SMED30023612

Overview
NameSMED30023612
Smed IDSMED30023612
Length (bp)1679
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of SMED30023612 (SMED30023612) t-SNE clustered cells

Violin plots show distribution of expression levels for SMED30023612 (SMED30023612) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of SMED30023612 (SMED30023612) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for SMED30023612 (SMED30023612) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023612

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023612h1SMcG0022051 dd_Smed_v4_8514_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Alignments
SMED30023612 aligns in the following genomic locations:
Alignment LocationAlignment Score
v31.000503:73585..76437 -7190
Homology
BLAST of SMED30023612 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 83.1889 bits (204), Expect = 1.795e-18
Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 83.1889 bits (204), Expect = 2.030e-18
Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 83.5741 bits (205), Expect = 3.804e-18
Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 83.5741 bits (205), Expect = 4.864e-18
Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Human
Match: HSPA8 (heat shock protein family A (Hsp70) member 8 [Source:HGNC Symbol;Acc:HGNC:5241])

HSP 1 Score: 83.5741 bits (205), Expect = 5.348e-18
Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 82.0333 bits (201), Expect = 3.366e-16
Identity = 40/67 (59.70%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VF HGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP+ T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Celegans
Match: hsp-1 (Heat shock 70 kDa protein A [Source:UniProtKB/Swiss-Prot;Acc:P09446])

HSP 1 Score: 82.0333 bits (201), Expect = 3.366e-16
Identity = 40/67 (59.70%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VF HGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP+ T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFMHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPHNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759681:11761808:1 gene:WBGene00009692.1 transcript:F44E5.5.2 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 77.7962 bits (190), Expect = 7.984e-15
Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = -3
Query: 1162 KTSGIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1371
            K  GIDL TTYS V ++Q+GK E +AN++ N+ TP+YV +TDTERL+   AKD    NP  T+F+ KR I
Sbjct:    5 KAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Celegans
Match: F44E5.5 (pep chromosome:WBcel235:II:11759640:11761853:1 gene:WBGene00009692.1 transcript:F44E5.5.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.5)

HSP 1 Score: 77.7962 bits (190), Expect = 7.984e-15
Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = -3
Query: 1162 KTSGIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1371
            K  GIDL TTYS V ++Q+GK E +AN++ N+ TP+YV +TDTERL+   AKD    NP  T+F+ KR I
Sbjct:    5 KAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Celegans
Match: F44E5.4 (pep chromosome:WBcel235:II:11757106:11759323:-1 gene:WBGene00009691.1 transcript:F44E5.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F44E5.4)

HSP 1 Score: 77.7962 bits (190), Expect = 7.984e-15
Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = -3
Query: 1162 KTSGIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1371
            K  GIDL TTYS V ++Q+GK E +AN++ N+ TP+YV +TDTERL+   AKD    NP  T+F+ KR I
Sbjct:    5 KAIGIDLGTTYSCVGIYQNGKVEILANSEGNKTTPSYVAFTDTERLVGDAAKDQAARNPENTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083059)

HSP 1 Score: 84.7297 bits (208), Expect = 5.831e-17
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0337053)

HSP 1 Score: 84.7297 bits (208), Expect = 5.831e-17
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083058)

HSP 1 Score: 84.7297 bits (208), Expect = 5.831e-17
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083060)

HSP 1 Score: 84.7297 bits (208), Expect = 5.831e-17
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Fly
Match: Hsc70-4 (gene:FBgn0266599 transcript:FBtr0083057)

HSP 1 Score: 84.7297 bits (208), Expect = 5.831e-17
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Zebrafish
Match: hsp70.1 (heat shock cognate 70-kd protein, tandem duplicate 1 [Source:ZFIN;Acc:ZDB-GENE-990415-91])

HSP 1 Score: 86.6557 bits (213), Expect = 2.984e-18
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 76          
BLAST of SMED30023612 vs. Ensembl Zebrafish
Match: hsp70.2 (heat shock cognate 70-kd protein, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110405-1])

HSP 1 Score: 86.6557 bits (213), Expect = 2.984e-18
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 76          
BLAST of SMED30023612 vs. Ensembl Zebrafish
Match: hspa8 (heat shock protein 8 [Source:NCBI gene;Acc:573376])

HSP 1 Score: 83.5741 bits (205), Expect = 4.458e-18
Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Zebrafish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 86.6557 bits (213), Expect = 2.125e-17
Identity = 43/67 (64.18%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Zebrafish
Match: hsp70.2 (heat shock cognate 70-kd protein, tandem duplicate 2 [Source:ZFIN;Acc:ZDB-GENE-110405-1])

HSP 1 Score: 86.6557 bits (213), Expect = 2.275e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 76          
BLAST of SMED30023612 vs. Ensembl Xenopus
Match: wdr26 (WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-993726])

HSP 1 Score: 85.5001 bits (210), Expect = 6.874e-17
Identity = 42/70 (60.00%), Postives = 51/70 (72.86%), Query Frame = -3
Query: 1162 KTSGIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1371
            +T GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    5 RTVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Xenopus
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:NCBI gene;Acc:100496396])

HSP 1 Score: 84.7297 bits (208), Expect = 1.118e-16
Identity = 42/70 (60.00%), Postives = 50/70 (71.43%), Query Frame = -3
Query: 1162 KTSGIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1371
            ++ GIDL TTYS V VFQHGK E +AN Q NR TP+YV +TDTERLI   AK+   +NP  TIF+ KR I
Sbjct:    5 RSVGIDLGTTYSCVGVFQHGKVEIIANEQGNRTTPSYVAFTDTERLIGDAAKNQVALNPANTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Xenopus
Match: tmed10 (transmembrane emp24-like trafficking protein 10 (yeast) [Source:Xenbase;Acc:XB-GENE-968508])

HSP 1 Score: 84.7297 bits (208), Expect = 1.363e-16
Identity = 41/67 (61.19%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP+ T+F+ KR I
Sbjct:    9 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPHNTVFDAKRLI 75          
BLAST of SMED30023612 vs. Ensembl Xenopus
Match: ENSXETT00000025573.1 (heat shock protein family A (Hsp70) member 1B [Source:NCBI gene;Acc:100485441])

HSP 1 Score: 84.3445 bits (207), Expect = 1.551e-16
Identity = 41/67 (61.19%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP+ T+F+ KR I
Sbjct:    9 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPHNTVFDAKRLI 75          
BLAST of SMED30023612 vs. Ensembl Xenopus
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:NCBI gene;Acc:100496396])

HSP 1 Score: 83.9593 bits (206), Expect = 2.085e-16
Identity = 42/67 (62.69%), Postives = 48/67 (71.64%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN Q NR TP+YV +TDTERLI   AK+   +NP  TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANEQGNRTTPSYVAFTDTERLIGDAAKNQVALNPANTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Mouse
Match: Hspa8 (heat shock protein 8 [Source:MGI Symbol;Acc:MGI:105384])

HSP 1 Score: 82.8037 bits (203), Expect = 1.191e-18
Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Mouse
Match: Hspa1a (heat shock protein 1A [Source:MGI Symbol;Acc:MGI:96244])

HSP 1 Score: 84.7297 bits (208), Expect = 9.382e-17
Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Mouse
Match: Hspa1b (heat shock protein 1B [Source:MGI Symbol;Acc:MGI:99517])

HSP 1 Score: 84.7297 bits (208), Expect = 9.733e-17
Identity = 41/67 (61.19%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPQNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 84.3445 bits (207), Expect = 1.339e-16
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  TIF+ KR I
Sbjct:    9 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLI 75          
BLAST of SMED30023612 vs. Ensembl Mouse
Match: Hspa2 (heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96243])

HSP 1 Score: 84.3445 bits (207), Expect = 1.339e-16
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  TIF+ KR I
Sbjct:    9 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTNTIFDAKRLI 75          
BLAST of SMED30023612 vs. UniProt/SwissProt
Match: sp|P02826|HSP7A_DROSI (Heat shock 70 kDa protein cognate 1 (Fragments) OS=Drosophila simulans OX=7240 GN=Hsc70-1 PE=2 SV=1)

HSP 1 Score: 83.1889 bits (204), Expect = 6.400e-17
Identity = 41/67 (61.19%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +T++ERLI   AK+   +NPN TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTESERLIGDAAKNQVAMNPNNTIFDAKRLI 74          
BLAST of SMED30023612 vs. UniProt/SwissProt
Match: sp|Q91291|HSP70_PLEWA (Heat shock 70 kDa protein OS=Pleurodeles waltl OX=8319 GN=HSP70 PE=2 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 1.708e-16
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +ANNQ NR TP+YV +TDTERLI   AK+  ++NP  T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANNQGNRTTPSYVAFTDTERLIGAPAKNQVSLNPQNTVFDAKRLI 76          
BLAST of SMED30023612 vs. UniProt/SwissProt
Match: sp|Q91233|HSP70_ONCTS (Heat shock 70 kDa protein OS=Oncorhynchus tshawytscha OX=74940 GN=hsp70 PE=2 SV=1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.945e-16
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 76          
BLAST of SMED30023612 vs. UniProt/SwissProt
Match: sp|Q9U639|HSP7D_MANSE (Heat shock 70 kDa protein cognate 4 OS=Manduca sexta OX=7130 PE=2 SV=1)

HSP 1 Score: 85.1149 bits (209), Expect = 5.269e-16
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDT+RLI   AK+   +NPN TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTDRLIGDAAKNQVAMNPNNTIFDAKRLI 74          
BLAST of SMED30023612 vs. UniProt/SwissProt
Match: sp|P11147|HSP7D_DROME (Heat shock 70 kDa protein cognate 4 OS=Drosophila melanogaster OX=7227 GN=Hsc70-4 PE=1 SV=3)

HSP 1 Score: 84.7297 bits (208), Expect = 5.845e-16
Identity = 42/67 (62.69%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP  TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPTQTIFDAKRLI 74          
BLAST of SMED30023612 vs. TrEMBL
Match: A0A2A4AYR6 (Molecular chaperone DnaK (Fragment) OS=Pseudomonas pelagia OX=553151 GN=CO192_00790 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 3.751e-17
Identity = 43/67 (64.18%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLI 74          
BLAST of SMED30023612 vs. TrEMBL
Match: K9ZRK9 (Heat shock 70kDa protein 1A (Fragment) OS=Bos indicus OX=9915 GN=HSPA1A PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.402e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI Y AK+   +NP  T+F+ KR I
Sbjct:    5 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGYAAKNQVALNPQNTVFDAKRLI 71          
BLAST of SMED30023612 vs. TrEMBL
Match: K9ZU00 (Heat shock 70kDa protein 1A (Fragment) OS=Bos indicus x Bos taurus OX=30522 GN=HSPA1A PE=4 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 5.402e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI Y AK+   +NP  T+F+ KR I
Sbjct:    5 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGYAAKNQVALNPQNTVFDAKRLI 71          
BLAST of SMED30023612 vs. TrEMBL
Match: A0A498M6N3 (Heat shock OS=Labeo rohita OX=84645 GN=ROHU_029300 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.445e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:   25 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 91          
BLAST of SMED30023612 vs. TrEMBL
Match: A0A5B1KSA7 (Hsp70 family protein (Fragment) OS=Nocardioides sp. BN130099 OX=2607660 GN=F0U44_22785 PE=4 SV=1)

HSP 1 Score: 86.6557 bits (213), Expect = 7.544e-17
Identity = 44/67 (65.67%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK ET+AN+Q NR TP+YV  TDTERLI   AK+   +NPN TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVETIANDQGNRTTPSYVARTDTERLIGDAAKNQVAMNPNNTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Cavefish
Match: ENSAMXT00000032722.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:155723:156505:1 gene:ENSAMXG00000042801.1 transcript:ENSAMXT00000032722.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.6557 bits (213), Expect = 1.147e-19
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 76          
BLAST of SMED30023612 vs. Ensembl Cavefish
Match: hspa1b (heat shock protein family A (Hsp70) member 1B [Source:ZFIN;Acc:ZDB-GENE-060503-867])

HSP 1 Score: 86.6557 bits (213), Expect = 1.738e-17
Identity = 43/67 (64.18%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Cavefish
Match: ENSAMXT00000037064.1 (heat shock 70 kDa protein [Source:NCBI gene;Acc:111193176])

HSP 1 Score: 86.6557 bits (213), Expect = 1.797e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 76          
BLAST of SMED30023612 vs. Ensembl Cavefish
Match: ENSAMXT00000055474.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:150188:156169:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000055474.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 1.987e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 76          
BLAST of SMED30023612 vs. Ensembl Cavefish
Match: ENSAMXT00000031477.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02001455.1:148482:152871:-1 gene:ENSAMXG00000043809.1 transcript:ENSAMXT00000031477.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 86.2705 bits (212), Expect = 1.987e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 76          
BLAST of SMED30023612 vs. Ensembl Sea Lamprey
Match: hspa5 (heat shock protein 5 [Source:NCBI gene;Acc:378848])

HSP 1 Score: 68.5514 bits (166), Expect = 1.918e-12
Identity = 37/68 (54.41%), Postives = 48/68 (70.59%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYT-DTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VF++G+ E +AN+Q NR TP+YV +T + ERLI   AK+  T NP  T+F+ KR I
Sbjct:   37 GIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTAEGERLIGDAAKNQLTSNPENTVFDAKRLI 104          
BLAST of SMED30023612 vs. Ensembl Sea Lamprey
Match: hspa9 (heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030828-12])

HSP 1 Score: 48.9062 bits (115), Expect = 2.451e-6
Identity = 28/68 (41.18%), Postives = 38/68 (55.88%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYT-DTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TT S V+V +  + + + N +  R TP+ V +T D ERL+   AK     NPN T +  KR I
Sbjct:   57 GIDLGTTNSCVAVMEGKQAKVLENAEGARTTPSVVAFTADGERLVGMPAKRQAVTNPNNTFYATKRLI 124          
BLAST of SMED30023612 vs. Ensembl Yeast
Match: KAR2 (ATPase involved in protein import into the ER; also acts as a chaperone to mediate protein folding in the ER and may play a role in ER export of soluble proteins; regulates the unfolded protein response via interaction with Ire1p [Source:SGD;Acc:S000003571])

HSP 1 Score: 75.485 bits (184), Expect = 7.690e-15
Identity = 39/69 (56.52%), Postives = 47/69 (68.12%), Query Frame = -3
Query: 1156 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKIQL 1362
            GIDL TTYS V+V ++GK E +AN Q NR TP+YV +TD ERLI   AK+    NP  TIF+ KR I L
Sbjct:   54 GIDLGTTYSCVAVMKNGKTEILANEQGNRITPSYVAFTDDERLIGDAAKNQVAANPQNTIFDIKRLIGL 122          
BLAST of SMED30023612 vs. Ensembl Yeast
Match: SSA4 (Heat shock protein that is highly induced upon stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the HSP70 family; cytoplasmic protein that concentrates in nuclei upon starvation; SSA4 has a paralog, SSA3, that arose from the whole genome duplication [Source:SGD;Acc:S000000905])

HSP 1 Score: 73.9442 bits (180), Expect = 2.736e-14
Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = -3
Query: 1162 KTSGIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1371
            K  GIDL TTYS V+ F + + E +AN+Q NR TP+YV +TDTERLI   AK+   +NP+ T+F+ KR I
Sbjct:    3 KAVGIDLGTTYSCVAHFANDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAMNPHNTVFDAKRLI 72          
BLAST of SMED30023612 vs. Ensembl Yeast
Match: SSA3 (ATPase involved in protein folding and the response to stress; plays a role in SRP-dependent cotranslational protein-membrane targeting and translocation; member of the heat shock protein 70 (HSP70) family; localized to the cytoplasm; SSA3 has a paralog, SSA4, that arose from the whole genome duplication [Source:SGD;Acc:S000000171])

HSP 1 Score: 73.559 bits (179), Expect = 3.372e-14
Identity = 37/70 (52.86%), Postives = 49/70 (70.00%), Query Frame = -3
Query: 1162 KTSGIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1371
            +  GIDL TTYS V+ F + + E +AN+Q NR TP+YV +TDTERLI   AK+   INP+ T+F+ KR I
Sbjct:    3 RAVGIDLGTTYSCVAHFSNDRVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQAAINPHNTVFDAKRLI 72          
BLAST of SMED30023612 vs. Ensembl Yeast
Match: SSA1 (ATPase involved in protein folding and NLS-directed nuclear transport; member of HSP70 family; required for ubiquitin-dependent degradation of short-lived proteins; forms chaperone complex with Ydj1p; localized to nucleus, cytoplasm, cell wall; 98% identical to paralog Ssa2p with different functional specificity in propagation of yeast [URE3] prions, vacuolar-mediated degradations of gluconeogenesis enzymes; general targeting factor of Hsp104p to prion fibrils [Source:SGD;Acc:S000000004])

HSP 1 Score: 71.2478 bits (173), Expect = 1.563e-13
Identity = 35/70 (50.00%), Postives = 49/70 (70.00%), Query Frame = -3
Query: 1162 KTSGIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1371
            K  GIDL TTYS V+ F + + + +AN+Q NR TP++V +TDTERLI   AK+   +NP+ T+F+ KR I
Sbjct:    3 KAVGIDLGTTYSCVAHFANDRVDIIANDQGNRTTPSFVAFTDTERLIGDAAKNQAAMNPSNTVFDAKRLI 72          
BLAST of SMED30023612 vs. Ensembl Yeast
Match: SSA2 (HSP70 family ATP-binding protein; involved in protein folding, vacuolar import of proteins; required for ubiquitin-dependent degradation of short-lived proteins; associated with chaperonin-containing T-complex; 98% identical to paralog Ssa1p with distinct functional specificity in propagation of yeast [URE3] prions and vacuolar-mediated degradation of gluconeogenesis enzymes; binds tRNA, has role in tRNA nuclear import during starvation [Source:SGD;Acc:S000003947])

HSP 1 Score: 70.0922 bits (170), Expect = 3.817e-13
Identity = 35/70 (50.00%), Postives = 48/70 (68.57%), Query Frame = -3
Query: 1162 KTSGIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1371
            K  GIDL TTYS V+ F + + + +AN+Q NR TP++V +TDTERLI   AK+   +NP  T+F+ KR I
Sbjct:    3 KAVGIDLGTTYSCVAHFSNDRVDIIANDQGNRTTPSFVGFTDTERLIGDAAKNQAAMNPANTVFDAKRLI 72          
BLAST of SMED30023612 vs. Ensembl Nematostella
Match: EDO37280 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SG65])

HSP 1 Score: 82.4185 bits (202), Expect = 1.309e-16
Identity = 40/67 (59.70%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV ++DTERLI   AK+   +NP  T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFSDTERLIGDAAKNQVAMNPENTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Nematostella
Match: EDO30323 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T144])

HSP 1 Score: 81.6481 bits (200), Expect = 2.474e-16
Identity = 40/67 (59.70%), Postives = 48/67 (71.64%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TD ERL+   AK+   +NP  TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDEERLVGDAAKNQVAMNPTNTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Nematostella
Match: EDO44530 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV88])

HSP 1 Score: 80.8777 bits (198), Expect = 4.600e-16
Identity = 40/67 (59.70%), Postives = 49/67 (73.13%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQ+GK E +AN+Q NR TP+YV +TDTERL+   AK+   +NP  TIF+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQNGKVEIIANDQGNRTTPSYVGFTDTERLVGDAAKNQVALNPENTIFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Nematostella
Match: EDO33296 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SSL5])

HSP 1 Score: 68.5514 bits (166), Expect = 3.240e-12
Identity = 37/68 (54.41%), Postives = 48/68 (70.59%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDT-ERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VF++G+ E +AN+Q NR TP+YV +T+  ERLI   AK+  T NP  T+F+ KR I
Sbjct:   37 GIDLGTTYSCVGVFKNGRVEIIANDQGNRITPSYVAFTEEGERLIGDGAKNQLTTNPENTVFDAKRLI 104          
BLAST of SMED30023612 vs. Ensembl Nematostella
Match: EDO25618 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8DVZ1])

HSP 1 Score: 45.8246 bits (107), Expect = 1.301e-6
Identity = 27/75 (36.00%), Postives = 40/75 (53.33%), Query Frame = -3
Query: 1153 KTSGIDLSTTYSFVSVFQ--HGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKIQLT 1371
            K  GIDL TTYS V  +Q   G+ +  ++  +++  P+ V +TD   L+   A     INP  TI++ KR I  T
Sbjct:    4 KIIGIDLGTTYSCVGAYQAISGRIDIFSDENDDKVVPSLVAFTDKGVLVGEKALSQAEINPKNTIYDAKRFIGKT 78          
BLAST of SMED30023612 vs. Ensembl Medaka
Match: ENSORLT00000042552.1 (pep primary_assembly:ASM223467v1:8:710990:713238:-1 gene:ENSORLG00000027683.1 transcript:ENSORLT00000042552.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 84.7297 bits (208), Expect = 6.965e-18
Identity = 41/67 (61.19%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP+ T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLI 76          
BLAST of SMED30023612 vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 86.2705 bits (212), Expect = 2.510e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Medaka
Match: hspa8b (heat shock cognate 70 kDa protein [Source:NCBI gene;Acc:100125490])

HSP 1 Score: 86.2705 bits (212), Expect = 2.662e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:    8 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPNNTVFDAKRLI 74          
BLAST of SMED30023612 vs. Ensembl Medaka
Match: ENSORLT00000027715.1 (pep primary_assembly:ASM223467v1:8:715730:793937:1 gene:ENSORLG00000026256.1 transcript:ENSORLT00000027715.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 85.5001 bits (210), Expect = 4.276e-17
Identity = 41/67 (61.19%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP+ T+F+ KR I
Sbjct:   10 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLI 76          
BLAST of SMED30023612 vs. Ensembl Medaka
Match: HSPA2 (heat shock protein family A (Hsp70) member 2 [Source:HGNC Symbol;Acc:HGNC:5235])

HSP 1 Score: 84.7297 bits (208), Expect = 6.389e-17
Identity = 41/67 (61.19%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NP+ T+F+ KR I
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVALNPSNTVFDAKRLI 73          
BLAST of SMED30023612 vs. Planmine SMEST
Match: SMESG000022730.1 (SMESG000022730.1)

HSP 1 Score: 422.935 bits (1086), Expect = 8.656e-140
Identity = 235/240 (97.92%), Postives = 235/240 (97.92%), Query Frame = 1
Query:    1 AELRNSQLISL*HQLKAQYEKLKNKMNDTLDNVGESLQFISLYPEFNIKPPKKSLPVPGSNLTKEQRIIESKKAAERIRNYNLKLKGKEEPKQTVRKSSAKKMSSNHTPSMAKPPKEFSILASKCPSEPPSPYIVTXXXXXXXXXXXXXXXXXXXVVTFVKIYNNKSSSSEVSTGNLMSELKSKLANRSSEITSRDIDISTKRNKNKPLNDINCFLSSMIDSRRLFFDQSSSINNDDFDE 720
            AELRNSQ     HQLKAQYEKLKNKMNDTLDNVGESLQFISLYPEFNIKPPKKSLPVPGSNLTKEQRIIESKKAAERIRNYNLKLKGKEEPKQTVRKSSAKKMSSNHTPSMAKPPKEFSILASKCPSEPPSPYIVTPPPPPPPPPAAAPPPPPPPVVTFVKIYNNKSSSSEVSTGNLMSELKSKLANRSSEITSRDIDISTKRNKNKPLNDINCFLSSMIDSRRLFFDQSSSINNDDFDE
Sbjct:  511 AELRNSQ-----HQLKAQYEKLKNKMNDTLDNVGESLQFISLYPEFNIKPPKKSLPVPGSNLTKEQRIIESKKAAERIRNYNLKLKGKEEPKQTVRKSSAKKMSSNHTPSMAKPPKEFSILASKCPSEPPSPYIVTPPPPPPPPPAAAPPPPPPPVVTFVKIYNNKSSSSEVSTGNLMSELKSKLANRSSEITSRDIDISTKRNKNKPLNDINCFLSSMIDSRRLFFDQSSSINNDDFDE 745          
BLAST of SMED30023612 vs. Planmine SMEST
Match: SMESG000022730.1 (SMESG000022730.1)

HSP 1 Score: 155.221 bits (391), Expect = 3.198e-40
Identity = 77/82 (93.90%), Postives = 77/82 (93.90%), Query Frame = 1
Query:    1 AELRNSQLISL*HQLKAQYEKLKNKMNDTLDNVGESLQFISLYPEFNIKPPKKSLPVPGSNLTKEQRIIESKKAAERIRNYN 246
            AELRNSQ     HQLKAQYEKLKNKMNDTLDNVGESLQFISLYPEFNIKPPKKSLPVPGSNLTKEQRIIESKKAAERIRNYN
Sbjct:  511 AELRNSQ-----HQLKAQYEKLKNKMNDTLDNVGESLQFISLYPEFNIKPPKKSLPVPGSNLTKEQRIIESKKAAERIRNYN 587          
BLAST of SMED30023612 vs. Planmine SMEST
Match: SMESG000051815.1 (SMESG000051815.1)

HSP 1 Score: 86.2705 bits (212), Expect = 1.912e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 73          
BLAST of SMED30023612 vs. Planmine SMEST
Match: SMESG000051570.1 (SMESG000051570.1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.053e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 73          
BLAST of SMED30023612 vs. Planmine SMEST
Match: SMESG000051567.1 (SMESG000051567.1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.053e-17
Identity = 42/67 (62.69%), Postives = 50/67 (74.63%), Query Frame = -3
Query: 1162 GIDLSTTYSFVSVFQHGKGETMANNQENRRTPNYVTYTDTERLIEYTAKD*DTINPNYTIFNPKRKI 1362
            GIDL TTYS V VFQHGK E +AN+Q NR TP+YV +TDTERLI   AK+   +NPN T+F+ KR I
Sbjct:    7 GIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVAMNPNNTVFDAKRLI 73          
The following BLAST results are available for this feature:
BLAST of SMED30023612 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
HSPA81.795e-1861.19heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA82.030e-1861.19heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA83.804e-1861.19heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA84.864e-1861.19heat shock protein family A (Hsp70) member 8 [Sour... [more]
HSPA85.348e-1861.19heat shock protein family A (Hsp70) member 8 [Sour... [more]
back to top
BLAST of SMED30023612 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp-13.366e-1659.70Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
hsp-13.366e-1659.70Heat shock 70 kDa protein A [Source:UniProtKB/Swi... [more]
F44E5.57.984e-1552.86pep chromosome:WBcel235:II:11759681:11761808:1 gen... [more]
F44E5.57.984e-1552.86pep chromosome:WBcel235:II:11759640:11761853:1 gen... [more]
F44E5.47.984e-1552.86pep chromosome:WBcel235:II:11757106:11759323:-1 ge... [more]
back to top
BLAST of SMED30023612 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hsc70-45.831e-1762.69gene:FBgn0266599 transcript:FBtr0083059[more]
Hsc70-45.831e-1762.69gene:FBgn0266599 transcript:FBtr0337053[more]
Hsc70-45.831e-1762.69gene:FBgn0266599 transcript:FBtr0083058[more]
Hsc70-45.831e-1762.69gene:FBgn0266599 transcript:FBtr0083060[more]
Hsc70-45.831e-1762.69gene:FBgn0266599 transcript:FBtr0083057[more]
back to top
BLAST of SMED30023612 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
hsp70.12.984e-1862.69heat shock cognate 70-kd protein, tandem duplicate... [more]
hsp70.22.984e-1862.69heat shock cognate 70-kd protein, tandem duplicate... [more]
hspa84.458e-1861.19heat shock protein 8 [Source:NCBI gene;Acc:573376][more]
hspa1b2.125e-1764.18heat shock protein family A (Hsp70) member 1B [Sou... [more]
hsp70.22.275e-1762.69heat shock cognate 70-kd protein, tandem duplicate... [more]
back to top
BLAST of SMED30023612 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
wdr266.874e-1760.00WD repeat domain 26 [Source:Xenbase;Acc:XB-GENE-99... [more]
HSPA21.118e-1660.00heat shock protein family A (Hsp70) member 2 [Sour... [more]
tmed101.363e-1661.19transmembrane emp24-like trafficking protein 10 (y... [more]
ENSXETT00000025573.11.551e-1661.19heat shock protein family A (Hsp70) member 1B [Sou... [more]
HSPA22.085e-1662.69heat shock protein family A (Hsp70) member 2 [Sour... [more]
back to top
BLAST of SMED30023612 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Hspa81.191e-1861.19heat shock protein 8 [Source:MGI Symbol;Acc:MGI:10... [more]
Hspa1a9.382e-1761.19heat shock protein 1A [Source:MGI Symbol;Acc:MGI:9... [more]
Hspa1b9.733e-1761.19heat shock protein 1B [Source:MGI Symbol;Acc:MGI:9... [more]
Hspa21.339e-1662.69heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
Hspa21.339e-1662.69heat shock protein 2 [Source:MGI Symbol;Acc:MGI:96... [more]
back to top
BLAST of SMED30023612 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P02826|HSP7A_DROSI6.400e-1761.19Heat shock 70 kDa protein cognate 1 (Fragments) OS... [more]
sp|Q91291|HSP70_PLEWA1.708e-1662.69Heat shock 70 kDa protein OS=Pleurodeles waltl OX=... [more]
sp|Q91233|HSP70_ONCTS1.945e-1662.69Heat shock 70 kDa protein OS=Oncorhynchus tshawyts... [more]
sp|Q9U639|HSP7D_MANSE5.269e-1662.69Heat shock 70 kDa protein cognate 4 OS=Manduca sex... [more]
sp|P11147|HSP7D_DROME5.845e-1662.69Heat shock 70 kDa protein cognate 4 OS=Drosophila ... [more]
back to top
BLAST of SMED30023612 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2A4AYR63.751e-1764.18Molecular chaperone DnaK (Fragment) OS=Pseudomonas... [more]
K9ZRK95.402e-1762.69Heat shock 70kDa protein 1A (Fragment) OS=Bos indi... [more]
K9ZU005.402e-1762.69Heat shock 70kDa protein 1A (Fragment) OS=Bos indi... [more]
A0A498M6N37.445e-1762.69Heat shock OS=Labeo rohita OX=84645 GN=ROHU_029300... [more]
A0A5B1KSA77.544e-1765.67Hsp70 family protein (Fragment) OS=Nocardioides sp... [more]
back to top
BLAST of SMED30023612 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000032722.11.147e-1962.69pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
hspa1b1.738e-1764.18heat shock protein family A (Hsp70) member 1B [Sou... [more]
ENSAMXT00000037064.11.797e-1762.69heat shock 70 kDa protein [Source:NCBI gene;Acc:11... [more]
ENSAMXT00000055474.11.987e-1762.69pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
ENSAMXT00000031477.11.987e-1762.69pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of SMED30023612 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 2
Match NameE-valueIdentityDescription
hspa51.918e-1254.41heat shock protein 5 [Source:NCBI gene;Acc:378848][more]
hspa92.451e-641.18heat shock protein 9 [Source:ZFIN;Acc:ZDB-GENE-030... [more]
back to top
BLAST of SMED30023612 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
KAR27.690e-1556.52ATPase involved in protein import into the ER; als... [more]
SSA42.736e-1452.86Heat shock protein that is highly induced upon str... [more]
SSA33.372e-1452.86ATPase involved in protein folding and the respons... [more]
SSA11.563e-1350.00ATPase involved in protein folding and NLS-directe... [more]
SSA23.817e-1350.00HSP70 family ATP-binding protein; involved in prot... [more]
back to top
BLAST of SMED30023612 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO372801.309e-1659.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO303232.474e-1659.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO445304.600e-1659.70Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO332963.240e-1254.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO256181.301e-636.00Predicted protein [Source:UniProtKB/TrEMBL;Acc:A8... [more]
back to top
BLAST of SMED30023612 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000042552.16.965e-1861.19pep primary_assembly:ASM223467v1:8:710990:713238:-... [more]
hspa8b2.510e-1762.69heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
hspa8b2.662e-1762.69heat shock cognate 70 kDa protein [Source:NCBI gen... [more]
ENSORLT00000027715.14.276e-1761.19pep primary_assembly:ASM223467v1:8:715730:793937:1... [more]
HSPA26.389e-1761.19heat shock protein family A (Hsp70) member 2 [Sour... [more]
back to top
BLAST of SMED30023612 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000022730.18.656e-14097.92SMESG000022730.1[more]
SMESG000022730.13.198e-4093.90SMESG000022730.1[more]
SMESG000051815.11.912e-1762.69SMESG000051815.1[more]
SMESG000051570.12.053e-1762.69SMESG000051570.1[more]
SMESG000051567.12.053e-1762.69SMESG000051567.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023612 ID=SMED30023612|Name=SMED30023612|organism=Schmidtea mediterranea sexual|type=transcript|length=1679bp
GCTGAATTAAGAAATTCTCAATTGATTTCTTTATAGCATCAATTGAAAGC
CCAATATGAAAAATTGAAGAACAAAATGAATGATACATTGGATAATGTCG
GTGAATCTTTACAATTTATCTCTCTATATCCAGAATTTAATATTAAACCA
CCTAAAAAGTCACTTCCTGTTCCGGGATCAAATTTAACTAAAGAACAGCG
TATAATTGAATCGAAGAAAGCCGCTGAAAGAATTAGAAACTATAATCTAA
AATTGAAAGGAAAAGAAGAACCGAAACAAACTGTAAGAAAATCTTCTGCA
AAAAAAATGTCTTCTAATCATACACCTTCAATGGCTAAGCCACCTAAAGA
ATTTTCAATTCTCGCATCAAAATGTCCGTCTGAACCTCCTTCTCCTTATA
TAGTAACACCTCCACCTCCACCGCCTCCGCCTCCAGCAGCAGCACCACCT
CCACCACCACCTCCTGTAGTCACATTCGTAAAAATTTATAATAATAAAAG
TTCCAGTAGTGAAGTTTCAACGGGAAATTTAATGAGTGAATTAAAATCAA
AATTGGCTAATAGAAGTTCGGAAATCACTTCTAGAGATATCGATATATCT
ACCAAGAGAAACAAGAACAAACCTTTGAATGATATAAATTGTTTTCTTTC
GTCGATGATTGATAGCAGACGACTTTTTTTCGATCAGTCAAGTTCCATCA
ATAACGATGATTTCGATGAGTAGCAGTAACGGGTTTGTGATAAAATGACA
CCAGATTTTATATACAAATTTTTATCAAAAATCGATATCCTTTTATTTTG
TGTTTCTCATTTTTTCAATTTCCAACTTTTATAAAAGCTTTTTGTATTTA
AAATCCTCAACAAGTATTTTTCAGTGTATTTTATAAAGTTTTCTAGCAAA
TCTATAAAAAATATCGCTGAAATTGCACTCAAAAATGGGATATCGGGATG
TCTCGTAATTCGTGAAAATGAAATATTTTATGAAGCATAATGGTAAGAAA
ATATTTTTCTTGTTGCTAGGTGACAAGATAAAACTCATGGAAGCATTTAC
TACAGAATCCCTGTCAAATACACGCACAACAAGACATTACCACTAGACAG
CCGTCAAAGATAACTTTTGTACTGTGCTCTAGCAGGCGGAATTTTTCTGT
TATGTTAATTGTATTTTTCGTTTGGGATTGAAAATCGTATAGTTGGGATT
AATCGTATCTTAGTCTTTTGCGGTATACTCAATCAATCTTTCTGTATCTG
TATATGTAACATAATTGGGTGTTCTGCGGTTTTCTTGATTATTAGCCATG
GTTTCACCTTTTCCATGTTGAAATACACTGACAAATGAATAGGTAGTACT
CAAATCAATACCAGACGTTTTTCAATTGAATCTTTGTTCCAAAATAAATT
GAAAGTAAAATTCCAAATAAATTTATTAAAGATCACAAAATATCCAAAGA
AAATTGTTCCAAAAGAATTTAAATCAATCGTAGAAAAATCATAAAGAAAA
ACATCAAAAATAAGCATGAAACATTCATAATTACAAATTCATATACAAGC
TTTAACAAATTTCATAAAATTTATTCGGTAATGCAAAACATTAAAAATCC
AATTCATAAAATAACAACAGCAAAAACAATTATTTGATAAAAACAAACCA
TAAAAACTCGTAAATTCCATAAATTAACC
back to top

protein sequence of SMED30023612-orf-1

>SMED30023612-orf-1 ID=SMED30023612-orf-1|Name=SMED30023612-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=216bp
MNDTLDNVGESLQFISLYPEFNIKPPKKSLPVPGSNLTKEQRIIESKKAA
ERIRNYNLKLKGKEEPKQTVRKSSAKKMSSNHTPSMAKPPKEFSILASKC
PSEPPSPYIVTPPPPPPPPPAAAPPPPPPPVVTFVKIYNNKSSSSEVSTG
NLMSELKSKLANRSSEITSRDIDISTKRNKNKPLNDINCFLSSMIDSRRL
FFDQSSSINNDDFDE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
Vocabulary: INTERPRO
TermDefinition
IPR013126Hsp_70_fam
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..72
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 73..87
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 55..90