG000031119.1[more]
SMESG000031119.13.439e-841.10SMESG000031119.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023618 ID=SMED30023618|Name=CAP-Gly domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2150bp
CTATATAAATCTTATATGTTAATAATTCAAATGAGGTATCAATACCCAAG
TTCTACTATTTATGCATATTGTATTTAATTACTAACTATGTGATAATCCT
TCATACATGTCTTTAAATTTTAATGATCTTAACCCTTCAATGATTTCTAA
TAATAAAGGAGACAATGAATCATCTTCAATTAACTGGAATGATGACTATT
CTCAGAAGCTAGCTAATTTTATGAAAAGTTCAAATGAATTATTGAAAAAT
AAGAAAAGAACTCAAAATATAATTAGTACTCAGGCAGTTATTTCCAACGA
AATTGATATTTCAAAGAAATCAGAATCACCTTTGAATTCTTTATTTTTCA
ATGATTTTAAACACGTGGATGATGAAATCAAGACTGAGAATAAACCAAAT
ATTGCGTTTCATGAAAAATACTTACCAATTTTCGATGAAAACGGAAACAA
TTCCGAGTGTGGTAATAAAGAAATTATTCACAAGAAAAAAAATATGCAAC
ATAACTTTCAAGAAGCCTTGCGCATGGATGACCTAGAAAGTCAAGTGAAT
AAATTACAAAAACAATTAACGGAAAAAAATAAACTCATAGAAGATCTTCA
ATCAGAACTGCTAACTGTTAAGCAAAAGAATACAACTAAAAAATGTGTCT
ATAGGAATTTGGCGACAGAATATTGTAATGATTTCGCAACTATTACTGCC
ACAATAAATGAATTACCAACCAATTCATCTAAAGTTAAATCGGAAGAAAT
AAGTGGGCAAAATACTTATAAAGAAGATTTCTGTAAAAAAAACCTTTTGG
AATTTTCTTCAATAGAGAATTATAATCCCGATAGCCCTGTTGCGCTGAAA
AATAAAATTAAGGATTTAGAATCACAAATACAAGATCTCCAAGAAGCTAA
TGAAATTGCATCACACTTTGTTTCTAATATCAAAAATGAAGAATCAGATT
TTTCAAATGAAGTATTGTCGGATTTAATAGGGAAAAATCAAATTTTACAA
GATGAAATACACAATTTACGTCAAAACGCTATCGAAGTAAAATCTGATTT
AGTTTTATCAAAAGTTATGCGAAACGAATTAGAAAATCTAAAACTAGGTG
TTAGTGCTTTAAAGCATCAAAATGATATCATAATTGAAGAAAACATTAAG
TTAAAAAAAATTGTGAAAAATCACGATTCTAAAAGTGATAAAAAAGTTAA
AAGTAAAACAAAATTGATCCAATCAGAATTTGAAAATTCAAGTAAGCCAT
CAAAACATTTATCTTATTCCGGTAAACACCTTTTGGAGAAAAACTCAAAA
TTGTTAAGCAATGAGAATTTTTTAAATGACAAGTATAACCGGGATTTAAG
CCAGGATTCTACAGATAGTATGTTGAGCGATATCAACCATAATACCGAAA
GTATAAAATTCATAAACGAACTGGTTCCAATAAGAATTCCAAAAGAAATA
ATCAATGATACATGTGATGATTCTGACAATGTAACATTTGGTACAAATGA
AATTTTGAGTTGTACAGATTCAGATTCTTTACGTATTGAAAGTTTTTCGA
ATCAATTAAGTAAATTTTCAACGCTTGGAAGAACCGCATTTGCTCCTCGA
GCTGGTTCAGACATAATTATTAATGATGTTGTTAAATTTATTCGACAAGG
TGGTCGAATATCAAAAGGCCTTGTTCATTTCATTGGGCATTTACCTAAAA
GAAATGATATCTATTTAGGTATTGAATTGGAAATCGAAGAAGGAAAGCAT
AATGGAATTTATGATGGAATTAGATATTTTCAATGTCGAGAAAACAAAGG
TGTATTTGTCGCTTTCAATAAAATTATTATGGTGTACTCAAAAAATGTAG
AAAGATAATTTGACCTAAATTTTAATTGTCTTTAATACTCTATTGTCATT
ATCATATCATAATAAATATACTATCATTTTATCTGTGTTCTATACGCCAT
GGATCTGCCATGTTGTTGTCCTTCTGCAAACTGTTTTATTTTTAATTGTT
TATCCGAACCTATTTTCGTAAACTTTTGTTTATCTTGGCTCGGATTATCC
TGAAGAATTTCAAATTTTTGGACAAAATCTTCATATCTTGATAATTATAA
AATTTATTGATTAGTATAGATTTATTGTATAAAATACATTTGAAATTATT
back to top

protein sequence of SMED30023618-orf-1

>SMED30023618-orf-1 ID=SMED30023618-orf-1|Name=SMED30023618-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=584bp
MSLNFNDLNPSMISNNKGDNESSSINWNDDYSQKLANFMKSSNELLKNKK
RTQNIISTQAVISNEIDISKKSESPLNSLFFNDFKHVDDEIKTENKPNIA
FHEKYLPIFDENGNNSECGNKEIIHKKKNMQHNFQEALRMDDLESQVNKL
QKQLTEKNKLIEDLQSELLTVKQKNTTKKCVYRNLATEYCNDFATITATI
NELPTNSSKVKSEEISGQNTYKEDFCKKNLLEFSSIENYNPDSPVALKNK
IKDLESQIQDLQEANEIASHFVSNIKNEESDFSNEVLSDLIGKNQILQDE
IHNLRQNAIEVKSDLVLSKVMRNELENLKLGVSALKHQNDIIIEENIKLK
KIVKNHDSKSDKKVKSKTKLIQSEFENSSKPSKHLSYSGKHLLEKNSKLL
SNENFLNDKYNRDLSQDSTDSMLSDINHNTESIKFINELVPIRIPKEIIN
DTCDDSDNVTFGTNEILSCTDSDSLRIESFSNQLSKFSTLGRTAFAPRAG
SDIIINDVVKFIRQGGRISKGLVHFIGHLPKRNDIYLGIELEIEEGKHNG
IYDGIRYFQCRENKGVFVAFNKIIMVYSKNVER*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000034epidermis
PLANA:0000099neuron
PLANA:0000101muscle cell
PLANA:0000140anterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR036859CAP-Gly_dom_sf
IPR000938CAP-Gly_domain
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 287..314
NoneNo IPR availableCOILSCoilCoilcoord: 244..271
NoneNo IPR availableCOILSCoilCoilcoord: 133..174
NoneNo IPR availablePANTHERPTHR18916:SF65coord: 196..578
NoneNo IPR availablePANTHERPTHR18916DYNACTIN 1-RELATED MICROTUBULE-BINDINGcoord: 196..578
IPR000938CAP Gly-rich domainSMARTSM01052CAP_GLY_2coord: 505..574
e-value: 1.8E-17
score: 74.1
IPR000938CAP Gly-rich domainPFAMPF01302CAP_GLYcoord: 516..573
e-value: 1.2E-16
score: 60.5
IPR000938CAP Gly-rich domainPROSITEPS50245CAP_GLY_2coord: 527..569
score: 13.517
IPR036859CAP Gly-rich domain superfamilyGENE3DG3DSA:2.30.30.190coord: 500..582
e-value: 1.9E-18
score: 67.8
IPR036859CAP Gly-rich domain superfamilySUPERFAMILYSSF74924Cap-Gly domaincoord: 485..575