Meningioma expressed antigen 5 (Hyaluronidase)

Overview
NameMeningioma expressed antigen 5 (Hyaluronidase)
Smed IDSMED30023601
Length (bp)2621
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Meningioma expressed antigen 5 (Hyaluronidase) (SMED30023601) t-SNE clustered cells

Violin plots show distribution of expression levels for Meningioma expressed antigen 5 (Hyaluronidase) (SMED30023601) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Meningioma expressed antigen 5 (Hyaluronidase) (SMED30023601) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Meningioma expressed antigen 5 (Hyaluronidase) (SMED30023601) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Homology
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Human
Match: OGA (O-GlcNAcase [Source:HGNC Symbol;Acc:HGNC:7056])

HSP 1 Score: 168.703 bits (426), Expect = 2.346e-42
Identity = 131/435 (30.11%), Postives = 198/435 (45.52%), Query Frame = 1
Query:  580 MELVSKVEEASECSDSHNQMILDSILNAF---PLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKE-LISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEK--ERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            M++V  VE+  E    ++  IL  I+ A     L PM+T D ++  ++ +  M+MQ D I +    + D             ++T+KE  +     K +    P+     TL+DL LL  +FYLPY++GP+  ++L    WLR+                 NSS  S N   K  E+I E       W+ +A KF      V  M  R +N  NR+ILYD+Y Y+ D++ ++  + S+V+W+GC    +   +  D EPW FRGGL  E QR+ P++G +DL      F +  P  P                                +Y I+PY   D   +YK+C+E +Y   +  P   +             DL GD+ +G  L  S D C +LED +  ICGYALGTV V  FIK  +  +   M++KY
Sbjct:  465 MDMV--VEKQEETDHKNDNQILSEIVEAKMAEELKPMDT-DKESIAESKSPEMSMQEDCISDIAPMQTD-------------EQTNKEQFVPGPNEKPLYTAEPV-----TLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRA-----------------NSSVVSVNCKGKDSEKIEE-------WRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPLTPT-----------------------------SKVYTIRPYFPKDEASVYKICRE-MYDDGVGLPFQSQ------------PDLIGDKLVGGLLSLSLDYCFVLEDED-GICGYALGTVDVTPFIKKCKISWIPFMQEKY 805          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Human
Match: OGA (O-GlcNAcase [Source:HGNC Symbol;Acc:HGNC:7056])

HSP 1 Score: 168.318 bits (425), Expect = 2.632e-42
Identity = 131/435 (30.11%), Postives = 198/435 (45.52%), Query Frame = 1
Query:  580 MELVSKVEEASECSDSHNQMILDSILNAF---PLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKE-LISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEK--ERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            M++V  VE+  E    ++  IL  I+ A     L PM+T D ++  ++ +  M+MQ D I +    + D             ++T+KE  +     K +    P+     TL+DL LL  +FYLPY++GP+  ++L    WLR+                 NSS  S N   K  E+I E       W+ +A KF      V  M  R +N  NR+ILYD+Y Y+ D++ ++  + S+V+W+GC    +   +  D EPW FRGGL  E QR+ P++G +DL      F +  P  P                                +Y I+PY   D   +YK+C+E +Y   +  P   +             DL GD+ +G  L  S D C +LED +  ICGYALGTV V  FIK  +  +   M++KY
Sbjct:  412 MDMV--VEKQEETDHKNDNQILSEIVEAKMAEELKPMDT-DKESIAESKSPEMSMQEDCISDIAPMQTD-------------EQTNKEQFVPGPNEKPLYTAEPV-----TLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRA-----------------NSSVVSVNCKGKDSEKIEE-------WRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPLTPT-----------------------------SKVYTIRPYFPKDEASVYKICRE-MYDDGVGLPFQSQ------------PDLIGDKLVGGLLSLSLDYCFVLEDED-GICGYALGTVDVTPFIKKCKISWIPFMQEKY 752          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Human
Match: OGA (O-GlcNAcase [Source:HGNC Symbol;Acc:HGNC:7056])

HSP 1 Score: 141.354 bits (355), Expect = 9.970e-34
Identity = 127/435 (29.20%), Postives = 190/435 (43.68%), Query Frame = 1
Query:  580 MELVSKVEEASECSDSHNQMILDSILNAF---PLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKE-LISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEK--ERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            M++V  VE+  E    ++  IL  I+ A     L PM+T D ++  ++ +  M+MQ D I +    + D             ++T+KE  +     K +    P+     TL+DL LL  +FYLPY++GP+  ++L    WLR+                 NSS  S N   K  E+I E       W+ +A KF      V  M  R +N  NR+ILYD+Y Y+ D++ ++  + S+V+W+GC    +   +  D EPW FRGGL  E Q   PL  TS ++   +R     P  PK                                         D   +YK+C+E +Y   +  P   +             DL GD+ +G  L  S D C +LED +  ICGYALGTV V  FIK  +  +   M++KY
Sbjct:  412 MDMV--VEKQEETDHKNDNQILSEIVEAKMAEELKPMDT-DKESIAESKSPEMSMQEDCISDIAPMQTD-------------EQTNKEQFVPGPNEKPLYTAEPV-----TLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRA-----------------NSSVVSVNCKGKDSEKIEE-------WRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQPP-PLTPTSKVY--TIR-----PYFPK-----------------------------------------DEASVYKICRE-MYDDGVGLPFQSQ------------PDLIGDKLVGGLLSLSLDYCFVLEDED-GICGYALGTVDVTPFIKKCKISWIPFMQEKY 738          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Human
Match: OGA (O-GlcNAcase [Source:HGNC Symbol;Acc:HGNC:7056])

HSP 1 Score: 92.4337 bits (228), Expect = 1.485e-18
Identity = 72/243 (29.63%), Postives = 116/243 (47.74%), Query Frame = 1
Query:  580 MELVSKVEEASECSDSHNQMILDSILNAF---PLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKE-LISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEK--ERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIG 1290
            M++V  VE+  E    ++  IL  I+ A     L PM+T D ++  ++ +  M+MQ D I +    + D             ++T+KE  +     K +    P+     TL+DL LL  +FYLPY++GP+  ++L    WLR+                 NSS  S N   K  E+I E       W+ +A KF      V  M  R +N  NR+ILYD+Y Y+ D++ ++  + S+V+W+G
Sbjct:  465 MDMV--VEKQEETDHKNDNQILSEIVEAKMAEELKPMDT-DKESIAESKSPEMSMQEDCISDIAPMQTD-------------EQTNKEQFVPGPNEKPLYTAEPV-----TLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRA-----------------NSSVVSVNCKGKDSEKIEE-------WRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLG 662          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Fly
Match: Oga (gene:FBgn0038870 transcript:FBtr0084050)

HSP 1 Score: 137.887 bits (346), Expect = 8.494e-33
Identity = 102/395 (25.82%), Postives = 173/395 (43.80%), Query Frame = 1
Query:  880 IDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWI--GCLP----------------GYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQA-IYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKYEFYLSDSNNQVTSSTNGDEISTSFSILNKNSVIENLIDGFGDSNLDK 2007
            I+   +T+DDL LL  +FYLP+++G R  ++L   NWL+ +   +               D S+     + I   K +   W ++ E+F      V  +  +  N PN+ I ++LY Y+ D+   L  LN YVKW+  G  P                G+  + M+ D EPWVFRGGLIA+LQR+ P++  +DLF  ++                                    PE   A  Y+++PY +SD +Q+  LC   LY Q+  +  +D  +           ++  D  +G +L  SP  C++  D + RI GY+   + V  F +  +  +  ++R+KY       +  +     G+E+    +     S++E+  D  G+  LD+
Sbjct:  604 IEGEGITVDDLVLLCDLFYLPFEHGSRGHKLLVEFNWLKGNANVILQ-------------DRSAG-GGGDAIKSDKPEVSEWHQRREQFDQLCSAVVELLIKIANCPNKEICHELYSYMWDISGALSLLNCYVKWLALGHFPQNTSSYTEGSYTWFSKGWKEAFMSGDQEPWVFRGGLIADLQRLMPVDSGNDLFVYKL------------------------------------PEQPTANYYLLRPYCNSDEQQVNDLCTR-LYLQWRGE--LDGGRHIPFPLPANVPNIVADGLIGGYLTLSPQLCIVAYDESNRIIGYSCAALDVNIFRRNLELCWYTELREKY-------SRDICPLEGGEEVVQLVT-----SLVESYHDSSGNGALDQ 933          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Zebrafish
Match: oga (O-GlcNAcase [Source:ZFIN;Acc:ZDB-GENE-030131-3208])

HSP 1 Score: 194.897 bits (494), Expect = 4.034e-51
Identity = 134/433 (30.95%), Postives = 210/433 (48.50%), Query Frame = 1
Query:  580 MELVSKVEEASECSDSHN-QMILDSILNAF---PLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            ME+V  VE+  E  D+ N   IL  I+ A     L PM+T D ++ T++ +  M++Q D+   S    M   D +           +KE+     +++   I+      LTL+DL LL  +FYLPY++GP++V++L   NWLR++  YV                 +S   + E++ E       W+ +AE F     +V  M  R +N  NR+ILYDLYPY+ D++ ++  + S+V+W+GC    +   ++ D EPW FRGGL  E QR+ P++G +DL      F +  P++P                                IY I+PY + D   +YK+C+E+             +    ++      DL GDR +G FL  SPD   +LED  E +CGYA+GTV VK F+K  +  +   M++KY
Sbjct:  455 MEMV--VEKHDEVEDTKNVNQILTEIVKAKMTEDLKPMDT-DKESLTESKSPEMSIQEDS--GSDIAPMQTDDQL-----------NKEVFVPGPNEKPLFIT----EALTLEDLTLLAELFYLPYEHGPKSVQMLKEFNWLRANSNYV---------------SVNSKAKDPEKVTE-------WQSRAENFEEMCCSVMQMFTRLSNSANRTILYDLYPYIWDIKSIISMVKSFVQWLGCRSQSSAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDL------FYQPPPSMP-----------------------------TSKIYTIRPYFAKDESAIYKICKEMF-----------TESCEGISFSDESPDLIGDRLVGGFLTLSPDYGFVLED-EEGVCGYAMGTVDVKPFVKKCKLSWIPFMQEKY 798          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Zebrafish
Match: oga (O-GlcNAcase [Source:ZFIN;Acc:ZDB-GENE-030131-3208])

HSP 1 Score: 180.259 bits (456), Expect = 2.578e-46
Identity = 133/451 (29.49%), Postives = 209/451 (46.34%), Query Frame = 1
Query:  580 MELVSKVEEASECSDSHN-QMILDSILNAF---PLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWI------------------GCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            ME+V  VE+  E  D+ N   IL  I+ A     L PM+T D ++ T++ +  M++Q D+   S    M   D +           +KE+     +++   I+      LTL+DL LL  +FYLPY++GP++V++L   NWLR++  YV                 +S   + E++ E       W+ +AE F     +V  M  R +N  NR+ILYDLYPY+ D++ ++  + S+V+W+                   C    +   ++ D EPW FRGGL  E QR+ P++G +DL      F +  P++P                                IY I+PY + D   +YK+C+E+             +    ++      DL GDR +G FL  SPD   +LED  E +CGYA+GTV VK F+K  +  +   M++KY
Sbjct:  455 MEMV--VEKHDEVEDTKNVNQILTEIVKAKMTEDLKPMDT-DKESLTESKSPEMSIQEDS--GSDIAPMQTDDQL-----------NKEVFVPGPNEKPLFIT----EALTLEDLTLLAELFYLPYEHGPKSVQMLKEFNWLRANSNYV---------------SVNSKAKDPEKVTE-------WQSRAENFEEMCCSVMQMFTRLSNSANRTILYDLYPYIWDIKSIISMVKSFVQWLDGRILGTSFYCYWTDSARWCRSQSSAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDL------FYQPPPSMP-----------------------------TSKIYTIRPYFAKDESAIYKICKEMF-----------TESCEGISFSDESPDLIGDRLVGGFLTLSPDYGFVLED-EEGVCGYAMGTVDVKPFVKKCKLSWIPFMQEKY 816          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Zebrafish
Match: si:dkey-183c6.8 (si:dkey-183c6.8 [Source:ZFIN;Acc:ZDB-GENE-160728-23])

HSP 1 Score: 113.62 bits (283), Expect = 2.660e-25
Identity = 86/348 (24.71%), Postives = 143/348 (41.09%), Query Frame = 1
Query:  889 SKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNE-KERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWI-------------------GCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRF--KDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            + L+   + LLV ++YLP+++GP A  +L  + WL++                   + H  + NE  ++   +K++   W+ +A  F    D V  +     N  NR++LYDLYPY+ D+R+ L    +++ W+                    C       L   + EPWVF+GGL  E+Q + P+  +S+LF +        P  P                                +Y I+P+   D+ +LY++  ++              +      D  F   DL GDR LG  L   P+  ++LED    +CG A+G + V+ F K  Q  +   MR KY
Sbjct:  403 APLSEAQVRLLVGLYYLPHEHGPPAQNLLLDLTWLKA-------------------NCHCVSVNENGKKASPQKVEE--WRARAGHFLAACDDVAILHSAVVNSINRAVLYDLYPYIWDLRNTLLVAKAFICWLEGRILSEGSPLGSWKNCFHWCGASSGAELHGVEAEPWVFKGGLSGEVQMLLPVGTSSELFSHP------PPLFPT-----------------------------SRLYNIRPFLQKDKVELYRMVHQL-------------HQRGKGGQDAAFCHPDLIGDRCLGASLALCPEYSLVLEDELG-VCGCAVGILDVRSFAKRCQATWLPAMRDKY 680          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Zebrafish
Match: ogal (O-GlcNAcase like [Source:ZFIN;Acc:ZDB-GENE-110914-153])

HSP 1 Score: 106.301 bits (264), Expect = 3.838e-23
Identity = 67/220 (30.45%), Postives = 100/220 (45.45%), Query Frame = 1
Query:  928 MFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLF--PNEVRFIENEPNLPK---ILTKIDSELKIEDNESCQCINE-------IPSPENCQAI 1551
            +FYLPY++G  A  +L  ++WLR+H     +G                                 W+ +A++F  +   V  M +R +N PNR ILYDLY Y+ D++  +    +YVK +G    +    + DD EPW FRGGL  E QRM P  G  DLF  P   R     P  PK    + KI  +++ E  +  + + +       +PS +NC  I
Sbjct:  370 LFYLPYEHGHTATHMLEELHWLRTHTLDEEEGC-------------------------------AWRVRAQQFDDRCAAVVQMFNRLSNAPNRLILYDLYNYICDIKSGVTMAKAYVKTLGGQTPHPALALTDDPEPWGFRGGLSGEFQRMLPSHGNRDLFRSPPATRVYTIRPCTPKDQPEVMKIFKQMQTETQQKVELVGDRLVEGQMMPS-QNCSLI 557          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Xenopus
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:100145437])

HSP 1 Score: 163.31 bits (412), Expect = 1.003e-40
Identity = 98/327 (29.97%), Postives = 155/327 (47.40%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  + L+DL LL  +FYLPY++G +  ++L    WLR+                 NSS  S N   K+    R  + + W+++A+KF    + V  M  R +N PNR+ILYDLYPY+ D++ ++  + S+V+W+GC    +   ++ D EPW FRGGL  E QR+ P+EG   +    V        +P +L+ + +                                      +YK+C+E +Y   ++D   + Q            DL GD+ +G  L  S D C +LED +  ICGYA+GTV V  +IK  +  +   M++KY
Sbjct:  542 AEAVNLEDLQLLADLFYLPYEHGTKGAQMLKEFQWLRA-----------------NSSVVSVNCGGKDADKWRGAQLWEWRDRADKFEEMCNVVMTMFTRLSNCPNRTILYDLYPYVWDIKSIISMVKSFVQWLGCRSHSSAQFLSGDQEPWAFRGGLAGEFQRLLPIEGIYIILCTIV--------IPIMLSYLQA-------------------------------------SVYKICRE-MYDDAMDDLPFESQ-----------PDLIGDKLVGGLLCHSLDYCFVLEDED-GICGYAVGTVDVTPYIKKCKHSWIPFMQEKY 793          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Xenopus
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:100145437])

HSP 1 Score: 159.073 bits (401), Expect = 2.103e-39
Identity = 99/329 (30.09%), Postives = 155/329 (47.11%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKE--RIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  + L+DL LL  +FYLPY++G +  ++L    WLR+                 NSS  S N   K+  +I E       W+++A+KF    + V  M  R +N PNR+ILYDLYPY+ D++ ++  + S+V+W+GC    +   ++ D EPW FRGGL  E QR+ P+EG   +    V        +P +L+ + +                                      +YK+C+E +Y   ++D   + Q            DL GD+ +G  L  S D C +LED +  ICGYA+GTV V  +IK  +  +   M++KY
Sbjct:  539 AEAVNLEDLQLLADLFYLPYEHGTKGAQMLKEFQWLRA-----------------NSSVVSVNCGGKDADKIAE-------WRDRADKFEEMCNVVMTMFTRLSNCPNRTILYDLYPYVWDIKSIISMVKSFVQWLGCRSHSSAQFLSGDQEPWAFRGGLAGEFQRLLPIEGIYIILCTIV--------IPIMLSYLQA-------------------------------------SVYKICRE-MYDDAMDDLPFESQ-----------PDLIGDKLVGGLLCHSLDYCFVLEDED-GICGYAVGTVDVTPYIKKCKHSWIPFMQEKY 785          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Xenopus
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:100145437])

HSP 1 Score: 157.918 bits (398), Expect = 3.131e-39
Identity = 99/329 (30.09%), Postives = 155/329 (47.11%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKE--RIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  + L+DL LL  +FYLPY++G +  ++L    WLR+                 NSS  S N   K+  +I E       W+++A+KF    + V  M  R +N PNR+ILYDLYPY+ D++ ++  + S+V+W+GC    +   ++ D EPW FRGGL  E QR+ P+EG   +    V        +P +L+ + +                                      +YK+C+E +Y   ++D   + Q            DL GD+ +G  L  S D C +LED +  ICGYA+GTV V  +IK  +  +   M++KY
Sbjct:  427 AEAVNLEDLQLLADLFYLPYEHGTKGAQMLKEFQWLRA-----------------NSSVVSVNCGGKDADKIAE-------WRDRADKFEEMCNVVMTMFTRLSNCPNRTILYDLYPYVWDIKSIISMVKSFVQWLGCRSHSSAQFLSGDQEPWAFRGGLAGEFQRLLPIEGIYIILCTIV--------IPIMLSYLQA-------------------------------------SVYKICRE-MYDDAMDDLPFESQ-----------PDLIGDKLVGGLLCHSLDYCFVLEDED-GICGYAVGTVDVTPYIKKCKHSWIPFMQEKY 673          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Xenopus
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:100145437])

HSP 1 Score: 158.303 bits (399), Expect = 3.832e-39
Identity = 99/329 (30.09%), Postives = 155/329 (47.11%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKE--RIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  + L+DL LL  +FYLPY++G +  ++L    WLR+                 NSS  S N   K+  +I E       W+++A+KF    + V  M  R +N PNR+ILYDLYPY+ D++ ++  + S+V+W+GC    +   ++ D EPW FRGGL  E QR+ P+EG   +    V        +P +L+ + +                                      +YK+C+E +Y   ++D   + Q            DL GD+ +G  L  S D C +LED +  ICGYA+GTV V  +IK  +  +   M++KY
Sbjct:  542 AEAVNLEDLQLLADLFYLPYEHGTKGAQMLKEFQWLRA-----------------NSSVVSVNCGGKDADKIAE-------WRDRADKFEEMCNVVMTMFTRLSNCPNRTILYDLYPYVWDIKSIISMVKSFVQWLGCRSHSSAQFLSGDQEPWAFRGGLAGEFQRLLPIEGIYIILCTIV--------IPIMLSYLQA-------------------------------------SVYKICRE-MYDDAMDDLPFESQ-----------PDLIGDKLVGGLLCHSLDYCFVLEDED-GICGYAVGTVDVTPYIKKCKHSWIPFMQEKY 788          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Xenopus
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:100145437])

HSP 1 Score: 157.918 bits (398), Expect = 4.581e-39
Identity = 99/329 (30.09%), Postives = 155/329 (47.11%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKE--RIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  + L+DL LL  +FYLPY++G +  ++L    WLR+                 NSS  S N   K+  +I E       W+++A+KF    + V  M  R +N PNR+ILYDLYPY+ D++ ++  + S+V+W+GC    +   ++ D EPW FRGGL  E QR+ P+EG   +    V        +P +L+ + +                                      +YK+C+E +Y   ++D   + Q            DL GD+ +G  L  S D C +LED +  ICGYA+GTV V  +IK  +  +   M++KY
Sbjct:  514 AEAVNLEDLQLLADLFYLPYEHGTKGAQMLKEFQWLRA-----------------NSSVVSVNCGGKDADKIAE-------WRDRADKFEEMCNVVMTMFTRLSNCPNRTILYDLYPYVWDIKSIISMVKSFVQWLGCRSHSSAQFLSGDQEPWAFRGGLAGEFQRLLPIEGIYIILCTIV--------IPIMLSYLQA-------------------------------------SVYKICRE-MYDDAMDDLPFESQ-----------PDLIGDKLVGGLLCHSLDYCFVLEDED-GICGYAVGTVDVTPYIKKCKHSWIPFMQEKY 760          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Mouse
Match: Oga (O-GlcNAcase [Source:MGI Symbol;Acc:MGI:1932139])

HSP 1 Score: 169.088 bits (427), Expect = 1.099e-42
Identity = 129/434 (29.72%), Postives = 198/434 (45.62%), Query Frame = 1
Query:  580 MELVSKVEEASECSDSHNQMILDSILNAF---PLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEK--ERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            M++V  VE+  E    ++  IL  I+ A     L PM+T D ++  ++ +  M+MQ D I +        +  M+ +   Q++    + +     K +    P+     TL+DL LL  +FYLPY++GP+  ++L    WLR+                 NSS  S N   K  E+I E       W+ +A KF      V  M  R +N  NR+ILYD+Y Y+ D++ ++  + S+V+W+GC    +   +  D EPW FRGGL  E QR+ P++G +DL      F +  P  P                                +Y I+PY   D   +YK+C+E +Y   +  P   +             DL GD+ +G  L  S D C +LED +  ICGYALGTV V  FIK  +  +   M++KY
Sbjct:  465 MDMV--VEKQEEAEHKNDNQILTEIVEAKMAEELRPMDT-DKESMAESKSPEMSMQEDCIPD--------VAPMQTDEQTQKE----QFVPGPNEKPLYTAEPV-----TLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRA-----------------NSSVVSVNCKGKDSEKIEE-------WRSRAAKFEEMCALVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPLTPT-----------------------------SKVYTIRPYFPKDEASVYKICRE-MYDDGVGFPFQSQ------------PDLIGDKLVGGLLSLSLDYCFVLEDED-GICGYALGTVDVTPFIKKCKISWIPFMQEKY 805          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. UniProt/SwissProt
Match: sp|Q9EQQ9|OGA_MOUSE (Protein O-GlcNAcase OS=Mus musculus OX=10090 GN=Oga PE=1 SV=2)

HSP 1 Score: 169.088 bits (427), Expect = 7.689e-42
Identity = 129/434 (29.72%), Postives = 198/434 (45.62%), Query Frame = 1
Query:  580 MELVSKVEEASECSDSHNQMILDSILNAF---PLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEK--ERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            M++V  VE+  E    ++  IL  I+ A     L PM+T D ++  ++ +  M+MQ D I +        +  M+ +   Q++    + +     K +    P+     TL+DL LL  +FYLPY++GP+  ++L    WLR+                 NSS  S N   K  E+I E       W+ +A KF      V  M  R +N  NR+ILYD+Y Y+ D++ ++  + S+V+W+GC    +   +  D EPW FRGGL  E QR+ P++G +DL      F +  P  P                                +Y I+PY   D   +YK+C+E +Y   +  P   +             DL GD+ +G  L  S D C +LED +  ICGYALGTV V  FIK  +  +   M++KY
Sbjct:  465 MDMV--VEKQEEAEHKNDNQILTEIVEAKMAEELRPMDT-DKESMAESKSPEMSMQEDCIPD--------VAPMQTDEQTQKE----QFVPGPNEKPLYTAEPV-----TLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRA-----------------NSSVVSVNCKGKDSEKIEE-------WRSRAAKFEEMCALVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPLTPT-----------------------------SKVYTIRPYFPKDEASVYKICRE-MYDDGVGFPFQSQ------------PDLIGDKLVGGLLSLSLDYCFVLEDED-GICGYALGTVDVTPFIKKCKISWIPFMQEKY 805          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. UniProt/SwissProt
Match: sp|O60502|OGA_HUMAN (Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA PE=1 SV=2)

HSP 1 Score: 168.703 bits (426), Expect = 1.127e-41
Identity = 131/435 (30.11%), Postives = 198/435 (45.52%), Query Frame = 1
Query:  580 MELVSKVEEASECSDSHNQMILDSILNAF---PLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKE-LISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEK--ERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            M++V  VE+  E    ++  IL  I+ A     L PM+T D ++  ++ +  M+MQ D I +    + D             ++T+KE  +     K +    P+     TL+DL LL  +FYLPY++GP+  ++L    WLR+                 NSS  S N   K  E+I E       W+ +A KF      V  M  R +N  NR+ILYD+Y Y+ D++ ++  + S+V+W+GC    +   +  D EPW FRGGL  E QR+ P++G +DL      F +  P  P                                +Y I+PY   D   +YK+C+E +Y   +  P   +             DL GD+ +G  L  S D C +LED +  ICGYALGTV V  FIK  +  +   M++KY
Sbjct:  465 MDMV--VEKQEETDHKNDNQILSEIVEAKMAEELKPMDT-DKESIAESKSPEMSMQEDCISDIAPMQTD-------------EQTNKEQFVPGPNEKPLYTAEPV-----TLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRA-----------------NSSVVSVNCKGKDSEKIEE-------WRSRAAKFEEMCGLVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPLTPT-----------------------------SKVYTIRPYFPKDEASVYKICRE-MYDDGVGLPFQSQ------------PDLIGDKLVGGLLSLSLDYCFVLEDED-GICGYALGTVDVTPFIKKCKISWIPFMQEKY 805          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. UniProt/SwissProt
Match: sp|Q8VIJ5|OGA_RAT (Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 GN=Oga PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 2.460e-41
Identity = 131/434 (30.18%), Postives = 197/434 (45.39%), Query Frame = 1
Query:  580 MELVSKVEEASECSDSHNQMILDSILNAF---PLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEK--ERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            M++V + +E SE   S NQ IL  I+ A     L PM+T D ++  ++ +  M+MQ D I +    + D             +   ++ +     K +    P+     TL+DL LL  +FYLPY++GP+  ++L    WLR+                 NSS  S N   K  E+I E       W+ +A KF      V  M  R +N  NR+ILYD+Y Y+ D++ ++  + S+V+W+GC    +   +  D EPW FRGGL  E QR+ P++G +DL      F +  P  P                                +Y I+PY   D   +YK+C+E +Y   +  P   +             DL GD+ +G  L  S D C +LED +  ICGYALGTV V  FIK  +  +   M++KY
Sbjct:  465 MDMVVEKQEESE-HKSDNQ-ILTEIVEAKMAEELKPMDT-DKESIAESKSPEMSMQEDCINDIAPMQTD------------EQANKEQFVPGPNEKPLYAAEPV-----TLEDLQLLADLFYLPYEHGPKGAQMLREFQWLRA-----------------NSSVVSVNCKGKDSEKIEE-------WRSRAAKFEEMCALVMGMFTRLSNCANRTILYDMYSYVWDIKSIMSMVKSFVQWLGCRSHSSAQFLIGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPLTPT-----------------------------SKVYTIRPYFPKDEASVYKICRE-MYDDGVGLPFQSQ------------PDLIGDKLVGGLLSLSLDYCFVLEDED-GICGYALGTVDVTPFIKKCKISWIPFMQEKY 805          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. TrEMBL
Match: A0A3P9AIY5 (O-GlcNAcase OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 206.453 bits (524), Expect = 1.396e-51
Identity = 119/329 (36.17%), Postives = 166/329 (50.46%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFN--EKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  L+LDDL LL  +FYLPY+YGP+A+ +L   NWLR+                 NSS  S N    E E++ E       WK +AEKF     +V  M  R +N  NR+ILYDLYPY+ D++ +   + S+V+W+GC        ++ D EPW FRGGL  E QR+ P++G +DL      F +  P +P                                IY I+PY+  D   +YK+C+E +Y + +E           L   G   DL GDR++G FL+ SPD   +LED  E ICGYALGTV VK F+K  +  +   M++KY
Sbjct:  550 AEPLSLDDLTLLAELFYLPYEYGPKAMHMLKEFNWLRA-----------------NSSTVSVNCQGKEPEKVAE-------WKARAEKFEEMCCSVIQMFTRLSNSANRTILYDLYPYIWDIKSITSMVKSFVQWLGCRSQATAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPAMPT-----------------------------SKIYSIRPYYPKDEHAVYKICRE-MYSEGVE----------GLPFSGEEPDLIGDRFVGGFLNLSPDYGFVLED-EEGICGYALGTVDVKPFVKKCKMSWIPSMQEKY 807          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. TrEMBL
Match: A0A1S3RPY1 (protein O-GlcNAcase OS=Salmo salar OX=8030 GN=mgea5 PE=4 SV=1)

HSP 1 Score: 205.297 bits (521), Expect = 3.572e-51
Identity = 119/329 (36.17%), Postives = 167/329 (50.76%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSN--FNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  L+L+DL LL  +FYLPY+YGP+A+ +L   NWLR+                 NSS  S N    E E++ E       WK +AEKF     +V  M  R +N  NR+ILYDLYPY+ D++ +   + S+V+W+GC        ++ D EPW FRGGL  E QR+ P++G +DL      F +  P LP                                IY I+PY++ D   +YK+C+E +Y + +E+          L   G   DL GDR +G FL+ SPD   +LED  E ICGYALGTV VK F+K  +  +   M++KY
Sbjct:  552 AEPLSLEDLTLLAELFYLPYEYGPKALHMLKEFNWLRA-----------------NSSTVSVNCEGKEPEKVAE-------WKSRAEKFEEMCCSVIQMFTRLSNSANRTILYDLYPYIWDIKSITSMVKSFVQWLGCRSQATAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPALP-----------------------------TSKIYSIRPYYAKDEHAVYKICRE-MYSEGVEE----------LPFSGEEPDLIGDRLVGGFLNLSPDYGFVLED-EEGICGYALGTVDVKPFVKKCKMSWIPSMQEKY 809          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. TrEMBL
Match: A0A4W5KAX7 (O-GlcNAcase OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 4.224e-51
Identity = 119/329 (36.17%), Postives = 167/329 (50.76%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNF--NEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  L+L+DL LL  +FYLPY+YGP+A+ +L   NWLR+                 NSS  S N    E E++ E       WK +AEKF     +V  M  R +N  NR+ILYDLYPY+ D++ +   + S+V+W+GC        ++ D EPW FRGGL  E QR+ P++G +DL      F +  P LP                                IY I+PY++ D   +YK+C+E +Y + +E+          L   G   DL GDR +G FL+ SPD   +LED  E ICGYALGTV VK F+K  +  +   M++KY
Sbjct:  548 AEPLSLEDLTLLAELFYLPYEYGPKALHMLKEFNWLRA-----------------NSSTVSVNCEGKEPEKVAE-------WKSRAEKFEEMCCSVIQMFTRLSNSANRTILYDLYPYIWDIKSITSMVKSFVQWLGCRSQATAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPALP-----------------------------TSKIYSIRPYYAKDEHAVYKICRE-MYSEGVEE----------LPFSGEEPDLIGDRLVGGFLNLSPDYGFVLED-EEGICGYALGTVDVKPFVKKCKMSWIPSMQEKY 805          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. TrEMBL
Match: A0A3P8Z1S3 (O-GlcNAcase OS=Esox lucius OX=8010 PE=4 SV=1)

HSP 1 Score: 204.912 bits (520), Expect = 5.232e-51
Identity = 119/329 (36.17%), Postives = 166/329 (50.46%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFN--EKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  L+LDDL LL  +FYLPY+YGP+A+ +L   NWLR+                 NSS  S N    E E++ E       WK +AEKF     +V  M  R +N  NR+ILYDLYPY+ D++ +   + S+V+W+GC        ++ D EPW FRGGL  E QR+ P++G +DL      F +  P +P                                IY I+PY+  D   +YK+C+E +Y + +E           L   G   DL GDR++G FL+ SPD   +LED  E ICGYALGTV VK F+K  +  +   M++KY
Sbjct:  573 AEPLSLDDLTLLAELFYLPYEYGPKAMHMLKEFNWLRA-----------------NSSTVSVNCQGKEPEKVAE-------WKARAEKFEEMCCSVIQMFTRLSNSANRTILYDLYPYIWDIKSITSMVKSFVQWLGCRSQATAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPAMPT-----------------------------SKIYSIRPYYPKDEHAVYKICRE-MYSEGVE----------GLPFSGEEPDLIGDRFVGGFLNLSPDYGFVLED-EEGICGYALGTVDVKPFVKKCKMSWIPSMQEKY 830          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. TrEMBL
Match: A0A060XCX3 (Uncharacterized protein OS=Oncorhynchus mykiss OX=8022 GN=GSONMT00019092001 PE=4 SV=1)

HSP 1 Score: 204.142 bits (518), Expect = 9.693e-51
Identity = 119/329 (36.17%), Postives = 167/329 (50.76%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNF--NEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  L+L+DL LL  +FYLPY+YGP+A+ +L   NWLR+                 NSS  S N    E E++ E       WK +AEKF     +V  M  R +N  NR+ILYDLYPY+ D++ +   + S+V+W+GC        ++ D EPW FRGGL  E QR+ P++G +DL      F +  P LP                                IY I+PY++ D   +YK+C+E +Y + +E+          L   G   DL GDR +G FL+ SPD   +LED  E ICGYALGTV VK F+K  +  +   M++KY
Sbjct:  552 AEPLSLEDLTLLAELFYLPYEYGPKALHMLKEFNWLRA-----------------NSSTVSVNCEGKEPEKVAE-------WKCRAEKFEEMCCSVIQMFTRLSNSANRTILYDLYPYIWDIKSITSMVKSFVQWLGCRSQATAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPALP-----------------------------TSKIYSIRPYYAKDEHAVYKICRE-MYSEGVEE----------LPFSGEEPDLIGDRLVGGFLNLSPDYGFVLED-EEGICGYALGTVDVKPFVKKCKMSWIPSMQEKY 809          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Cavefish
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:103032082])

HSP 1 Score: 190.66 bits (483), Expect = 8.314e-50
Identity = 109/327 (33.33%), Postives = 165/327 (50.46%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            S  LTL+DL L+  +FYLPY++GP+AV++L   NWLR+          NS+    NS    S     E++ E       W  +A+ F     +V  M  R +N  NR+ILYDLYPY+ D++ ++  + S+V+W+GC    +   ++ D EPW FRGGL  E QR+ P++G +DL      F +  P++P                                +Y I+PY+  D   +YK+C+E+  +   + P  D++            DL GDR +G FL  SPD   +LED +  ICGYALGTV V+ F+   +  +   M++KY
Sbjct:  544 SEPLTLEDLTLMAELFYLPYEHGPKAVQMLKEFNWLRA----------NSSLVSVNSKSEDS-----EKVAE-------WHSRADNFEEMCCSVMQMFTRLSNSANRTILYDLYPYIWDIKSIISMIKSFVQWLGCRSQSSAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPSMP-----------------------------TSKMYSIRPYYPKDETAVYKICKEMYTEGCNDLPFSDQE-----------PDLIGDRLVGGFLTLSPDYGFVLEDED-GICGYALGTVDVQPFVTKCKMSWIPFMQEKY 801          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Cavefish
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:103032082])

HSP 1 Score: 189.504 bits (480), Expect = 9.764e-50
Identity = 109/327 (33.33%), Postives = 165/327 (50.46%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            S  LTL+DL L+  +FYLPY++GP+AV++L   NWLR+          NS+    NS    S     E++ E       W  +A+ F     +V  M  R +N  NR+ILYDLYPY+ D++ ++  + S+V+W+GC    +   ++ D EPW FRGGL  E QR+ P++G +DL      F +  P++P                                +Y I+PY+  D   +YK+C+E+  +   + P  D++            DL GDR +G FL  SPD   +LED +  ICGYALGTV V+ F+   +  +   M++KY
Sbjct:  441 SEPLTLEDLTLMAELFYLPYEHGPKAVQMLKEFNWLRA----------NSSLVSVNSKSEDS-----EKVAE-------WHSRADNFEEMCCSVMQMFTRLSNSANRTILYDLYPYIWDIKSIISMIKSFVQWLGCRSQSSAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPSMPT-----------------------------SKMYSIRPYYPKDETAVYKICKEMYTEGCNDLPFSDQE-----------PDLIGDRLVGGFLTLSPDYGFVLEDED-GICGYALGTVDVQPFVTKCKMSWIPFMQEKY 698          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Cavefish
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:103032082])

HSP 1 Score: 176.022 bits (445), Expect = 5.954e-45
Identity = 108/345 (31.30%), Postives = 164/345 (47.54%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWI------------------GCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            S  LTL+DL L+  +FYLPY++GP+AV++L   NWLR+          NS+    NS    S     E++ E       W  +A+ F     +V  M  R +N  NR+ILYDLYPY+ D++ ++  + S+V+W+                   C    +   ++ D EPW FRGGL  E QR+ P++G +DL      F +  P++P                                +Y I+PY+  D   +YK+C+E+  +   + P  D++            DL GDR +G FL  SPD   +LED +  ICGYALGTV V+ F+   +  +   M++KY
Sbjct:  544 SEPLTLEDLTLMAELFYLPYEHGPKAVQMLKEFNWLRA----------NSSLVSVNSKSEDS-----EKVAE-------WHSRADNFEEMCCSVMQMFTRLSNSANRTILYDLYPYIWDIKSIISMIKSFVQWLDGRILSTSFYCYWIDSGRWCRSQSSAQFLSGDQEPWAFRGGLAGEFQRLLPIDGANDL------FFQPPPSMP-----------------------------TSKMYSIRPYYPKDETAVYKICKEMYTEGCNDLPFSDQE-----------PDLIGDRLVGGFLTLSPDYGFVLEDED-GICGYALGTVDVQPFVTKCKMSWIPFMQEKY 819          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Cavefish
Match: ogal (protein O-GlcNAcase-like [Source:NCBI gene;Acc:103039791])

HSP 1 Score: 125.946 bits (315), Expect = 2.149e-29
Identity = 74/192 (38.54%), Postives = 97/192 (50.52%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLF--PNEVRFIENEPNLPK 1455
            +  LTL+DL LL  +FYLPY+YGP A+ +L  +NWLR           NS   V  S+    N   KE           W+E+AE F      V  M +R +N PNR+ILYDLY Y+ D++  +    ++V  +G        ++NDD EPW FRGGL  E QRM P  G  DL+  P   R     P  PK
Sbjct:  363 AEPLTLEDLTLLSELFYLPYEYGPTALTMLTELNWLRG----------NSGAAVFGST-APENSKAKE-----------WRERAEHFDEMCAAVVQMFNRLSNAPNRTILYDLYNYICDIKSGVSLAKAFVNSLGGRNPPPSQVINDDPEPWGFRGGLSGEFQRMLPCHGNRDLYRIPPATRVYTIRPCTPK 532          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Cavefish
Match: ogal (protein O-GlcNAcase-like [Source:NCBI gene;Acc:103039791])

HSP 1 Score: 120.168 bits (300), Expect = 1.260e-27
Identity = 70/192 (36.46%), Postives = 95/192 (49.48%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLF--PNEVRFIENEPNLPK 1455
            +  LTL+DL LL  +FYLPY+YGP A+ +L  +NWLR ++    D   N A+                           W+E+AE F      V  M +R +N PNR+ILYDLY Y+ D++  +    ++V  +G        ++NDD EPW FRGGL  E QRM P  G  DL+  P   R     P  PK
Sbjct:  358 AEPLTLEDLTLLSELFYLPYEYGPTALTMLTELNWLRGNKL---DEFLNCAKE--------------------------WRERAEHFDEMCAAVVQMFNRLSNAPNRTILYDLYNYICDIKSGVSLAKAFVNSLGGRNPPPSQVINDDPEPWGFRGGLSGEFQRMLPCHGNRDLYRIPPATRVYTIRPCTPK 520          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Sea Lamprey
Match: si:dkey-183c6.8 (si:dkey-183c6.8 [Source:ZFIN;Acc:ZDB-GENE-160728-23])

HSP 1 Score: 78.5666 bits (192), Expect = 3.491e-15
Identity = 40/120 (33.33%), Postives = 65/120 (54.17%), Query Frame = 1
Query:  931 FYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIG 1290
            FYLPY++GPRA ++L   +WL+         + +SA   S S    +   E++           W+ +A  F    + V  M  R ++I NRS+LYDLYPY+ D++ ++  + S+VKW+G
Sbjct:  569 FYLPYEHGPRAAQLLREFHWLK---------VNSSAVGCSRSVAEPNKEREED-----------WRARALAFEELCNRVTQMFTRLSSIANRSVLYDLYPYIWDIKGIVSMVKSFVKWLG 668          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Medaka
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:101166655])

HSP 1 Score: 189.119 bits (479), Expect = 3.021e-49
Identity = 114/327 (34.86%), Postives = 163/327 (49.85%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  L+LDDL LL  +FYLPY++GP+A+++L   NWLR+                 NSS  S N   KE     K+    W+ +A+KF     +V  M  R +NI NR+ILYDLYPY+ D++ ++  + S+V W+GC    +   +  D EPW FRGGL  E QR+ P+E  +DL      F +  P+LP                                IY I+PY+  D   +YK+C+E +Y + +ED    ++            DL GDR +G  L  S D   +LED    ICGYA+GTV VK FIK  +  +   M++KY
Sbjct:  547 AEPLSLDDLCLLAELFYLPYEHGPKAMQMLKEFNWLRA-----------------NSSVVSVNCKRKE---SEKVSE--WQSRAQKFEDMCCSVIEMFTRLSNIANRTILYDLYPYIWDIKSIISMVKSFVLWLGCRSQSSAQFLRGDQEPWAFRGGLAGEFQRLLPIEAANDL------FYQPPPSLPT-----------------------------SKIYTIRPYYPKDETAVYKICKE-MYCEGMEDELFSQED----------PDLIGDRLVGGLLTLSSDYGFVLEDEA-GICGYAVGTVDVKPFIKKCKLSWLPFMQEKY 804          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Medaka
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:101166655])

HSP 1 Score: 174.096 bits (440), Expect = 1.956e-44
Identity = 113/345 (32.75%), Postives = 162/345 (46.96%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWI------------------GCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            +  L+LDDL LL  +FYLPY++GP+A+++L   NWLR+                 NSS  S N   KE     K+    W+ +A+KF     +V  M  R +NI NR+ILYDLYPY+ D++ ++  + S+V W+                   C    +   +  D EPW FRGGL  E QR+ P+E  +DL      F +  P+LP                                IY I+PY+  D   +YK+C+E +Y + +ED    ++            DL GDR +G  L  S D   +LED    ICGYA+GTV VK FIK  +  +   M++KY
Sbjct:  485 AEPLSLDDLCLLAELFYLPYEHGPKAMQMLKEFNWLRA-----------------NSSVVSVNCKRKE---SEKVSE--WQSRAQKFEDMCCSVIEMFTRLSNIANRTILYDLYPYIWDIKSIISMVKSFVLWLDGRIHSTSFYCYWIDSGRWCRSQSSAQFLRGDQEPWAFRGGLAGEFQRLLPIEAANDL------FYQPPPSLPT-----------------------------SKIYTIRPYYPKDETAVYKICKE-MYCEGMEDELFSQED----------PDLIGDRLVGGLLTLSSDYGFVLEDEA-GICGYAVGTVDVKPFIKKCKLSWLPFMQEKY 760          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Medaka
Match: oga (O-GlcNAcase [Source:NCBI gene;Acc:101166655])

HSP 1 Score: 143.665 bits (361), Expect = 9.160e-35
Identity = 89/268 (33.21%), Postives = 129/268 (48.13%), Query Frame = 1
Query:  886 SSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQE--ILYKQFLED-PAVDKQKLAALTTD 1680
            +  L+LDDL LL  +FYLPY++GP+A+++L   NWLR+                 NSS  S N   KE     K+    W+ +A+KF     +V  M  R +NI NR+ILYDLYPY+ D++ ++  + S+V W+GC    +   +  D EPW FRGGL  E QR+ P+E  +DL      F +  P+LP                                IY I+PY+  D K +    +E   L   FL + P++ K  + A  TD
Sbjct:  543 AEPLSLDDLCLLAELFYLPYEHGPKAMQMLKEFNWLRA-----------------NSSVVSVNCKRKE---SEKVSE--WQSRAQKFEDMCCSVIEMFTRLSNIANRTILYDLYPYIWDIKSIISMVKSFVLWLGCRSQSSAQFLRGDQEPWAFRGGLAGEFQRLLPIEAANDL------FYQPPPSLP-----------------------------TSKIYTIRPYYPKDEKMMLSFHEEEDGLPDSFLSNFPSLIKVDIHAKVTD 753          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Medaka
Match: si:dkey-183c6.8 (protein O-GlcNAcase [Source:NCBI gene;Acc:101163611])

HSP 1 Score: 108.997 bits (271), Expect = 6.998e-24
Identity = 83/343 (24.20%), Postives = 137/343 (39.94%), Query Frame = 1
Query:  895 LTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWI-------------------GCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY 1866
            L+   + L+V + YLP+++GP A ++L  + WL+++              VS +   +     +E           W  +A +F    + +  +        NR++LYDLYPY+ D+R+      ++V W+                    C       +M  D EPWVF+GGL  ++Q + P+   S+L      F    P  P                                +Y ++PYH+ D+ +LY++ +++     L      +  +A         D+ GDR LG  L  SP+   ILED    +CG  LG + V  F K  Q  +   MR KY
Sbjct:  420 LSESQVRLMVGLHYLPHEHGPSAQKLLQDLTWLKTN-----------CHLVSTNGKKAQPQKAEE-----------WHGRASRFLSLCEDIAQLHCSVVGGANRAVLYDLYPYVWDLRNTALVAKAFVCWLDGRVQSDSSALGSWRNCFHWCGKTTGADMMGVDSEPWVFKGGLSGDVQMLLPIGSCSEL------FTHPPPLFPT-----------------------------SRLYNVRPYHNKDKVELYRMVRQL----HLRTQGGQESNIA-------HPDVIGDRCLGPCLALSPEYSFILEDELG-VCGCVLGILDVPSFAKRCQASWIPAMRDKY 693          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Medaka
Match: ogal (protein O-GlcNAcase [Source:NCBI gene;Acc:101172880])

HSP 1 Score: 105.145 bits (261), Expect = 7.109e-23
Identity = 79/298 (26.51%), Postives = 123/298 (41.28%), Query Frame = 1
Query:  931 FYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKL---AALTTDG-RFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVK 1812
            FYLPY++GP A  +L  ++WL++H                         ++ E+  E       W+ +A+ F      V  M +R +N PNR ILYDLY Y+ D++  +    ++VK +G        LM DD EPW FRGGL  E QRM P  G  DLF          P +                                A+Y ++PY + D+  + +     ++K+  +  A DK  +     L +DG    ++P           SP N  ++ED+   +CGYA   +  +
Sbjct:  383 FYLPYEHGPTARSMLQELDWLKTH-------------------------SQTEQTEE-------WRCRAQHFDQMCKAVVQMFNRLSNAPNRRILYDLYNYICDIKSGVGLACAHVKALGGQDSPAAQLMTDDPEPWGFRGGLSGEFQRMLPGHGNRDLF--------RHPPM-------------------------------TAVYTVRPYSAEDQTTVQR-----VFKEMQKGGAGDKAPMMMQPPLISDGLSSGEVPP----------SPGNAFVMEDDVG-VCGYAFALIDAR 593          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Planmine SMEST
Match: SMESG000023389.1 (SMESG000023389.1)

HSP 1 Score: 1472.6 bits (3811), Expect = 0.000e+0
Identity = 737/738 (99.86%), Postives = 738/738 (100.00%), Query Frame = 1
Query:  190 QKENAEEIQTASKDSNMRNSDEKVTFQIENLPGNNSTNFSSQELLNSALKNIDQLNVVDSPKPLHSKFVAKTDIKESVCELNNKTKVNSPTKPNPTSKELESETDHIKIVNDINITSYGYKMCRNESSNEMELVSKVEEASECSDSHNQMILDSILNAFPLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKYEFYLSDSNNQVTSSTNGDEISTSFSILNKNSVIENLIDGFGDSNLDKTLDMFDNSTHGLIHVDMSDVCKKSNILHINSVGFRXXXXXXXXXXXXXXQTSASDSQLEDNYYNEDYVESEDTLSDQITSNPQSNCSSLSLAIFSEVDSLNKRHEKFYKRHGFELCNVDRQMNNVMIMSRYI 2403
            +KENAEEIQTASKDSNMRNSDEKVTFQIENLPGNNSTNFSSQELLNSALKNIDQLNVVDSPKPLHSKFVAKTDIKESVCELNNKTKVNSPTKPNPTSKELESETDHIKIVNDINITSYGYKMCRNESSNEMELVSKVEEASECSDSHNQMILDSILNAFPLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMENNNNLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKYEFYLSDSNNQVTSSTNGDEISTSFSILNKNSVIENLIDGFGDSNLDKTLDMFDNSTHGLIHVDMSDVCKKSNILHINSVGFRLIKSISSALKKKILQTSASDSQLEDNYYNEDYVESEDTLSDQITSNPQSNCSSLSLAIFSEVDSLNKRHEKFYKRHGFELCNVDRQMNNVMIMSRYI
Sbjct:  304 KKENAEEIQTASKDSNMRNSDEKVTFQIENLPGNNSTNFSSQELLNSALKNIDQLNVVDSPKPLHSKFVAKTDIKESVCELNNKTKVNSPTKPNPTSKELESETDHIKIVNDINITSYGYKMCRNESSNEMELVSKVEEASECSDSHNQMILDSILNAFPLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMENNNNLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKYEFYLSDSNNQVTSSTNGDEISTSFSILNKNSVIENLIDGFGDSNLDKTLDMFDNSTHGLIHVDMSDVCKKSNILHINSVGFRLIKSISSALKKKILQTSASDSQLEDNYYNEDYVESEDTLSDQITSNPQSNCSSLSLAIFSEVDSLNKRHEKFYKRHGFELCNVDRQMNNVMIMSRYI 1041          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Planmine SMEST
Match: SMESG000023389.1 (SMESG000023389.1)

HSP 1 Score: 1471.83 bits (3809), Expect = 0.000e+0
Identity = 737/738 (99.86%), Postives = 738/738 (100.00%), Query Frame = 1
Query:  190 QKENAEEIQTASKDSNMRNSDEKVTFQIENLPGNNSTNFSSQELLNSALKNIDQLNVVDSPKPLHSKFVAKTDIKESVCELNNKTKVNSPTKPNPTSKELESETDHIKIVNDINITSYGYKMCRNESSNEMELVSKVEEASECSDSHNQMILDSILNAFPLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMEXXXXLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKYEFYLSDSNNQVTSSTNGDEISTSFSILNKNSVIENLIDGFGDSNLDKTLDMFDNSTHGLIHVDMSDVCKKSNILHINSVGFRXXXXXXXXXXXXXXQTSASDSQLEDNYYNEDYVESEDTLSDQITSNPQSNCSSLSLAIFSEVDSLNKRHEKFYKRHGFELCNVDRQMNNVMIMSRYI 2403
            +KENAEEIQTASKDSNMRNSDEKVTFQIENLPGNNSTNFSSQELLNSALKNIDQLNVVDSPKPLHSKFVAKTDIKESVCELNNKTKVNSPTKPNPTSKELESETDHIKIVNDINITSYGYKMCRNESSNEMELVSKVEEASECSDSHNQMILDSILNAFPLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMENNNNLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKYEFYLSDSNNQVTSSTNGDEISTSFSILNKNSVIENLIDGFGDSNLDKTLDMFDNSTHGLIHVDMSDVCKKSNILHINSVGFRLIKSISSALKKKILQTSASDSQLEDNYYNEDYVESEDTLSDQITSNPQSNCSSLSLAIFSEVDSLNKRHEKFYKRHGFELCNVDRQMNNVMIMSRYI
Sbjct:  288 KKENAEEIQTASKDSNMRNSDEKVTFQIENLPGNNSTNFSSQELLNSALKNIDQLNVVDSPKPLHSKFVAKTDIKESVCELNNKTKVNSPTKPNPTSKELESETDHIKIVNDINITSYGYKMCRNESSNEMELVSKVEEASECSDSHNQMILDSILNAFPLTPMETEDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMENNNNLQRKKTSKELISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWIGCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRKQLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKYEFYLSDSNNQVTSSTNGDEISTSFSILNKNSVIENLIDGFGDSNLDKTLDMFDNSTHGLIHVDMSDVCKKSNILHINSVGFRLIKSISSALKKKILQTSASDSQLEDNYYNEDYVESEDTLSDQITSNPQSNCSSLSLAIFSEVDSLNKRHEKFYKRHGFELCNVDRQMNNVMIMSRYI 1025          
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Planmine SMEST
Match: SMESG000005407.1 (SMESG000005407.1)

HSP 1 Score: 229.95 bits (585), Expect = 1.132e-62
Identity = 175/572 (30.59%), Postives = 284/572 (49.65%), Query Frame = 1
Query:  895 LTLDDLHLLVSMFYLPYQYGPRAVEILNSINWLRSHEFYV-RDGI----RNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKAEKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWI------------------GCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIENEPNLP--KIL---TKIDSELKIEDNESCQCINEIPSPENCQ-AIYIIQPYHSSDRKQLYKLCQEIL----------YKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFSPDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKY-EFYLSDSNN--QVTSSTNGDEISTSFSILNKNSVIENLIDGFGDSNLDKTLDMFDNSTHGLIHVDMSDVCKKSNILHINSVGFRXXXXXXXXXXXXXXQTSASDSQLEDNYYNEDYVESEDTLSD--------------------------QITSNPQSNCSSLSLAIFSEVDSLNKRHEKFYKRHGF-ELCNVDRQMNNVMIMSRYI 2403
            LTL++L LLV ++YLPY++G  A+++L  ++WLRSH   V RD       N  +  SN SD   +          + K   W+ KA +F    + VR + +RF +IPN+S+L DLY YLQD+RHVL  L+SY++W+                   C PGY      DD+E W+FRGGLI E QRMFP++   DLFP    FI+  P+     +L   T  +          C  + +I  P   + +++ ++P+   DR+ +Y LC  ++          YK + ED                  +LPGDRY+GVFLD  P+ C++LE+ +  I GYA+  + V EF K+R ++Y  KM+ KY ++++++SN   ++T ST    +          S I+N+I+ F       ++   +NS   + + DM +  K +++  I+S+  RL+  + SALK    + S    Q     Y    + +   L+                           Q+T+  ++   SL+  +++EVD LNK H++ YKR+GF E+ + D   +++ I++R I
Sbjct:  523 LTLENLRLLVDLYYLPYEHGAEAIKMLELVHWLRSHAHLVDRDDFDENETNINQIKSNESDSQDHI---------QCKLTHWRLKAAQFHELMEKVRELTNRFCHIPNKSVLGDLYSYLQDIRHVLETLDSYIQWLERAKITYASVCAMRRLLSWCTPGYKEMFTGDDYESWMFRGGLITEFQRMFPVDNAYDLFPIRASFIQYSPDFTVNGLLSDPTDSEKSSSSISQNGCH-LTKISRPIYSKPSMFNVRPFKDEDRQSIYSLCFTLVNNRATLSVNDYKCYSED----------------IYNLPGDRYVGVFLDNFPEYCLVLENEDSVIVGYAVACMNVLEFQKYRNQEYLPKMKNKYSKYFINNSNTDIEMTDSTYSSAV---------KSAIQNMINQFQHEQC--SMPQSENSV--VFYFDMKECYKPNDLDTIDSLTRRLLICLFSALKTAAAENS---DQTPTPNYPTSLIGTGSALTTSSIAIVSQGSLITTSSVPLVAIGPVLQVTNKDRAPVPSLT--VYAEVDLLNKSHKEVYKRYGFTEIMSTDSGSDDI-ILTRII 1049          
The following BLAST results are available for this feature:
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
OGA2.346e-4230.11O-GlcNAcase [Source:HGNC Symbol;Acc:HGNC:7056][more]
OGA2.632e-4230.11O-GlcNAcase [Source:HGNC Symbol;Acc:HGNC:7056][more]
OGA9.970e-3429.20O-GlcNAcase [Source:HGNC Symbol;Acc:HGNC:7056][more]
OGA1.485e-1829.63O-GlcNAcase [Source:HGNC Symbol;Acc:HGNC:7056][more]
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Oga8.494e-3325.82gene:FBgn0038870 transcript:FBtr0084050[more]
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
oga4.034e-5130.95O-GlcNAcase [Source:ZFIN;Acc:ZDB-GENE-030131-3208][more]
oga2.578e-4629.49O-GlcNAcase [Source:ZFIN;Acc:ZDB-GENE-030131-3208][more]
si:dkey-183c6.82.660e-2524.71si:dkey-183c6.8 [Source:ZFIN;Acc:ZDB-GENE-160728-2... [more]
ogal3.838e-2330.45O-GlcNAcase like [Source:ZFIN;Acc:ZDB-GENE-110914-... [more]
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oga1.003e-4029.97O-GlcNAcase [Source:NCBI gene;Acc:100145437][more]
oga2.103e-3930.09O-GlcNAcase [Source:NCBI gene;Acc:100145437][more]
oga3.131e-3930.09O-GlcNAcase [Source:NCBI gene;Acc:100145437][more]
oga3.832e-3930.09O-GlcNAcase [Source:NCBI gene;Acc:100145437][more]
oga4.581e-3930.09O-GlcNAcase [Source:NCBI gene;Acc:100145437][more]
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Oga1.099e-4229.72O-GlcNAcase [Source:MGI Symbol;Acc:MGI:1932139][more]
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 3
Match NameE-valueIdentityDescription
sp|Q9EQQ9|OGA_MOUSE7.689e-4229.72Protein O-GlcNAcase OS=Mus musculus OX=10090 GN=Og... [more]
sp|O60502|OGA_HUMAN1.127e-4130.11Protein O-GlcNAcase OS=Homo sapiens OX=9606 GN=OGA... [more]
sp|Q8VIJ5|OGA_RAT2.460e-4130.18Protein O-GlcNAcase OS=Rattus norvegicus OX=10116 ... [more]
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3P9AIY51.396e-5136.17O-GlcNAcase OS=Esox lucius OX=8010 PE=4 SV=1[more]
A0A1S3RPY13.572e-5136.17protein O-GlcNAcase OS=Salmo salar OX=8030 GN=mgea... [more]
A0A4W5KAX74.224e-5136.17O-GlcNAcase OS=Hucho hucho OX=62062 PE=4 SV=1[more]
A0A3P8Z1S35.232e-5136.17O-GlcNAcase OS=Esox lucius OX=8010 PE=4 SV=1[more]
A0A060XCX39.693e-5136.17Uncharacterized protein OS=Oncorhynchus mykiss OX=... [more]
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oga8.314e-5033.33O-GlcNAcase [Source:NCBI gene;Acc:103032082][more]
oga9.764e-5033.33O-GlcNAcase [Source:NCBI gene;Acc:103032082][more]
oga5.954e-4531.30O-GlcNAcase [Source:NCBI gene;Acc:103032082][more]
ogal2.149e-2938.54protein O-GlcNAcase-like [Source:NCBI gene;Acc:103... [more]
ogal1.260e-2736.46protein O-GlcNAcase-like [Source:NCBI gene;Acc:103... [more]
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-183c6.83.491e-1533.33si:dkey-183c6.8 [Source:ZFIN;Acc:ZDB-GENE-160728-2... [more]
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
oga3.021e-4934.86O-GlcNAcase [Source:NCBI gene;Acc:101166655][more]
oga1.956e-4432.75O-GlcNAcase [Source:NCBI gene;Acc:101166655][more]
oga9.160e-3533.21O-GlcNAcase [Source:NCBI gene;Acc:101166655][more]
si:dkey-183c6.86.998e-2424.20protein O-GlcNAcase [Source:NCBI gene;Acc:10116361... [more]
ogal7.109e-2326.51protein O-GlcNAcase [Source:NCBI gene;Acc:10117288... [more]
back to top
BLAST of Meningioma expressed antigen 5 (Hyaluronidase) vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000023389.10.000e+099.86SMESG000023389.1[more]
SMESG000023389.10.000e+099.86SMESG000023389.1[more]
SMESG000005407.11.132e-6230.59SMESG000005407.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023601 ID=SMED30023601|Name=Meningioma expressed antigen 5 (Hyaluronidase)|organism=Schmidtea mediterranea sexual|type=transcript|length=2621bp
AAAATACAATTTTTGCTAAAAAAGCATAAAAATTAATTCTCAATGAAAAA
ATATTTTCTTCATGGAAGTCTTCAATTTTTTGAGAAATTTTATTTTCGAA
ATTCAAATAAATGCTGAACAATTTTGTGTTTATATAATATTGTGATTGCG
GTATCAAATAGTTAATCGAATGTCACTACTATCTGCAAACAGAAGGAAAA
CGCTGAAGAGATCCAAACTGCTTCTAAAGACTCCAATATGAGAAACTCTG
ATGAAAAAGTCACTTTTCAAATTGAAAATTTACCAGGAAACAATTCCACC
AACTTTAGCTCACAAGAACTTTTGAATTCTGCGTTGAAAAATATTGACCA
ACTAAATGTTGTTGATTCACCTAAACCGCTTCATTCTAAATTTGTCGCAA
AAACCGATATCAAAGAATCGGTTTGCGAATTGAATAATAAGACCAAAGTT
AATTCACCAACAAAACCTAATCCCACCAGCAAAGAACTTGAAAGTGAAAC
CGACCATATCAAAATAGTAAATGATATAAATATCACATCGTACGGTTACA
AAATGTGTCGAAATGAATCATCTAATGAAATGGAGTTAGTTTCTAAAGTT
GAAGAAGCATCAGAGTGTTCTGATAGCCACAATCAGATGATTCTTGATAG
TATTCTTAATGCATTCCCACTAACCCCCATGGAAACGGAAGATAATCAAA
CCGATACTGACAATGTCACAGATTCCATGGCAATGCAGATTGATAATATC
TATGAAAGTACATTTGAGAAAATGGACATTATAGATGACATGGAAAATAA
TAACAATTTACAACGGAAAAAAACTTCTAAGGAGTTAATTTCGAAGAATA
AATCTAAACAAATAGAAAATATTTCGCCAATAGATTCTTCAAAATTAACT
TTAGATGATTTGCATTTACTCGTCAGTATGTTTTATTTACCGTATCAATA
TGGACCACGAGCCGTTGAAATACTTAACTCGATAAATTGGCTCCGTTCCC
ATGAATTCTATGTAAGGGATGGTATTCGCAATTCGGCTGAAACTGTTTCT
AATAGTTCTGACCATTCATCGAATTTCAACGAAAAAGAGAGAATTTACGA
AAGAAAAATCAAATCCTATATATGGAAAGAAAAGGCAGAAAAATTCAGCT
TTCAGTATGATACAGTACGCTGCATGGCAGATCGCTTCACCAATATTCCG
AATCGGTCTATCCTATATGACCTCTATCCTTATCTTCAAGACATGCGCCA
TGTATTGTGCAATTTGAATTCGTATGTAAAATGGATAGGTTGCTTACCGG
GATATAATGTATCGTTAATGAATGATGATCACGAACCTTGGGTATTCAGA
GGAGGTTTAATAGCTGAATTGCAAAGAATGTTTCCATTGGAAGGTACGTC
TGATCTCTTTCCAAATGAAGTACGATTTATTGAAAATGAACCTAACCTGC
CGAAAATACTTACAAAAATTGATTCGGAATTAAAAATTGAAGATAATGAA
AGTTGTCAATGCATAAATGAAATTCCAAGTCCAGAGAATTGTCAAGCTAT
TTATATTATTCAGCCATATCATTCATCCGATCGAAAGCAATTATACAAAT
TATGTCAGGAAATATTATATAAACAATTTCTTGAAGATCCAGCTGTAGAT
AAACAAAAGTTAGCTGCATTGACAACAGATGGTAGATTTAAAGATTTACC
TGGTGACAGATATCTGGGAGTCTTTCTCGACTTTTCACCTGATAACTGTA
TGATACTAGAAGATAATAATGAGAGGATTTGTGGATATGCTCTCGGTACA
GTTCAAGTCAAAGAGTTCATTAAATTTAGACAAAAGGATTATAATTTAAA
GATGCGAAAGAAATATGAATTTTATTTATCAGATTCGAACAATCAAGTGA
CTTCTTCAACTAATGGCGATGAAATTTCTACTTCATTTTCCATATTAAAT
AAAAATTCAGTCATTGAAAATTTAATCGACGGATTTGGAGACAGCAATTT
AGATAAAACTCTTGATATGTTTGACAATTCTACGCATGGATTAATCCACG
TCGATATGTCAGATGTCTGTAAAAAGTCAAATATTCTCCATATTAACAGT
GTGGGATTTAGATTGATTAAATCGATATCTTCTGCTCTAAAAAAGAAAAT
ATTACAGACTAGCGCTTCTGATTCTCAGTTGGAAGATAATTATTACAATG
AAGATTATGTGGAATCAGAAGATACTTTATCTGATCAAATCACTAGCAAT
CCACAGTCAAATTGTTCATCTTTATCATTGGCAATATTCAGTGAGGTTGA
TTCATTAAACAAGCGTCACGAGAAGTTTTATAAAAGACATGGGTTCGAAT
TATGTAATGTTGATCGACAGATGAATAACGTTATGATTATGTCCAGATAC
ATTTGAAAAATTATAATTTGGTTTTCATTTTTTCTAATGATTATTATTTA
ATTTAATATTTTGCCAACCTGGATTTATCCCTGTTGGTGACTGGCATGTA
TTTTTAATATTTTAAACCAGTGAACTAGGTTTTAGAAGATTTTGGATTTT
TCAATAAAAAGTTTTTATAATACGAGGTCTTCCTTTTATTAATTATATTT
GTCATTAATTCTTAAATTAGC
back to top

protein sequence of SMED30023601-orf-1

>SMED30023601-orf-1 ID=SMED30023601-orf-1|Name=SMED30023601-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=723bp
MRNSDEKVTFQIENLPGNNSTNFSSQELLNSALKNIDQLNVVDSPKPLHS
KFVAKTDIKESVCELNNKTKVNSPTKPNPTSKELESETDHIKIVNDINIT
SYGYKMCRNESSNEMELVSKVEEASECSDSHNQMILDSILNAFPLTPMET
EDNQTDTDNVTDSMAMQIDNIYESTFEKMDIIDDMENNNNLQRKKTSKEL
ISKNKSKQIENISPIDSSKLTLDDLHLLVSMFYLPYQYGPRAVEILNSIN
WLRSHEFYVRDGIRNSAETVSNSSDHSSNFNEKERIYERKIKSYIWKEKA
EKFSFQYDTVRCMADRFTNIPNRSILYDLYPYLQDMRHVLCNLNSYVKWI
GCLPGYNVSLMNDDHEPWVFRGGLIAELQRMFPLEGTSDLFPNEVRFIEN
EPNLPKILTKIDSELKIEDNESCQCINEIPSPENCQAIYIIQPYHSSDRK
QLYKLCQEILYKQFLEDPAVDKQKLAALTTDGRFKDLPGDRYLGVFLDFS
PDNCMILEDNNERICGYALGTVQVKEFIKFRQKDYNLKMRKKYEFYLSDS
NNQVTSSTNGDEISTSFSILNKNSVIENLIDGFGDSNLDKTLDMFDNSTH
GLIHVDMSDVCKKSNILHINSVGFRLIKSISSALKKKILQTSASDSQLED
NYYNEDYVESEDTLSDQITSNPQSNCSSLSLAIFSEVDSLNKRHEKFYKR
HGFELCNVDRQMNNVMIMSRYI*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000074oocyte
PLANA:0000231vitelline gland
Vocabulary: molecular function
TermDefinition
GO:0004415hyalurononglucosaminidase activity
GO:0016231beta-N-acetylglucosaminidase activity
GO:0016787hydrolase activity
GO:0016798hydrolase activity, acting on glycosyl bonds
Vocabulary: cellular component
TermDefinition
GO:0005634nucleus
GO:0005737cytoplasm
GO:0005829cytosol
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0006044N-acetylglucosamine metabolic process
GO:0006493protein O-linked glycosylation
GO:0006516glycoprotein catabolic process
GO:0006517protein deglycosylation
GO:0008152metabolic process
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableGENE3DG3DSA:3.40.630.30coord: 437..596
e-value: 3.4E-16
score: 61.5
NoneNo IPR availableGENE3DG3DSA:1.20.58.240coord: 207..392
e-value: 2.0E-30
score: 107.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 68..87
NoneNo IPR availablePANTHERPTHR13170O-GLCNACASEcoord: 432..721
coord: 58..394