Netrin-1a

Overview
NameNetrin-1a
Smed IDSMED30023593
Uniprot Best hitNetrin unc-6 OS=Caenorhabditis elegans GN=unc-6 PE=1 SV=1 (E=2.58124e-94)
Length (bp)1962
Neoblast Clusters

Zeng et. al., 2018


▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Netrin-1a (SMED30023593) t-SNE clustered cells

Violin plots show distribution of expression levels for Netrin-1a (SMED30023593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017


Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

Download CSV of Expression Data

 

back to top

Expression Details

Netrin-1a ( netrin-like ) is expressed during Stage 2, Stage 3 and Stage 4 in the embryonic digestive system and temporary embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Homology
BLAST of Netrin-1a vs. Ensembl Human
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 301.982 bits (772), Expect = 5.714e-92
Identity = 185/606 (30.53%), Postives = 299/606 (49.34%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CN+ DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   +IN K++C K+   +++I   +  G W +F   I  V+   Q   R+ + +       S+W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVY--KQGTSRIRRGD------QSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin-1a vs. Ensembl Human
Match: NTN3 (netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030])

HSP 1 Score: 252.292 bits (643), Expect = 1.017e-73
Identity = 163/578 (28.20%), Postives = 260/578 (44.98%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPV-YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNS----SCD-FCQ--RKSKRINFKRFCSKETNFKVNIKSR-ESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSY----LVMANVKTTEFMGQTELILNQSDVIEDWKETW 1759
            C+   G P+ C P L+N A    + ASSTCG     +                  C++ DP+ + S  ++          CW SE +  +  P +V LT+ L K   + F+++  C   P  + + K       W+P  +F+  C L + ++PA          +      +CF    +   G       L+ F+ +     G  L  +   Q+W+ AT++R+  +LT     G     + R+ E  V Y + ++D+ +GG+  C+GHASR +  +     C+C+H T G DC +C   + D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R     +  + AC+ C CH VG+ +G  C+Q +G+C CK GVTG TC  CAPG++Q+ S   PC K         S+      CD  C+  R S RI+ K+FC K+   +V + +R E+RG W RF   +  V+   ++  R           +++WV      CGC     G  Y                    LI  +  ++  W++ W
Sbjct:   30 CHDEGGAPRGCVPGLVNAALGREVLASSTCGRPATRA------------------CDASDPRRAHSPALLTSPGGTASPLCWRSESLPRA--PLNVTLTVPLGKAFELVFVSLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAPANGPAGPGPEA-----LCFPAPLAQPDGSG-----LLAFSMQDSSPPGLDLDSSPVLQDWVTATDVRV--VLTRPSTAG-----DPRDMEAVVPYSYAATDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRATARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRALSDRRACRACDCHPVGA-AGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKTPIPGPTEDSSPVQPQDCDSHCKPARGSYRISLKKFCKKDYAVQVAVGARGEARGAWTRFPVAVLAVFRSGEERARRGS--------SALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGAGGRGPGLIAARGSLVLPWRDAW 561          
BLAST of Netrin-1a vs. Ensembl Human
Match: LAMC1 (laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:6492])

HSP 1 Score: 211.46 bits (537), Expect = 1.587e-56
Identity = 140/435 (32.18%), Postives = 214/435 (49.20%), Query Frame = 2
Query:   65 LQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-------------KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +  C    G P+ C P  +N A  + + A++TCG    E  C +    +    KSC  C++  P L   +  + D + +   T W S+ +     YP+S+NLTL L K   I+++ ++     P+   IYK   E   W P+QY++  C+ T+             +  AL TD    FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ AT+IR++  L     +G+ +  + +  ++  Y++  SD  +GG+  C+GHAS  ++   D   C C+H+T G DCEKC   FND+PW  AT  + + C  C+CN  S +C FD  ++  +G  HG  C +C DNT G  C++C   +FR     + +  AC  C C  VGSLS T CD   G+C CKPGV G  C  C PG+
Sbjct:   37 MDECTDEGGRPQRCMPEFVNAAFNVTVVATNTCG-TPPEEYCVQT--GVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDE---FSDISPLT------------GGN------VAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVT--LNRLNTFGDEVFNDPKVLKS--YYYAISDFAVGGRCKCNGHASECMKNEFDKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG--HGGHCTNCQDNTDGAHCERCRENFFR-----LGNNEACSSCHCSPVGSLS-TQCDSY-GRCSCKPGVMGDKCDRCQPGF 434          

HSP 2 Score: 68.9366 bits (167), Expect = 2.076e-11
Identity = 48/160 (30.00%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  848 PLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEE-FNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSL-SGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            P   G +  ++  + +     C   T GK CE C +  F D    +  +R   +C+ C+C+++      D N      R+ G  C+ C  NT G  CD+C  G+F     P    + CK C C+  G++   + C+ V+G+C C P VTG+ C  C PG+
Sbjct:  774 PCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVR---LCRLCQCSDN-----IDPNAVGNCNRLTGE-CLKCIYNTAGFYCDRCKDGFFGNPLAP-NPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGF 923          

HSP 3 Score: 61.6178 bits (148), Expect = 4.244e-9
Identity = 45/141 (31.91%), Postives = 65/141 (46.10%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPA-VCKRCECNNHSIKCVFDFNVFLKSGRIHGSSC------IDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHC 1309
            +C ++TAG  C++C + F   P +     NPA  CK C CN             L       SSC       +C  +  G  C  C PG+     Y +     C+ C CH++GS +G  CD  +G+C C+PG+TG+ C  C
Sbjct:  851 KCIYNTAGFYCDRCKDGFFGNPLAP----NPADKCKACNCN-------------LYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGF-----YNLQSGQGCERCDCHALGSTNGQ-CDIRTGQCECQPGITGQHCERC 968          

HSP 4 Score: 50.8322 bits (120), Expect = 8.355e-6
Identity = 40/142 (28.17%), Postives = 61/142 (42.96%), Query Frame = 2
Query:  896 TYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            T QCEC     G+DC  C   F +       +++   C+RC+C  H++    +    +++G+       +C     G  C++C   +F       +    CKPC CH  GSLS    D   G+C C+ G  G  C  C   Y
Sbjct:  902 TGQCECLPHVTGQDCGACDPGFYN-------LQSGQGCERCDC--HALGST-NGQCDIRTGQC------ECQPGITGQHCERCEVNHFG------FGPEGCKPCDCHPEGSLSLQCKD--DGRCECREGFVGNRCDQCEENY 1019          
BLAST of Netrin-1a vs. Ensembl Human
Match: LAMC3 (laminin subunit gamma 3 [Source:HGNC Symbol;Acc:HGNC:6494])

HSP 1 Score: 199.519 bits (506), Expect = 1.163e-52
Identity = 135/432 (31.25%), Postives = 204/432 (47.22%), Query Frame = 2
Query:   65 LQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVH-ESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPA----------LTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +  CY   G P+ C P+  N A     +AS TCG +  E  C         AH  C++C++ DP+   ++  + D H + + T W S  +     YPTSVN+TL L K   I+++ ++     P+   IYK       W P+Q+++  CQ T+  P                 + FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ +TE+ IS  L     +G+ + ++ +  ++  Y++  SD  +GG+  C+GHAS           C CQH+T G DCE+C   F D+PW+  T      C  C C+  S +C FD  +F  +G  HG  C  C D+T GP C++C   ++  H  P   +  C+PC C S GSL    CD  +G C CKP VTG  C  C PG+
Sbjct:   22 MGACYDGAGRPQRCLPVFENAAFGRLAQASHTCG-SPPEDFCPHVGAAGAGAH--CQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNITLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLRPGEDERVAFCTSEFSDISPLS------------GGN------VAFSTLEGRPSAYNFEESPGLQEWVTSTELLIS--LDRLNTFGDDIFKDPKVLQS--YYYAVSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTDCERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTG--HGGRCHHCRDHTAGPHCERCQENFY--HWDP---RMPCQPCDCQSAGSLH-LQCDD-TGTCACKPTVTGWKCDRCLPGF 419          

HSP 2 Score: 72.0182 bits (175), Expect = 2.632e-12
Identity = 48/153 (31.37%), Postives = 68/153 (44.44%), Query Frame = 2
Query:  866 ASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLS-GTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            A   I  S +     C     G+ CE C + F   P       +P  C +C+C+ +      D N       + G  C+ C  NT G  C+ C  G++     P    + C PC CH  GS+S   PCD V+G+C C P VT + C+ C PG+
Sbjct:  762 ACTTIPESREVVCTHCPPGQRGRRCEVCDDGFFGDPL--GLFGHPQPCHQCQCSGN-----VDPNAVGNCDPLSGH-CLRCLHNTTGDHCEHCQEGFYGSALAP-RPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTARDCSRCYPGF 905          

HSP 3 Score: 55.8398 bits (133), Expect = 2.249e-7
Identity = 41/138 (29.71%), Postives = 58/138 (42.03%), Query Frame = 2
Query:  911 CQHSTAGKDCEKCHEEFNDQPWSSATIRNPA-VCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            C H+T G  CE C E F    + SA    PA  C  C C+          +  +    + G     C  +     C +C PG+F      +     C+ C CH +GS     C   +G+C C+PGVTG+ C  C  G+
Sbjct:  834 CLHNTTGDHCEHCQEGF----YGSALAPRPADKCMPCSCHPQG-----SVSEQMPCDPVTGQ--CSCLPHVTARDCSRCYPGFFD-----LQPGRGCRSCKCHPLGSQEDQ-CHPKTGQCTCRPGVTGQACDRCQLGF 954          
BLAST of Netrin-1a vs. Ensembl Human
Match: NTN5 (netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208])

HSP 1 Score: 183.341 bits (464), Expect = 1.160e-49
Identity = 101/330 (30.61%), Postives = 159/330 (48.18%), Query Frame = 2
Query:  854 CHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVK-------SNSSC-DFCQRKSKRIN--FKRFCSKETNFKVNIKSRESRG-QWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCN 1810
            CHGHA+R    +       C+H T G  CE C     D PW  AT R+P  C  C CN H+ +C F+  +F  SG   G  C  C  +T G  C  C PG++R  + PI+ + AC+ C CH +G+  GT C+Q SG+C CK GVTG TC  C PGY+Q+ S + PC++I +    +        S+  C ++C     R++   +R+C ++   +  + + E+ G  W R    +  V+ +  Q  R    +         WV +  + CGC+  + G  YL++ +         T LIL++  +   W+  W     +   +++ G C 
Sbjct:  159 CHGHAARCAARARPPRC-HCRHHTTGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPIFSRRACRACQCHPIGATGGT-CNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVHMSLRRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQRAQPVRRGDQD--------AWVPRADLTCGCLRLQPGTDYLLLGSAVGDP--DPTRLILDRHGLALPWRPRWARPLKRLQQEERAGGCR 476          
BLAST of Netrin-1a vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 310.071 bits (793), Expect = 1.893e-95
Identity = 190/598 (31.77%), Postives = 297/598 (49.67%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYI-LTP--KEHYG-----NLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQK 1828
            C+   G P  C P  IN A    + AS TCG N  +  CT      G   + C+ C++ +   S  + ++ D +  G  TCW+S     S  P +V+LTL L K+  ++++++  C   PD + +YK       W+P+Q+++ +C+  F       D   + +  N  + VC      M  GG+   F  +   P   ++F +  S   Q+W+ AT+I++ +  L+P   E YG     N    E  +     Y +   ++ +GG+  C+GHASR I      Y C+C+H+TAG +CE C     D+PW  AT  +   C  C CN H+ +C FD  +F  SG   G  C++C  NT G  C  C PG+ R  + P+ H+ ACK C CH VGSL G  C+Q SG+C CKPGVTG TC  CA GY+Q+ S   PC KI      + S+ S     C  C+   KR+N K+FC ++   ++ + SRE    W ++   +E V+ R  +       N++  E TS+W+    V C C     G  YL++   K      +  L++N   V+ +W++   ++  +F  +DK+G+C   T  +
Sbjct:   37 CHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVST---PSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGR-----DPDVSITKSNEQEAVC-TASHIMGPGGNRVAFPFLENRP-SAQNFEN--SPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSL-GKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTE-------NMQRGE-TSLWISPQGVICKCPKLRVGRRYLLLG--KNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHR 611          
BLAST of Netrin-1a vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 310.071 bits (793), Expect = 1.893e-95
Identity = 190/598 (31.77%), Postives = 297/598 (49.67%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYI-LTP--KEHYG-----NLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQK 1828
            C+   G P  C P  IN A    + AS TCG N  +  CT      G   + C+ C++ +   S  + ++ D +  G  TCW+S     S  P +V+LTL L K+  ++++++  C   PD + +YK       W+P+Q+++ +C+  F       D   + +  N  + VC      M  GG+   F  +   P   ++F +  S   Q+W+ AT+I++ +  L+P   E YG     N    E  +     Y +   ++ +GG+  C+GHASR I      Y C+C+H+TAG +CE C     D+PW  AT  +   C  C CN H+ +C FD  +F  SG   G  C++C  NT G  C  C PG+ R  + P+ H+ ACK C CH VGSL G  C+Q SG+C CKPGVTG TC  CA GY+Q+ S   PC KI      + S+ S     C  C+   KR+N K+FC ++   ++ + SRE    W ++   +E V+ R  +       N++  E TS+W+    V C C     G  YL++   K      +  L++N   V+ +W++   ++  +F  +DK+G+C   T  +
Sbjct:   37 CHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVST---PSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGR-----DPDVSITKSNEQEAVC-TASHIMGPGGNRVAFPFLENRP-SAQNFEN--SPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSL-GKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTE-------NMQRGE-TSLWISPQGVICKCPKLRVGRRYLLLG--KNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHR 611          
BLAST of Netrin-1a vs. Ensembl Celegans
Match: lam-2 (Laminin-like protein lam-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18823])

HSP 1 Score: 209.92 bits (533), Expect = 1.796e-56
Identity = 141/443 (31.83%), Postives = 216/443 (48.76%), Query Frame = 2
Query:   74 CYS-ANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESS-YPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF----KMPAL-----TTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTS----DDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQ--TNSLKN 1345
            CY  A   P+ C P  +N A  + ++ ++TCG       C +      ++   CE C+      S  +K + D ++   ET W S+ + E   YPT+ NLTL L K   I+++ ++     P+   IYK      +W PWQ+++  C+ T+    + P L     T      FSDI+ +             GG+      I F+  +GR       ++E  Q W+ A+ IRIS  L     +G+ + ++ +   +  Y++  SD  +GG+  C+GHAS  + +S    ++   C C+H+T G DC +C   +ND+PW S T      C  C C+  S +C FD  +F ++G  HG  CIDC  NT G  C+QC   ++R+       +N C  C C+ +GSLS T CD   GKC CKPGVTG+ C  C  G+    TN  KN
Sbjct:   40 CYDRATRQPQRCVPDFVNAAFNLEVQVTNTCGTKRPTKFCVQSGHTGQRS--VCETCDDRHEGFSHPAKYLTDFNVGNNETWWQSDTMQEGQQYPTTTNLTLVLGKSFDITYVRLKFISPRPESFTIYKKTHTDSEWEPWQFYSGSCRATYGLSDRAPILPGNEATAQCTKEFSDISPIT------------GGN------IAFSTLEGRPSAHAFEESEVLQKWVTASAIRIS--LNRMNTFGDEVFKDPQVLRS--YYYAISDFAVGGRCKCNGHASECVGSSSVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLFEETG--HGGHCIDCQGNTQGVHCEQCIANHWRRPG-----ENYCVACGCNEIGSLS-TQCDN-EGKCQCKPGVTGRFCDQCLDGFYDFSTNGCKN 449          

HSP 2 Score: 69.707 bits (169), Expect = 4.501e-12
Identity = 47/135 (34.81%), Postives = 63/135 (46.67%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCA 1312
            +C  +T G +CE C   +    W  A I     C+ C C     +   +    L+  +  G    DC  N +G QCDQCA G+     Y I     C+ C C  +GS  G  CD  +G+C CKPGVTG+ C  CA
Sbjct:  858 KCIFNTHGFNCENCKPGY----WGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQ--CDCLPNVIGIQCDQCAHGF-----YNITSGLGCQECNCDPLGS-EGNTCDVNTGQCQCKPGVTGQRCDRCA 980          

HSP 3 Score: 52.7582 bits (125), Expect = 8.356e-7
Identity = 45/165 (27.27%), Postives = 71/165 (43.03%), Query Frame = 2
Query:  854 CHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVF--DFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLC------HSVGSLSGTPCDQVSGKC-FCKPGVTGKTCTHCAPGY 1321
            CH H++       ++  C C+H+TAG  CE+C   +    +  A       C++C C N    C+   D +V           C +C +   G +CD+C+ GYF            C  C C      +S+G+     CD+++G+C  C     G  C +C PGY
Sbjct:  738 CHNHSNSC---EAESGSCICEHNTAGDTCERCARGY----YGDALQGTEEDCQKCPCPNDG-PCILHADGDVI----------CTECPNGYTGRRCDECSDGYFGNPK----DGTECVECACSGNTDPNSIGN-----CDKITGECKKCIFNTHGFNCENCKPGY 875          
BLAST of Netrin-1a vs. Ensembl Celegans
Match: lam-2 (Laminin-like protein lam-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18823])

HSP 1 Score: 209.92 bits (533), Expect = 1.796e-56
Identity = 141/443 (31.83%), Postives = 216/443 (48.76%), Query Frame = 2
Query:   74 CYS-ANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESS-YPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF----KMPAL-----TTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTS----DDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQ--TNSLKN 1345
            CY  A   P+ C P  +N A  + ++ ++TCG       C +      ++   CE C+      S  +K + D ++   ET W S+ + E   YPT+ NLTL L K   I+++ ++     P+   IYK      +W PWQ+++  C+ T+    + P L     T      FSDI+ +             GG+      I F+  +GR       ++E  Q W+ A+ IRIS  L     +G+ + ++ +   +  Y++  SD  +GG+  C+GHAS  + +S    ++   C C+H+T G DC +C   +ND+PW S T      C  C C+  S +C FD  +F ++G  HG  CIDC  NT G  C+QC   ++R+       +N C  C C+ +GSLS T CD   GKC CKPGVTG+ C  C  G+    TN  KN
Sbjct:   40 CYDRATRQPQRCVPDFVNAAFNLEVQVTNTCGTKRPTKFCVQSGHTGQRS--VCETCDDRHEGFSHPAKYLTDFNVGNNETWWQSDTMQEGQQYPTTTNLTLVLGKSFDITYVRLKFISPRPESFTIYKKTHTDSEWEPWQFYSGSCRATYGLSDRAPILPGNEATAQCTKEFSDISPIT------------GGN------IAFSTLEGRPSAHAFEESEVLQKWVTASAIRIS--LNRMNTFGDEVFKDPQVLRS--YYYAISDFAVGGRCKCNGHASECVGSSSVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLFEETG--HGGHCIDCQGNTQGVHCEQCIANHWRRPG-----ENYCVACGCNEIGSLS-TQCDN-EGKCQCKPGVTGRFCDQCLDGFYDFSTNGCKN 449          

HSP 2 Score: 69.707 bits (169), Expect = 4.501e-12
Identity = 47/135 (34.81%), Postives = 63/135 (46.67%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCA 1312
            +C  +T G +CE C   +    W  A I     C+ C C     +   +    L+  +  G    DC  N +G QCDQCA G+     Y I     C+ C C  +GS  G  CD  +G+C CKPGVTG+ C  CA
Sbjct:  858 KCIFNTHGFNCENCKPGY----WGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQ--CDCLPNVIGIQCDQCAHGF-----YNITSGLGCQECNCDPLGS-EGNTCDVNTGQCQCKPGVTGQRCDRCA 980          

HSP 3 Score: 52.7582 bits (125), Expect = 8.356e-7
Identity = 45/165 (27.27%), Postives = 71/165 (43.03%), Query Frame = 2
Query:  854 CHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVF--DFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLC------HSVGSLSGTPCDQVSGKC-FCKPGVTGKTCTHCAPGY 1321
            CH H++       ++  C C+H+TAG  CE+C   +    +  A       C++C C N    C+   D +V           C +C +   G +CD+C+ GYF            C  C C      +S+G+     CD+++G+C  C     G  C +C PGY
Sbjct:  738 CHNHSNSC---EAESGSCICEHNTAGDTCERCARGY----YGDALQGTEEDCQKCPCPNDG-PCILHADGDVI----------CTECPNGYTGRRCDECSDGYFGNPK----DGTECVECACSGNTDPNSIGN-----CDKITGECKKCIFNTHGFNCENCKPGY 875          
BLAST of Netrin-1a vs. Ensembl Celegans
Match: lam-3 (LAMinin related. See also lmb- [Source:RefSeq peptide;Acc:NP_492775])

HSP 1 Score: 166.007 bits (419), Expect = 2.745e-42
Identity = 126/466 (27.04%), Postives = 209/466 (44.85%), Query Frame = 2
Query:  110 PLLINLAQPMHIEASSTCGENGAESIC--TEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFA---KDCQLTFKMPALT-------TDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRN-----AENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDT---YQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFD-------FNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLS--------GTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKN-PCRKISKLRHLVKSNSSC 1399
            P + NLA    I A+ TCG+  AE  C   E        +    +C+  D   +   +  ++  I G    W S  +        VN+T+ L++   +++I +++      G  + +   + + + PWQY+A    +C   F +PA T        D V+  S+ + + P    LE              I  +   GR   +  S   Q +  A  +R+  +++P+    +L++  K++     +    Y +  SDI IGGQ +C+GHA      SD     ++CEC+H+T G+ C +C   FN  PW   T  +P VC++C+C NH+  CV+D       +++  +     G  C++C  NT G  C++C  GY+R      Y ++AC+ C C  VGS+S             Q  G C CKPG  G+ C  CAPGY+   + +  PC +   +       +SC
Sbjct:   50 PNIFNLATNSLITATDTCGQYTAEEYCKLVEHVLLRKTTNTQSPQCDICDAN-NVHKRHPIEYAIDGTRRWWQSPSLANGLRFEKVNITIDLRQEYQVAYIILKMGNSPRPGTWVLEKSLDGEYYEPWQYYAMQDAECMRQFGIPATTGVPRFQKEDEVHCTSEYSKITP----LENGE-----------IHTSLVNGRPGAENTSLELQKFTRARFVRLR-LISPRTLNADLMIINKKSDSLDKSVTMRYFYSISDISIGGQCICYGHAESC--PSDPVTGQFKCECRHNTCGESCNRCCPLFNQLPWKPGTNSHPNVCQQCQCFNHAHSCVYDDELDRNKWSITPEGVYEGGGRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECDPVGSVSDACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGYRNHPTCEPCPCNRAGSVNFDTCDGASC 496          

HSP 2 Score: 75.485 bits (184), Expect = 9.171e-14
Identity = 58/171 (33.92%), Postives = 77/171 (45.03%), Query Frame = 2
Query:  854 CHGHASRIIRTSDDTYQC-ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCEC----NNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPC 1351
            CHGH+      + DT  C +C+H+T G  CE C   +       A       C +C C    N+ S  CV      +  GR  G  C  C     G  C+ C  GY+     P +    C PC CH  GSL G  C+ +SG+C CKPGVTG+TC+ C   +   N +   C
Sbjct: 1542 CHGHSQTC---NPDTSVCTDCEHNTFGDFCEHCLPGY----IGDAREGGANACTKCACPLVENSFSDSCVA-----VDHGR--GYVCNSCKPGYTGQYCETCVAGYYGD---PQHIGGTCSPCDCHPDGSLHGA-CNPLSGQCECKPGVTGRTCSMCQERHAFINRVCTSC 1694          

HSP 3 Score: 73.9442 bits (180), Expect = 3.110e-13
Identity = 52/177 (29.38%), Postives = 77/177 (43.50%), Query Frame = 2
Query:  809 YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSC------IDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +H+G++ +       CH   +   + S++  +CEC+ +  G  C++C E   D       + N   C  C+CN+              +G I GS C       +C     G QCDQC P YF       +    C+ C C+  GS+    CDQ +GKC C+  V G  C  CA GY
Sbjct:  928 HHWGNAQLHTCKPCGCHTQGAVNPQCSEENGECECKENYIGAQCDRCKENHGD-------VENG--CPACDCND--------------TGSI-GSDCDQVSGQCNCKQGVFGKQCDQCRPSYFN------FTDAGCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADGY 1074          

HSP 4 Score: 63.1586 bits (152), Expect = 5.832e-10
Identity = 46/138 (33.33%), Postives = 62/138 (44.93%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +C   T G  CE C E      W +A +     CK C C+           V  +    +G    +C +N +G QCD+C   +          +N C  C C+  GS+ G+ CDQVSG+C CK GV GK C  C P Y
Sbjct:  912 KCIGHTTGDSCESCKEHH----WGNAQLH---TCKPCGCHTQGA-------VNPQCSEENGE--CECKENYIGAQCDRCKENHGDV-------ENGCPACDCNDTGSI-GSDCDQVSGQCNCKQGVFGKQCDQCRPSY 1025          
BLAST of Netrin-1a vs. Ensembl Fly
Match: NetA (Netrin-A [Source:FlyBase gene name;Acc:FBgn0015773])

HSP 1 Score: 244.973 bits (624), Expect = 3.519e-70
Identity = 167/576 (28.99%), Postives = 259/576 (44.97%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGH--NPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAEN--------PV-----------------------YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNS-----LKNPCRKISKLR---------------------------------HLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLE 1582
            CY+   +P+ C P  +N A    + ASSTCG +GA+  C E+ D      +SC  C+  DP  S  ++ + D +     TCW SE V  S    +V LTL L K+  ++++ ++LC H   PD ++IYK       W P+Q+F+  C+  F  PA  +   +     N  +  C D+ +         L   I F+  +GR     L  +   Q+W+ AT+IR+ +    +     LL  E   A +        P+                        H+  SD  +GG+  C+GHAS+    +     CEC H+TAG+DCE+C     D+PW+ AT +    CK C CN H+ +C F+  +F  S  + G  C +C  +T G  C QC  G++R    P+ H+  CK C CH +GS SG  C+  SG+C CK GVTG TC  CA GY+Q+ S     +K P R I+ L                                  +  +    C  C+  +KR+N  +FC ++      +  R++  + +    E++    R   DP V+   ++
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDAPVVASSTCGSSGAQRYC-EYQDH----ERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSG--DNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQSTGRH-----NEHEARCSDVTR--------PLVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGS-SGKICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVS--REVQ----RRAMDPDVADYEMD 588          
BLAST of Netrin-1a vs. Ensembl Fly
Match: NetA (Netrin-A [Source:FlyBase gene name;Acc:FBgn0015773])

HSP 1 Score: 244.973 bits (624), Expect = 3.519e-70
Identity = 167/576 (28.99%), Postives = 259/576 (44.97%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGH--NPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAEN--------PV-----------------------YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNS-----LKNPCRKISKLR---------------------------------HLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLE 1582
            CY+   +P+ C P  +N A    + ASSTCG +GA+  C E+ D      +SC  C+  DP  S  ++ + D +     TCW SE V  S    +V LTL L K+  ++++ ++LC H   PD ++IYK       W P+Q+F+  C+  F  PA  +   +     N  +  C D+ +         L   I F+  +GR     L  +   Q+W+ AT+IR+ +    +     LL  E   A +        P+                        H+  SD  +GG+  C+GHAS+    +     CEC H+TAG+DCE+C     D+PW+ AT +    CK C CN H+ +C F+  +F  S  + G  C +C  +T G  C QC  G++R    P+ H+  CK C CH +GS SG  C+  SG+C CK GVTG TC  CA GY+Q+ S     +K P R I+ L                                  +  +    C  C+  +KR+N  +FC ++      +  R++  + +    E++    R   DP V+   ++
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDAPVVASSTCGSSGAQRYC-EYQDH----ERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSG--DNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQSTGRH-----NEHEARCSDVTR--------PLVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGS-SGKICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVS--REVQ----RRAMDPDVADYEMD 588          
BLAST of Netrin-1a vs. Ensembl Fly
Match: NetA (Netrin-A [Source:FlyBase gene name;Acc:FBgn0015773])

HSP 1 Score: 242.276 bits (617), Expect = 1.442e-69
Identity = 152/463 (32.83%), Postives = 224/463 (48.38%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGH--NPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAEN--------PV-----------------------YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRK 1357
            CY+   +P+ C P  +N A    + ASSTCG +GA+  C E+ D      +SC  C+  DP  S  ++ + D +     TCW SE V  S    +V LTL L K+  ++++ ++LC H   PD ++IYK       W P+Q+F+  C+  F  PA  +   +     N  +  C D+ +         L   I F+  +GR     L  +   Q+W+ AT+IR+ +    +     LL  E   A +        P+                        H+  SD  +GG+  C+GHAS+    +     CEC H+TAG+DCE+C     D+PW+ AT +    CK C CN H+ +C F+  +F  S  + G  C +C  +T G  C QC  G++R    P+ H+  CK C CH +GS SG  C+  SG+C CK GVTG TC  CA GY+Q+ S   PC K
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDAPVVASSTCGSSGAQRYC-EYQDH----ERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSG--DNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQSTGRH-----NEHEARCSDVTR--------PLVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGS-SGKICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIK 481          
BLAST of Netrin-1a vs. Ensembl Fly
Match: LanB2 (Laminin B2 [Source:FlyBase gene name;Acc:FBgn0267348])

HSP 1 Score: 202.986 bits (515), Expect = 4.640e-54
Identity = 146/439 (33.26%), Postives = 212/439 (48.29%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMP-------------ALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTS----DDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPG-YFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQ 1327
            CY   G P+ C P  IN A  + IE+++TCGE      C +    + + HK+CE C   D   S     + D H     T W SE + E   +P  VNLTL L K   I+++ +      P+   IYK  SE+  W P+Q+++  C+ T+ +P             AL T   + +SDI+ L+    D E              I F+  +GR  G    ++   Q W+ AT+IRI+  L     +G+ L  + +  ++  Y +  SDI +G +  C+GHAS+ + ++    + T  CEC+H+T G DC++C   +ND  W  +T      CK C CN  + KC FD N+F ++G  HG  C+DC +N  GP C++C    Y R   Y       C  C C  VGS S   C+   GKC CKPGVTG  C  C   Y Q
Sbjct:   57 CYDPYGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFCIQ---TMNQNHKNCEFCKYNDHNPS----FLTDLHDPQSPTWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCT---SEYSDISPLR----DGE--------------IAFSTLEGRPSGINFERSGELQEWVTATDIRIT--LDRLNTFGDELFGDSQVLKS--YFYAISDIAVGARCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLFNRTG--HGGHCLDCRENRDGPNCERCKENFYMRDDGY-------CVNCACDPVGSRS-LQCNS-HGKCQCKPGVTGDKCDRCDNNYYQ 452          

HSP 2 Score: 78.9518 bits (193), Expect = 9.956e-15
Identity = 54/154 (35.06%), Postives = 73/154 (47.40%), Query Frame = 2
Query:  878 IRTSDDTYQC-ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNA-CKPCLCHSVGS----LSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            ++ ++DT  C EC     G  CE+C + F   P  +  +     CK C+CN +      D N      R  G  C+ C  NT G  CDQC  G+F     P+   +  C  C C+  G+     S T CDQV+G+C CKP V G+ C  C PGY
Sbjct:  802 LQINEDTVICTECPKGYFGSRCEQCSDGFFGDP--TGLLGEVQTCKSCDCNGN-----VDPNAVGNCNRTTGE-CLKCIHNTAGEHCDQCLSGHF---GDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGY 944          

HSP 3 Score: 72.0182 bits (175), Expect = 1.183e-12
Identity = 46/134 (34.33%), Postives = 64/134 (47.76%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHC 1309
            +C H+TAG+ C++C       P +    R    C RC C  +      D     +  ++ G     C  N +G  C +C PGYF      I   N C+ CLC  VGS + T CD+ SG+C C+PGV G+ C  C
Sbjct:  870 KCIHNTAGEHCDQCLSGHFGDPLALPHGR----CDRCSC--YEAGTEQDEQSITRCDQVTGQ--CQCKPNVIGRDCGECQPGYFN-----IRSGNGCENCLCDPVGSYNST-CDRYSGQCHCRPGVMGQRCDQC 989          
BLAST of Netrin-1a vs. Ensembl Fly
Match: LanB2 (Laminin B2 [Source:FlyBase gene name;Acc:FBgn0267348])

HSP 1 Score: 202.986 bits (515), Expect = 4.640e-54
Identity = 146/439 (33.26%), Postives = 212/439 (48.29%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMP-------------ALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTS----DDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPG-YFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQ 1327
            CY   G P+ C P  IN A  + IE+++TCGE      C +    + + HK+CE C   D   S     + D H     T W SE + E   +P  VNLTL L K   I+++ +      P+   IYK  SE+  W P+Q+++  C+ T+ +P             AL T   + +SDI+ L+    D E              I F+  +GR  G    ++   Q W+ AT+IRI+  L     +G+ L  + +  ++  Y +  SDI +G +  C+GHAS+ + ++    + T  CEC+H+T G DC++C   +ND  W  +T      CK C CN  + KC FD N+F ++G  HG  C+DC +N  GP C++C    Y R   Y       C  C C  VGS S   C+   GKC CKPGVTG  C  C   Y Q
Sbjct:   57 CYDPYGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFCIQ---TMNQNHKNCEFCKYNDHNPS----FLTDLHDPQSPTWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCT---SEYSDISPLR----DGE--------------IAFSTLEGRPSGINFERSGELQEWVTATDIRIT--LDRLNTFGDELFGDSQVLKS--YFYAISDIAVGARCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLFNRTG--HGGHCLDCRENRDGPNCERCKENFYMRDDGY-------CVNCACDPVGSRS-LQCNS-HGKCQCKPGVTGDKCDRCDNNYYQ 452          

HSP 2 Score: 78.9518 bits (193), Expect = 9.956e-15
Identity = 54/154 (35.06%), Postives = 73/154 (47.40%), Query Frame = 2
Query:  878 IRTSDDTYQC-ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNA-CKPCLCHSVGS----LSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            ++ ++DT  C EC     G  CE+C + F   P  +  +     CK C+CN +      D N      R  G  C+ C  NT G  CDQC  G+F     P+   +  C  C C+  G+     S T CDQV+G+C CKP V G+ C  C PGY
Sbjct:  802 LQINEDTVICTECPKGYFGSRCEQCSDGFFGDP--TGLLGEVQTCKSCDCNGN-----VDPNAVGNCNRTTGE-CLKCIHNTAGEHCDQCLSGHF---GDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGY 944          

HSP 3 Score: 72.0182 bits (175), Expect = 1.183e-12
Identity = 46/134 (34.33%), Postives = 64/134 (47.76%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHC 1309
            +C H+TAG+ C++C       P +    R    C RC C  +      D     +  ++ G     C  N +G  C +C PGYF      I   N C+ CLC  VGS + T CD+ SG+C C+PGV G+ C  C
Sbjct:  870 KCIHNTAGEHCDQCLSGHFGDPLALPHGR----CDRCSC--YEAGTEQDEQSITRCDQVTGQ--CQCKPNVIGRDCGECQPGYFN-----IRSGNGCENCLCDPVGSYNST-CDRYSGQCHCRPGVMGQRCDQC 989          
BLAST of Netrin-1a vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 311.612 bits (797), Expect = 6.558e-96
Identity = 186/593 (31.37%), Postives = 302/593 (50.93%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAES-ICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  NG P+ C P  +N A    + ASSTCG+  +   + TE  D+    H++C  C++ DPK +     + D +     TCW S+   +  YP +V LTL L K+  +++++++ C   P+ + I+K       W P+QY++  C+  +  P+  T T       N  + +C D    M    GG      LI F+   GR        +   Q+W+ AT+I++++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHASR ++  D    CEC+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI        ++S+     C+   + SK   +IN K++C K+   +V+I   +  G+W +F   I  V+ + +   R     L        WV    V C C   + G  YL++ N + +   GQ+ ++ ++  ++  W++TW  +  +F  ++K GKC +
Sbjct:   40 CYDENGHPRRCIPDFVNAAFGKEVRASSTCGKTPSRYCVVTEKGDE---RHRNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSDNYLQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKSWVPFQYYSTQCRKMYNKPSKATITKQ-----NEQEAICTDSHTDMHPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASRCVKDRDGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCIKIPIAPPTTTASSTEEPSDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKAGEWWKFTVNIISVYKQGESRIRRGDQFL--------WVRAKDVACKCPKIKSGKKYLLLGNDEDSP--GQSGMVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin-1a vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 311.612 bits (797), Expect = 6.558e-96
Identity = 186/593 (31.37%), Postives = 302/593 (50.93%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAES-ICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  NG P+ C P  +N A    + ASSTCG+  +   + TE  D+    H++C  C++ DPK +     + D +     TCW S+   +  YP +V LTL L K+  +++++++ C   P+ + I+K       W P+QY++  C+  +  P+  T T       N  + +C D    M    GG      LI F+   GR        +   Q+W+ AT+I++++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHASR ++  D    CEC+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI        ++S+     C+   + SK   +IN K++C K+   +V+I   +  G+W +F   I  V+ + +   R     L        WV    V C C   + G  YL++ N + +   GQ+ ++ ++  ++  W++TW  +  +F  ++K GKC +
Sbjct:   40 CYDENGHPRRCIPDFVNAAFGKEVRASSTCGKTPSRYCVVTEKGDE---RHRNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSDNYLQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKSWVPFQYYSTQCRKMYNKPSKATITKQ-----NEQEAICTDSHTDMHPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASRCVKDRDGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCIKIPIAPPTTTASSTEEPSDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKAGEWWKFTVNIISVYKQGESRIRRGDQFL--------WVRAKDVACKCPKIKSGKKYLLLGNDEDSP--GQSGMVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin-1a vs. Ensembl Zebrafish
Match: ntn2 (netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2])

HSP 1 Score: 296.975 bits (759), Expect = 2.983e-90
Identity = 177/599 (29.55%), Postives = 298/599 (49.75%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLL--REKRNAEN-----PVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLR-----HLVKSNSSCD-FCQ--RKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY   G  + C P  IN A    +  SS CG   + S C+        A ++C+ C++ DP+ +  +  + D +     TCW SE +  S  P +V LTL L K+  I++++++ C   P+ + IYK       W+P+Q+++  C+  +  P     T       N  + +C D    +    GG      LI F+   GR  G     +   Q+W+  T+IR+  + +  +H   L +  RE  +A       P Y++   D  +GG+  C+GHASR +R  D    CEC+H+T G +C++C     D+PW  AT +    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R     I H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  ++        +  + CD +C+  + + +IN K++C K+   +V++   E+ G W +F   +  V+ +++ DP     ++       +WVH   + C C     G  +L++ + + T    +  L  +++ ++  W++ W  +  +F  ++K GKC++
Sbjct:   35 CYEETGAARRCIPEFINAAFGQEVSVSSVCGRPVSRS-CSLVERDDRPAVRTCQICDASDPRNAHPASYLTDLNSAHNLTCWQSENLQSS--PLNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGRTWTPYQFYSSQCRRMYNRPNKAAITKQ-----NEQEALCTDGHTDLYPLSGG------LIAFSTLDGRPSGKDFDSSPVLQDWVTVTDIRV--VFSRPQHTRALPMSGRESEDALGAPGSLPTYYYAVGDFQVGGRCKCNGHASRCVREKDGKLLCECKHNTEGPECDRCKPFHYDRPWQRATGKEANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGKAITHRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVIKPTAVISTTEEPADCDSYCKPLKGNLKINMKKYCKKDYAVQVSVLDMETVGDWAKFSVSLMSVY-KSRGDPLKRGDHM-------LWVHMKDLACKCPRIHMGKRFLILGSTEGTANPERPGLQADKNSLVIQWRDIWTRRLRKFQRKEKKGKCSK 608          
BLAST of Netrin-1a vs. Ensembl Zebrafish
Match: ntn2 (netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2])

HSP 1 Score: 296.975 bits (759), Expect = 2.983e-90
Identity = 177/599 (29.55%), Postives = 298/599 (49.75%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLL--REKRNAEN-----PVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLR-----HLVKSNSSCD-FCQ--RKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY   G  + C P  IN A    +  SS CG   + S C+        A ++C+ C++ DP+ +  +  + D +     TCW SE +  S  P +V LTL L K+  I++++++ C   P+ + IYK       W+P+Q+++  C+  +  P     T       N  + +C D    +    GG      LI F+   GR  G     +   Q+W+  T+IR+  + +  +H   L +  RE  +A       P Y++   D  +GG+  C+GHASR +R  D    CEC+H+T G +C++C     D+PW  AT +    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R     I H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  ++        +  + CD +C+  + + +IN K++C K+   +V++   E+ G W +F   +  V+ +++ DP     ++       +WVH   + C C     G  +L++ + + T    +  L  +++ ++  W++ W  +  +F  ++K GKC++
Sbjct:   35 CYEETGAARRCIPEFINAAFGQEVSVSSVCGRPVSRS-CSLVERDDRPAVRTCQICDASDPRNAHPASYLTDLNSAHNLTCWQSENLQSS--PLNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGRTWTPYQFYSSQCRRMYNRPNKAAITKQ-----NEQEALCTDGHTDLYPLSGG------LIAFSTLDGRPSGKDFDSSPVLQDWVTVTDIRV--VFSRPQHTRALPMSGRESEDALGAPGSLPTYYYAVGDFQVGGRCKCNGHASRCVREKDGKLLCECKHNTEGPECDRCKPFHYDRPWQRATGKEANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGKAITHRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVIKPTAVISTTEEPADCDSYCKPLKGNLKINMKKYCKKDYAVQVSVLDMETVGDWAKFSVSLMSVY-KSRGDPLKRGDHM-------LWVHMKDLACKCPRIHMGKRFLILGSTEGTANPERPGLQADKNSLVIQWRDIWTRRLRKFQRKEKKGKCSK 608          
BLAST of Netrin-1a vs. Ensembl Zebrafish
Match: ntn1b (netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168])

HSP 1 Score: 291.967 bits (746), Expect = 1.428e-88
Identity = 180/602 (29.90%), Postives = 295/602 (49.00%), Query Frame = 2
Query:   44 LVALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAES-ICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNS-----SCD-FCQ--RKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTR-NQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
              A +     CY  NG+P+ C P  +N A    +  SSTCG   +   + TE   K  +  + C  C++ DPK +     + D +     TCW SE   +  YP +V LTL L K+  +++++++ C   P+ + I+K       W P+Q+++  C+  +  P+    T       N  + +C D    M    GG      LI F+   GR        +   Q+W+ AT+I++++       +G+    +   A +  Y +  SD+ +GG+  C+GHAS+ ++  +    CEC+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R  +  I H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI         +S      CD  C+  +   ++  K++C K+   +V++   +  G+W +F   I  V+ +   +  R  QL         +WV    V C C   + G  YL+M + +  +  GQ+ ++ ++  ++  WK+ W  +  +F  +DK GKC
Sbjct:   30 FAAQSSPPDPCYDENGNPRRCIPDFVNSAFGKDVRVSSTCGSPPSRYCVVTE---KGEERSRDCNICDATDPKKTHPPAYLTDLNNPHNLTCWQSENYVQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKTWVPFQFYSTQCKKMYNKPSKAAITKQ-----NEQEAICTDSHTDMQPLTGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTFNRL--HTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKAISHRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAAPTSSYSSPDGPTDCDSHCKAPKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGGHRIRRGDQL---------LWVRAKDVACKCPKIKPGRKYLLMGSDEEEDSRGQSGVVADRGSLLIPWKDLWARRLRKFQQRDKRGKC 602          
BLAST of Netrin-1a vs. Ensembl Xenopus
Match: ntn1 (netrin 1 [Source:Xenbase;Acc:XB-GENE-989335])

HSP 1 Score: 296.59 bits (758), Expect = 1.657e-90
Identity = 180/593 (30.35%), Postives = 289/593 (48.74%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAES-ICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNS-----SCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  NG+P+ C P  +N A    +  S TCG+  +   + TE   K     ++C  CN+ DPK +     + D +     TCW SE   +  YP +V LTL L K+  +++++++ C   P+ + I+K       W P+Q+++  C+  +  P     T       N  + +C D    M    GG      LI F+   GR        +   Q+W+ AT+I++  + +    +G+    +   A +  Y +  SD+ +GG+  C+GHASR ++  DD   C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  +F  SGR  G  C++C  NT G  C  C  GY+R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  +     ++S      CD   + SK   +IN K++C K+   +         G W +F   +  V+ +     R    NL        W+    + C C   +    YL++ N + +    Q  ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   43 CYDENGNPRRCIPDFVNSAFGKEVRVSGTCGKPPSRYCVVTE---KGEDRFRNCHICNTSDPKRAHPPSFLTDLNNPHNLTCWQSENYIQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKSWVPFQFYSTQCRKMYNKPNKAIITKQ-----NEQEAICTDSHTDMHPLSGG------LIAFSTLDGRPTAHDFDNSPVLQDWVTATDIKV--VFSRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASRCVKDRDDNLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELFKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVVPPTTAASSMEEPADCDAYCKASKGKLKINMKKYCKKDYANQQRFMKANRSGDWWKFTVNVISVYKQGTNRIRRGDQNL--------WIRAKDIACKCPKLKPTKKYLLLGNDEDSP--DQNGVVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 605          
BLAST of Netrin-1a vs. Ensembl Xenopus
Match: ntn1 (netrin 1 precursor [Source:RefSeq peptide;Acc:NP_001072385])

HSP 1 Score: 293.123 bits (749), Expect = 2.948e-89
Identity = 181/590 (30.68%), Postives = 289/590 (48.98%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISE-GVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFR-LIPFNPRQGRSFGDVL--SKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPC------RKISKLRHLVKSNSSCDFCQRKSKRI--NFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY A   PK C P  IN+A    +  S+TCG    + +C  + D      + C+ C+   P+ S     + D+     +TCW SE G+   ++P +V LTL L +R  + + ++  C   PD + IYK       W P+Q+++  C+  +        T +  S     +  C D +      G + L + L+ F P  GR        S   Q+W+ AT+IR+ +    + H+G  +   ++ A      +G S+I +GG+  C+GHASR      +   CECQH+T G +C+ C   + D+PW  AT  N   C  CECN HS +C F+  ++  SGR  G  C++C  NT G  C  C  GY R  + PI  + ACKPC CH +G+++   C+Q +G+C CK GVTG TC  CAPGY+Q+ S   PC      +  S L ++ +S     +C+    R+  N +++C K+   +  + S E  G+W +F + +  V+ + +   R     L        WV    + C C+  + G SYL++ N    E      LIL+++ +   W++ W  +  +F  Q++ GKC
Sbjct:   42 CYDAKQRPKYCIPDFINVALGQEVITSNTCGRT-PQKLCY-FLDSTNVTSRRCQLCDQKRPENSYPPSYMTDTDA---QTCWKSESGI---TFPQNVTLTLPLGRRFELVYASLRFCSPRPDSMAIYKSMDYGKTWIPFQFYSTHCRRVYDQ-----ATTSAISKPMQHEATCTDFQT-----GVKPLTKGLVAFMPLAGRPSARRFEYSPVLQDWVTATDIRVVFN---RLHHGKKMGIRRKTA-----FYGVSEIQVGGRCKCNGHASRCT-AGKEGLMCECQHNTIGPECDACKPFYYDRPWQRATPSNAHECVACECNLHSHRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKQGYKRDLSKPITSRKACKPCQCHPIGAVNAM-CNQTTGQCQCKTGVTGPTCNRCAPGYQQSRSAHMPCVRKPVMKMWSGLDNISQSTECQSYCKPSHSRVHMNLRKYCKKDYVLRAQLLSMEKSGEWWQFTATVLTVYRQRRVPIRRGDQPL--------WVPDHDLACDCLRVQVGKSYLIIGN--DEESPDPARLILDKNSLALPWRDVWGHKLRRFQQQERRGKC 593          
BLAST of Netrin-1a vs. Ensembl Xenopus
Match: ntn1 (netrin 1 precursor [Source:RefSeq peptide;Acc:NP_001072385])

HSP 1 Score: 290.041 bits (741), Expect = 4.993e-88
Identity = 181/595 (30.42%), Postives = 289/595 (48.57%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISE-GVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFR-LIPFNPRQGRSFGDVL--SKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKS----------NSSCD-FCQRKSKRI--NFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY A   PK C P  IN+A    +  S+TCG    + +C  + D      + C+ C+   P+ S     + D+     +TCW SE G+   ++P +V LTL L +R  + + ++  C   PD + IYK       W P+Q+++  C+  +        T +  S     +  C D +      G + L + L+ F P  GR        S   Q+W+ AT+IR+ +    + H+G  +   ++ A      +G S+I +GG+  C+GHASR      +   CECQH+T G +C+ C   + D+PW  AT  N   C  CECN HS +C F+  ++  SGR  G  C++C  NT G  C  C  GY R  + PI  + ACKPC CH +G+++   C+Q +G+C CK GVTG TC  CAPGY+Q+ S   PC +I +      S           + C  +C+    R+  N +++C K+   +  + S E  G+W +F + +  V+ + +   R     L        WV    + C C+  + G SYL++ N +  E      LIL+++ +   W++ W  +  +F  Q++ GKC
Sbjct:   42 CYDAKQRPKYCIPDFINVALGQEVITSNTCGRT-PQKLCY-FLDSTNVTSRRCQLCDQKRPENSYPPSYMTDTDA---QTCWKSESGI---TFPQNVTLTLPLGRRFELVYASLRFCSPRPDSMAIYKSMDYGKTWIPFQFYSTHCRRVYDQ-----ATTSAISKPMQHEATCTDFQT-----GVKPLTKGLVAFMPLAGRPSARRFEYSPVLQDWVTATDIRVVFN---RLHHGKKMGIRRKTA-----FYGVSEIQVGGRCKCNGHASRCT-AGKEGLMCECQHNTIGPECDACKPFYYDRPWQRATPSNAHECVACECNLHSHRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKQGYKRDLSKPITSRKACKPCQCHPIGAVNAM-CNQTTGQCQCKTGVTGPTCNRCAPGYQQSRSAHMPCVRIQEEMTTTASYPQEWKAGTNGTECQSYCKPSHSRVHMNLRKYCKKDYVLRAQLLSMEKSGEWWQFTATVLTVYRQRRVPIRRGDQPL--------WVPDHDLACDCLRVQVGKSYLIIGNDE--ESPDPARLILDKNSLALPWRDVWGHKLRRFQQQERRGKC 598          
BLAST of Netrin-1a vs. Ensembl Xenopus
Match: ntn3 (netrin 3 [Source:Xenbase;Acc:XB-GENE-960264])

HSP 1 Score: 281.182 bits (718), Expect = 7.653e-85
Identity = 176/596 (29.53%), Postives = 290/596 (48.66%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKL----------RHLVKSNSSCD-FCQ--RKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVK-TTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY  +G P+ C P  +N A    ++ASSTCG             +L   H     C++ DP+ S  +  + D +  G  TCW SE     S   +V+LTL L K+  +++++++ C   P+ + I+K       W P+QY++  C+  +  P+  + T       N  + +C D +  +    GG      LI F+   GR     L  +   Q+WL AT+IR+ +    + H       E R+ E P +++   +  +GG+  C+GHASR ++  +    C+C+H+T G +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R  +  I  + ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  +              K    C+ +C+  + + +IN K++C K+   +VN+   E  G W +F   I  V+    +D R+ + +        +W+H   + C C        YLVM + +  +E  G   L  +++ ++  W++ W  +  +   ++K GKC
Sbjct:   35 CYDEHGLPRRCVPEFVNAAFNKEVQASSTCG-------------RLATRH-----CDTTDPRKSYPASYLTDLNTAGNMTCWRSETFPRHS-SQNVSLTLSLGKKFEVTYVSLQFCSPRPESVAIFKSMDYGKSWVPYQYYSSQCRKVYGKPSRASVTKQ-----NEQEALCTDGQTELYPLTGG------LIAFSTLDGRPSAQDLDNSPVLQDWLTATDIRVFF---SRPHLLGNKESEARD-EGPCFYYSVGEFQVGGRRQCNGHASRCVKDKEARLICDCKHNTEGPECDRCKPFHYDRPWQRATAREANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPTPALTSTEEPAGKEGQDCEQYCKPPKGNYKINLKKYCKKDFVVQVNVLEMEMVGSWAKFTVNILSVY--KCRDDRIKRGD------NFLWIHIKDLSCKCPKILLSRRYLVMGSSEGPSERPG---LTADKNSMVIQWRDAWTRRLRKLQRREKKGKC 584          
BLAST of Netrin-1a vs. Ensembl Xenopus
Match: lamc1 (laminin, gamma 1 [Source:Xenbase;Acc:XB-GENE-478553])

HSP 1 Score: 207.223 bits (526), Expect = 9.820e-56
Identity = 139/439 (31.66%), Postives = 216/439 (49.20%), Query Frame = 2
Query:   53 LNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFK-------------MPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +   +  CY   G P+ C P  +N A    + A++TCG    E  C +    +    KSC  C+S    L   ++ + D + + + T W S+ +     YP+++NLTL L K   I+++ ++     P+   +YK   E   W P+QY++  C+ T++               AL TD    FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ AT+IR++  L     +G+ +  + +  ++  Y++  SD  +GG+  C+GHAS  +R   +   C C+H+T G DCEKC   +ND+PW  +T  +P  C  C CN  S +C FD  ++  +G  HG  C  C DNT GP C++C   Y+RQ      +   C  C C+ VGSLS T CD   G+C CKPGV G+ C  C PG+
Sbjct:   17 VRAAMDECYE-EGSPQRCMPEFVNAAFNATVVATNTCG-TPPEEYCVQT--GVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTMLAGIQYPSTINLTLHLGKAFDITYVRLKFHTSRPESFALYKRTHEDGPWIPYQYYSGSCEKTYQKFNRGFIRTGEDEQQALCTDE---FSDISPLT------------GGN------VAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVT--LNRLNTFGDEVFSDPKVLKS--YYYAISDFAVGGRCKCNGHASECVRNEFEKIVCNCKHNTFGSDCEKCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELYRSTG--HGGHCTGCADNTDGPNCERCRENYYRQD-----NNEPCHACQCNPVGSLS-TQCDNY-GRCSCKPGVMGEKCDRCQPGF 417          

HSP 2 Score: 69.707 bits (169), Expect = 4.267e-12
Identity = 48/161 (29.81%), Postives = 75/161 (46.58%), Query Frame = 2
Query:  848 PLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKN--ACKPCLCHSVGSLSG-TPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            P   G +  ++  + +     C   T GK CE C + +   P        P  C+ CEC+N+      D N      R+ G  C+ C  NT G  CD+C  G++     P+       C+ C C+  G++ G + C+QV+G+C C P VT + C+ C PG+
Sbjct:  757 PCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRP--CRICECSNN-----IDPNAVGNCDRLTGE-CLKCIYNTGGFYCDRCRDGFY---GNPLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCSACEPGF 906          

HSP 3 Score: 63.929 bits (154), Expect = 2.286e-10
Identity = 42/139 (30.22%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAV-CKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +C ++T G  C++C + F   P +    +NP + C+ C CN +         V  +SG    +   +C  +     C  C PG+     Y +     C+ C CHS+GS SG  CD  +G+C C PG++G+ C  C P +
Sbjct:  834 KCIYNTGGFYCDRCRDGFYGNPLA----QNPDLKCRACSCNPYGT-------VKGQSGCNQVTGQCECLPHVTERDCSACEPGF-----YNLLSGRGCERCDCHSLGSTSGQ-CDVRTGQCECHPGISGQQCQQCEPNH 955          
BLAST of Netrin-1a vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 301.212 bits (770), Expect = 6.227e-92
Identity = 184/606 (30.36%), Postives = 300/606 (49.50%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CNS DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y++  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   ++N K++C K+   +++I   +  G W +F   I  V+   Q   R+ + +       S+W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVY--KQGTSRIRRGD------QSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin-1a vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 301.212 bits (770), Expect = 6.227e-92
Identity = 184/606 (30.36%), Postives = 300/606 (49.50%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CNS DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y++  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   ++N K++C K+   +++I   +  G W +F   I  V+   Q   R+ + +       S+W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVY--KQGTSRIRRGD------QSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin-1a vs. Ensembl Mouse
Match: Tbc1d24 (TBC1 domain family, member 24 [Source:MGI Symbol;Acc:MGI:2443456])

HSP 1 Score: 253.832 bits (647), Expect = 1.844e-74
Identity = 162/585 (27.69%), Postives = 265/585 (45.30%), Query Frame = 2
Query:   50 ALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQ--RKSKRINFKRFCSKETNFKVNIKSR-ESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTE----LILNQSDVIEDWKETW 1759
             L      CY    +P+ C P L+N A    + ASSTCG +                      C+S DP+ + S+ ++  +       CW S+ + ++  P +V LT+ L K   + F+++  C   P  + + K       W P  +F+  C L + ++PA          +      +CF   ++   GG      L+ F+ + G   G  L  +   Q+W+ AT+IRI  +LT     G+     +       Y + ++++ +GG+  C+GHASR +  +     C+CQH T G DC +C   + D+PW  AT +    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R     +  + AC+ C CH VG+ +G  C+Q +G+C CK GVTG TC  CAPG++Q+ S   PC K      ++    V+       C+  R S RI+ K+FC K+   +V + +R E+RG W RF   +  V+   ++  R           +++WV      CGC     G  YL++                 L   +  ++  W++ W
Sbjct:   22 GLPASADPCYDEAREPRSCIPGLVNAALGREVLASSTCGRSANRV------------------CDSSDPQRAHSADLLTSAPGTASPLCWRSDLLQQA--PFNVTLTVPLGKAFELVFVSLRFCSAPPTSVALLKSQDHGRSWVPLGFFSSSCTLDYGRLPAPADGPSGPGPEA-----LCFPAPQAQPDGGG-----LLAFSVQDGSPQGLDLDNSPVLQDWVTATDIRI--VLTRPAIQGD----TRDGGVTVPYSYSATELQVGGRCKCNGHASRCLLDTHGHLVCDCQHGTEGPDCSRCKPFYCDRPWQRATGQEAHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRVLSDRRACRACDCHPVGA-AGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKTPVPGPTEESSPVEPQDCESHCRPARGSYRISLKKFCRKDYAVQVAVGARGEARGSWTRFPVAVLAVFRSGEERARRGS--------SALWVPTLDAACGCPRLLPGRRYLLLGGGPGAAAGSTAGRGQGLSAARGSLVLPWRDAW 561          
BLAST of Netrin-1a vs. Ensembl Mouse
Match: Lamc1 (laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914])

HSP 1 Score: 211.846 bits (538), Expect = 6.554e-57
Identity = 140/439 (31.89%), Postives = 215/439 (48.97%), Query Frame = 2
Query:   53 LNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-------------KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +   +  C    G P+ C P  +N A  + + A++TCG    E  C +    +    KSC  C++    L   +  + D + +   T W S+ +     YP S+NLTL L K   I+++ ++     P+   IYK   E   W P+QY++  C+ T+             +  AL TD    FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ AT+IR++  L     +G+ +  + +  ++  Y++  SD  +GG+  C+GHAS  ++   D   C C+H+T G DCEKC   FND+PW  AT  + + C  C+CN  S +C FD  ++  +G  HG  C +C DNT G +C++C   +FR     + +  AC PC C  VGSLS T CD   G+C CKPGV G  C  C PG+
Sbjct:   31 VRAAMDECADEGGRPQRCMPEFVNAAFNVTVVATNTCG-TPPEEYCVQT--GVTGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDE---FSDISPLT------------GGN------VAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVT--LNRLNTFGDEVFNDPKVLKS--YYYAISDFAVGGRCKCNGHASECVKNEFDKLMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG--HGGHCTNCRDNTDGAKCERCRENFFR-----LGNTEACSPCHCSPVGSLS-TQCDSY-GRCSCKPGVMGDKCDRCQPGF 432          

HSP 2 Score: 76.2554 bits (186), Expect = 8.719e-14
Identity = 52/160 (32.50%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  848 PLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEE-FNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSG-TPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            P   G +  I+  + +     C   TAGK CE C +  F D   S+  +R   +C+ C+CN++      D N      R+ G  C+ C  NT G  CD+C  G+F     P    + CK C C+  G++   + C+ V+G+C C P V+G+ C  C PGY
Sbjct:  772 PCPGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVR---LCRPCQCNDN-----IDPNAVGNCNRLTGE-CLKCIYNTAGFYCDRCKEGFFGNPLAP-NPADKCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGY 921          

HSP 3 Score: 62.7734 bits (151), Expect = 1.255e-9
Identity = 45/135 (33.33%), Postives = 65/135 (48.15%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPA-VCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHC 1309
            +C ++TAG  C++C E F   P +     NPA  CK C CN +         V  +S     +    C  +  G  C  C PGY     Y +     C+ C CH++GS +G  CD  +G+C C+PG+TG+ C  C
Sbjct:  849 KCIYNTAGFYCDRCKEGFFGNPLAP----NPADKCKACACNPYGT-------VQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGY-----YNLQSGQGCERCDCHALGSTNGQ-CDIRTGQCECQPGITGQHCERC 966          
BLAST of Netrin-1a vs. Ensembl Mouse
Match: Lamc3 (laminin gamma 3 [Source:MGI Symbol;Acc:MGI:1344394])

HSP 1 Score: 206.068 bits (523), Expect = 5.276e-55
Identity = 141/437 (32.27%), Postives = 202/437 (46.22%), Query Frame = 2
Query:   50 ALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVH-ESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPA----------LTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            A   ++ +CY   G  + C P   N A     EAS TCG    E  C         A   C++C+  DP     +  + D H     T W S  +     YPTSVNLTL L K   I+++ ++     P+   IYK    +  W P+QY++  CQ T+  P                 + FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ +T+I IS  L     +G+ + ++ R  ++  Y++  SD  +GG+  C+GHAS     +     C CQH+T G DCE+C   F D+PW+  T  +   C  C C+ HS +C FD  ++  +G  HG  C  C D+T GP C++C   Y+R        K  C+PC CH  GSLS   CD  SG C CKP VTG  C  C PG+
Sbjct:   26 AAGADMGSCYDGVGRAQRCLPEFENAAFGRRAEASHTCGRP-PEDFCPHVGAP--GAGLQCQRCDDADPGRRHDASYLTDFHSPDDSTWWQSPSMAFGVQYPTSVNLTLSLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTYGRPEGHYLRPGEDERVAFCTSEFSDISPLN------------GGN------VAFSTLEGRPSAYNFEESPVLQEWVTSTDILIS--LDRLNTFGDDIFKDPRVLQS--YYYAVSDFSVGGRCKCNGHASECEPNAAGQLACRCQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTG--HGGHCQRCRDHTTGPHCERCEKNYYRWSP-----KTPCQPCDCHPAGSLS-LQCDN-SGVCPCKPTVTGWKCDRCLPGF 428          

HSP 2 Score: 76.6406 bits (187), Expect = 5.907e-14
Identity = 48/157 (30.57%), Postives = 71/157 (45.22%), Query Frame = 2
Query:  866 ASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNS 1336
            A   I  S D     C     G+ CE C + F   P   +    P  C+RC+C+ +      D N  + +   H   C+ C  NT G  C+ C  G++   A      + C PC C   GS+S   C+ V+G+C C P V+G+ C+ C+PG+    S
Sbjct:  774 ACATIPESGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQP--CRRCQCSGN-----VDLNA-VGNCDPHSGHCLRCLYNTTGAHCEHCREGFYGS-AVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVCLPYVSGRDCSRCSPGFYDLQS 921          

HSP 3 Score: 59.6918 bits (143), Expect = 1.200e-8
Identity = 43/138 (31.16%), Postives = 61/138 (44.20%), Query Frame = 2
Query:  911 CQHSTAGKDCEKCHEEFNDQPWSSATIRNPA-VCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            C ++T G  CE C E F    + SA    P   C  C C+          +V  K+       C+ C     G  C +C+PG+     Y +     C+ C CH +GSL    C   +G+C C+PGVTG+ C  C  G+
Sbjct:  846 CLYNTTGAHCEHCREGF----YGSAVATRPVDKCAPCSCD-------LRGSVSEKTCNPVTGQCV-CLPYVSGRDCSRCSPGF-----YDLQSGRGCQSCKCHPLGSLENK-CHPKTGQCPCRPGVTGQACDRCQLGF 965          
BLAST of Netrin-1a vs. UniProt
Match: sp|P34710|UNC6_CAEEL (Netrin unc-6 OS=Caenorhabditis elegans GN=unc-6 PE=1 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 2.581e-94
Identity = 190/598 (31.77%), Postives = 297/598 (49.67%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYI-LTP--KEHYG-----NLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQK 1828
            C+   G P  C P  IN A    + AS TCG N  +  CT      G   + C+ C++ +   S  + ++ D +  G  TCW+S     S  P +V+LTL L K+  ++++++  C   PD + +YK       W+P+Q+++ +C+  F       D   + +  N  + VC      M  GG+   F  +   P   ++F +  S   Q+W+ AT+I++ +  L+P   E YG     N    E  +     Y +   ++ +GG+  C+GHASR I      Y C+C+H+TAG +CE C     D+PW  AT  +   C  C CN H+ +C FD  +F  SG   G  C++C  NT G  C  C PG+ R  + P+ H+ ACK C CH VGSL G  C+Q SG+C CKPGVTG TC  CA GY+Q+ S   PC KI      + S+ S     C  C+   KR+N K+FC ++   ++ + SRE    W ++   +E V+ R  +       N++  E TS+W+    V C C     G  YL++   K      +  L++N   V+ +W++   ++  +F  +DK+G+C   T  +
Sbjct:   37 CHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVST---PSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGR-----DPDVSITKSNEQEAVC-TASHIMGPGGNRVAFPFLENRP-SAQNFEN--SPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSL-GKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTE-------NMQRGE-TSLWISPQGVICKCPKLRVGRRYLLLG--KNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHR 611          
BLAST of Netrin-1a vs. UniProt
Match: sp|O95631|NET1_HUMAN (Netrin-1 OS=Homo sapiens GN=NTN1 PE=1 SV=2)

HSP 1 Score: 301.982 bits (772), Expect = 2.936e-91
Identity = 185/606 (30.53%), Postives = 299/606 (49.34%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CN+ DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   +IN K++C K+   +++I   +  G W +F   I  V+   Q   R+ + +       S+W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVY--KQGTSRIRRGD------QSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin-1a vs. UniProt
Match: sp|O09118|NET1_MOUSE (Netrin-1 OS=Mus musculus GN=Ntn1 PE=1 SV=3)

HSP 1 Score: 301.212 bits (770), Expect = 4.850e-91
Identity = 184/606 (30.36%), Postives = 300/606 (49.50%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CNS DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y++  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   ++N K++C K+   +++I   +  G W +F   I  V+   Q   R+ + +       S+W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVY--KQGTSRIRRGD------QSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin-1a vs. UniProt
Match: sp|Q90922|NET1_CHICK (Netrin-1 OS=Gallus gallus GN=NTN1 PE=1 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 5.345e-90
Identity = 181/593 (30.52%), Postives = 297/593 (50.08%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAES-ICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  +G P+ C P  +N A    ++ SSTCG+  +   + TE   K  +  +SC  CN+ DPK +     + D +     TCW S+   +  YP +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P+    T       N  + +C D    +    GG      LI F+   GR        +   Q+W+ AT+I++++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHASR +R  DD   C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI            +  + CD   + SK   +IN K++C K+   +++I   E    W +F   I  V+ +     R            ++WVH   + C C   +    YL++ +  T +   Q+ +I ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   43 CYDEHGLPRRCIPDFVNSAFGKEVKVSSTCGKPPSRYCVVTE---KGEEQVRSCHLCNASDPKRAHPPSFLTDLNNPHNLTCWQSDSYVQ--YPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYSTQCRKMYNKPSRAAITKQ-----NEQEAICTDSHTDVRPLSGG------LIAFSTLDGRPTAHDFDNSPVLQDWVTATDIKVTF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASRCVRDRDDNLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKECDCHPVGA-AGQTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPAAPPPTAASSTEEPADCDSYCKASKGKLKINMKKYCKKDYAVQIHILKAEKNADWWKFTVNIISVYKQGSNRLRRGD--------QTLWVHAKDIACKCPKVKPMKKYLLLGS--TEDSPDQSGIIADKSSLVIQWRDTWARRLRKFQQREKKGKCRK 605          
BLAST of Netrin-1a vs. UniProt
Match: sp|Q2HXW4|NET1_PIG (Netrin-1 OS=Sus scrofa GN=NTN1 PE=2 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 9.801e-90
Identity = 183/600 (30.50%), Postives = 292/600 (48.67%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDK 1795
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CN+ DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GYFR    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   +IN K++C K+   +++I   +  G W +F   I  V+ +     R    NL        W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYFRDLGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGVTCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGASRIRRGDQNL--------WIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREK 597          
BLAST of Netrin-1a vs. TrEMBL
Match: tr|A0A0K0EM36|A0A0K0EM36_STRER (Uncharacterized protein OS=Strongyloides stercoralis PE=4 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 8.379e-97
Identity = 185/588 (31.46%), Postives = 305/588 (51.87%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVY-------HFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLV--KSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTS-MWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY ++G P  C P  IN A    + ASSTCG NG    CT   +  G   + C+ C++     +  + ++ D +     TCWISE   + +   +V LT+ L K+  +++I+++ C   PD + IYK      +W P+Q+++  C     M     D  +T S  N  + +C +   +M        F  +   P    +F    S   Q+W+ AT+IRI +      +     + +  N  + +        ++  +++ +GG+  C+GHASR I      Y C+C+H+TAG DCE+C     D+PW+ AT  +   C  C CN H+ KC F+  ++  SG   G  CI+C  NT G  C  C PGY+R +   I H+ ACK C CH VGSLS + C+Q SG+C CKPGVTG+TC  CA GY+Q+ + + PC KI  +   +  K+N +CD C+   KR+NF+++C ++  F+  I SRE    ++++   IE+V+ +N         + +  +G++ +W+ + +  C C     G  Y+++       +  Q+EL ++   ++ DW ET  E+ ++F  ++K G+C
Sbjct:    9 CYDSSGRPIRCVPDFINAAFGKPVIASSTCGVNGPSRYCTIRENTNGLIREVCDICDNKVKNKAHPASLLTDLNNARNLTCWISEPSIDKN--ENVTLTVSLGKKFELTYISMQFCNKIPDSMAIYKSVDGGKNWIPFQFYSSQC-----MEMYQRDVKDTISPKNEQEAICTN-SHTMSPTASRVAFATLEGRPS---AFRFEQSPILQDWVTATDIRIVFNKPSTFNEQLYAVSDSNNITDDMSGDMIAKSYYSMAELAVGGRCKCNGHASRCIYDKKGQYTCDCKHNTAGNDCERCKPFHYDRPWARATSESANACVACNCNLHARKCRFNAELYRLSGNKSGGICINCRHNTAGRNCHYCKPGYYRDNTKAITHRRACKACGCHLVGSLSKS-CNQTSGQCICKPGVTGQTCNRCAKGYQQSRNPQMPCIKIPTVTQSIIPKNNVNCDKCKVSPKRVNFRKYCKRQHAFQFYIISREILTDYVKYEISIEKVYKKN---------DYKIKKGSNYLWLPEKMAICKCPKLRIGQRYIILGTNNAKNYK-QSELYIDNHSIVVDWSETHVERMARFVRREKNGEC 574          
BLAST of Netrin-1a vs. TrEMBL
Match: tr|A0A090LSV4|A0A090LSV4_STRRB (Netrin-1a OS=Strongyloides ratti GN=SRAE_X000060400 PE=4 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 8.648e-97
Identity = 187/588 (31.80%), Postives = 302/588 (51.36%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVY-------HFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI--SKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCN 1810
            CY ++G P  C P  IN A    + ASSTCG NG    C    +  G   + C+ C++     +  + ++ D +     TCWISE     +   +V LT+ L K+  +++I+++ C   PD + IYK      +W P+Q+++  C     M     D  +T S  N  + +C +   +M        F  +   P    +F    S   Q+W+ AT+IRI +      +     + +  N  + +        ++  +++ +GG+  C+GHASR I      Y C+C+H+TAG DCE+C     D+PW+ AT  +   C  C CN H+ KC F+  ++  SG   G  CI+C  NT G  C  C PGY+R +   I H+ ACK C CH VGSLS + C+Q SG+C CKPGVTG+TC  CA GY+Q+ + + PC KI  S    + KSN +C+ C+   KR+NF++FC ++  F+  I SRE    ++++   IE+V+ +N  D ++ +          +W+ + +  C C     G  Y+++      +   Q+EL +N   ++ DW ET  E+ ++F  ++K G+C+
Sbjct:    9 CYDSSGRPIRCVPDFINAAFGKPVIASSTCGVNGPSKFCAIRENVNGLIREVCDICDNTIKSKAHPASLLTDLNNARNLTCWISEPSINKN--ENVTLTVSLGKKFELTYISMQFCNKIPDSMAIYKSVDNGKNWIPFQFYSSQC-----MEMYQRDVKDTISPKNEQEAICTN-SHTMSPTASRVAFATLEGRPS---AFRFEQSPILQDWVTATDIRIIFNKPSTFNEQLYAITDSNNITDDISNDMIAKSYYSMAELAVGGRCKCNGHASRCIYDKKGQYTCDCKHNTAGNDCERCKPFHYDRPWARATSESANACVACNCNLHARKCRFNAELYRLSGNKSGGICINCRHNTAGRNCHYCKPGYYRDNTKAITHRRACKACGCHLVGSLSKS-CNQTSGQCICKPGVTGQTCNRCAKGYQQSRNPQMPCIKIASSTQNSIPKSNINCEKCKISPKRVNFRKFCKRQHVFQFYIISREIMTDYVKYEISIEKVYKKN--DYKIKK------GPNYLWLPEKMAICKCPKLRIGQRYMILG-TNNDQDNKQSELYINSHSIVVDWTETLVERMARFVKREKNGECD 575          
BLAST of Netrin-1a vs. TrEMBL
Match: tr|V4AN98|V4AN98_LOTGI (Uncharacterized protein OS=Lottia gigantea GN=LOTGIDRAFT_201560 PE=4 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 3.881e-96
Identity = 185/587 (31.52%), Postives = 302/587 (51.45%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI--SKLRHLVKSNS---SCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCN 1810
            CY  + +PK C P  +N A  M + ASSTCG   +   C    DK GK  ++C  C++  PK    SK + D +     TCW+SE   +  YP +V LTL L K+  +++I+++ C   PD + IYK       W P+QY++ +C+  + K P+         +  N  + +C +   ++D     +    + F+  +GR        +   Q+W+ AT+I++  +      YG+    E+   E+  Y++  SD  +GG+  C+GHAS+ I   +    C+C+H+TAG DCE+C     D+PWS A+ R    C  C CN H+ +C F+  ++  SG   G  C+ C  NT G  C+ C  GY+R  + PI H+ ACK C CH VG+L G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  + +R   +  +   SC  C+++S+R++ K+FC ++      + SRE    W++F   +   + R       S ++     GT +WV K  + C C        YL++   K  +   ++  ++++  V+  WK+ W+ +  +F   ++ GKC+
Sbjct:   12 CYE-DSNPKRCIPDFVNAAFGMEVVASSTCGSPPSR-YCKSTTDKEGKIIRNCFICDANHPKRKHPSKYLTDLNNPNNLTCWMSEPFVQ--YPNNVTLTLSLGKKYELTYISLQFCSARPDSMTIYKSVDYGKTWIPFQYYSSNCKEMYNKAPSAIV------TKANEQEALCTEAYSNIDPLSGAR----VAFSTLEGRPSAYAFDHSPVLQDWVTATDIKV--VFNKLNTYGDEEKDEEGARES--YYYSLSDFAVGGRCKCNGHASQCIPLKNGRLGCDCKHNTAGDDCERCKPFHYDRPWSRASAREANECVACNCNLHARQCRFNMELYTLSGYKSGGVCLKCRHNTAGRNCNYCKEGYYRDRSKPITHRKACKACDCHPVGAL-GKTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSKSPIAPCIKIPVTDMRGPNRQPTQEDSCKKCKKRSRRLSIKKFCRRDFAIHAQVVSREKVDDWVKFTINVLNSYKRG-----TSPIDRARRGGTYLWVPKKDLQCKCPKIRLSRRYLIVGKHKRND--SRSGFVIDRKSVVIRWKDKWQRRLRRFVKHERRGKCH 572          
BLAST of Netrin-1a vs. TrEMBL
Match: tr|A0A0N5C6U6|A0A0N5C6U6_STREA (Uncharacterized protein OS=Strongyloides papillosus PE=4 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 4.090e-96
Identity = 187/587 (31.86%), Postives = 298/587 (50.77%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPT-SVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVY-------HFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-SKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY ++G P  C P  IN A    + ASSTCG NG    C       G   + C+ C+      S  + ++ D +     TCWISE    S  P  SV LT+ L K+  +++I+++ C    D + IYK      +W P+Q+++  C     M     ++ +T S  N  + +C +   S+        F  +   P    +F    S   Q+W+ AT+IRI +      +    ++ +  N  + +        ++  +++ +GG+  C+GHASR I      Y C+C+H+TAG DCE+C     D+PW+ AT  +   C  C CN H+ KC F+  ++  SG   G  CI+C  NT G  C  C PGY+R +   I H+ ACK C CH VGSLS + C+Q SG+C CKPGVTG+TC  CA GY+Q+ + + PC KI S    ++K+N  C+ C+   KR+NFK+FC ++  F+  I SRE    ++++   IE+++ +N    R             +W+ + +  C C     G  Y+++      ++  ++EL +N   ++ DW ET  E+ ++F  ++K G C
Sbjct:    9 CYDSSGRPIRCVPDFINAAFGKPVIASSTCGVNGPSKFCAIRESANGLIREVCDICDGAIKSKSHPASLLTDLNNARNLTCWISE---PSINPNESVTLTVSLGKKFELTYISMQFCNRIADSMAIYKSVDGGKNWIPFQFYSSQC-----MEVYGRESKDTISPKNEQEAICTN-SHSLSPTASRVAFATLEGRPS---AFRFEQSPILQDWVTATDIRIVFNKPSAMNEQLYVISDSNNITDEISNDMIAKSYYSMAELAVGGRCKCNGHASRCIYDKKGQYTCDCKHNTAGNDCERCKPFHYDRPWARATSESANACVACNCNLHARKCRFNGELYRLSGNKSGGICINCRHNTAGRNCHYCKPGYYRDNTKAITHRRACKACGCHIVGSLSKS-CNQTSGQCICKPGVTGQTCNRCAKGYQQSRNPQTPCIKIPSPQEGVLKNNVVCEKCKVSPKRVNFKKFCKRQHAFQFYIISREIVADYVKYEISIERIFKKNDYKIR--------KGAQFLWLPEKMAICKCPKLRTGQRYIILGTNNLRDYK-RSELYINNHSIVVDWSETHVEKLARFGRREKNGDC 573          
BLAST of Netrin-1a vs. TrEMBL
Match: tr|E3LD86|E3LD86_CAERE (CRE-UNC-6 protein OS=Caenorhabditis remanei GN=Cre-unc-6 PE=4 SV=1)

HSP 1 Score: 318.931 bits (816), Expect = 1.602e-95
Identity = 193/599 (32.22%), Postives = 301/599 (50.25%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYI-LTP--KEHYG-----NLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQK 1828
            C+   G P  C P  IN A    + AS TCG NG    C       G   + C+ C++ +P LS  + ++ D +  G  TCW+S     S  P +V+LTL L K+  ++++++  C   PD + +YK       W+P+Q+++ +C+  F + P ++       +  N  + VC      M  GG+   F  +   P   ++F +  S   Q+W+ AT+I++ +  L+P   E YG     N    +  +     Y +   ++ +GG+  C+GHASR I      Y C+C+H+TAG +CE C     D+PW  AT  +   C  C CN H+ +C FD  +F  SG   G  C++C  NT G  C  C PGY R  + P+ H+ ACK C CH VGSL G  C+Q SG+C CKPGVTG TC  CA GY+Q+ S   PC KI      + S++S     C  C+   KR+N K+FC ++   ++ + SRE    W ++   +E V+ R  +       NL+  E TS+W+    V C C     G  YL++   K      +  L++N   V+ +W++   ++  +F  +DK+G+C   T  +
Sbjct:   37 CHDHTGRPVRCVPEFINAAFGKPVIASDTCGNNGPSKYCIVKEGPDGIIREQCDTCDARNPLLSHPASLLTDLNSIGNMTCWVST---PSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGREPDIS------ITKSNEQEAVC-TASHIMGPGGNRVAFPFLENRP-SAQNFEN--SPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNDTDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGYVRDTSLPMTHRKACKSCGCHPVGSL-GKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSNSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTE-------NLQRGE-TSLWISPQGVICKCPKLRVGRRYLLLG--KNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHR 611          
The following BLAST results are available for this feature:
BLAST of Netrin-1a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Human)
Total hits: 5
Match NameE-valueIdentityDescription
NTN15.714e-9230.53netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN31.017e-7328.20netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030][more]
LAMC11.587e-5632.18laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
LAMC31.163e-5231.25laminin subunit gamma 3 [Source:HGNC Symbol;Acc:HG... [more]
NTN51.160e-4930.61netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208][more]
back to top
BLAST of Netrin-1a vs. Ensembl Celegans
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Celegan)
Total hits: 5
Match NameE-valueIdentityDescription
unc-61.893e-9531.77Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
unc-61.893e-9531.77Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
lam-21.796e-5631.83Laminin-like protein lam-2 [Source:UniProtKB/Swis... [more]
lam-21.796e-5631.83Laminin-like protein lam-2 [Source:UniProtKB/Swis... [more]
lam-32.745e-4227.04LAMinin related. See also lmb- [Source:RefSeq pep... [more]
back to top
BLAST of Netrin-1a vs. Ensembl Fly
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Drosophila)
Total hits: 5
Match NameE-valueIdentityDescription
NetA3.519e-7028.99Netrin-A [Source:FlyBase gene name;Acc:FBgn0015773... [more]
NetA3.519e-7028.99Netrin-A [Source:FlyBase gene name;Acc:FBgn0015773... [more]
NetA1.442e-6932.83Netrin-A [Source:FlyBase gene name;Acc:FBgn0015773... [more]
LanB24.640e-5433.26Laminin B2 [Source:FlyBase gene name;Acc:FBgn02673... [more]
LanB24.640e-5433.26Laminin B2 [Source:FlyBase gene name;Acc:FBgn02673... [more]
back to top
BLAST of Netrin-1a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Zebrafish)
Total hits: 5
Match NameE-valueIdentityDescription
ntn1a6.558e-9631.37netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
ntn1a6.558e-9631.37netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
ntn22.983e-9029.55netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2][more]
ntn22.983e-9029.55netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2][more]
ntn1b1.428e-8829.90netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168][more]
back to top
BLAST of Netrin-1a vs. Ensembl Xenopus
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Xenopus)
Total hits: 5
Match NameE-valueIdentityDescription
ntn11.657e-9030.35netrin 1 [Source:Xenbase;Acc:XB-GENE-989335][more]
ntn12.948e-8930.68netrin 1 precursor [Source:RefSeq peptide;Acc:NP_... [more]
ntn14.993e-8830.42netrin 1 precursor [Source:RefSeq peptide;Acc:NP_... [more]
ntn37.653e-8529.53netrin 3 [Source:Xenbase;Acc:XB-GENE-960264][more]
lamc19.820e-5631.66laminin, gamma 1 [Source:Xenbase;Acc:XB-GENE-47855... [more]
back to top
BLAST of Netrin-1a vs. Ensembl Mouse
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Ensembl Mouse)
Total hits: 5
Match NameE-valueIdentityDescription
Ntn16.227e-9230.36netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn16.227e-9230.36netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Tbc1d241.844e-7427.69TBC1 domain family, member 24 [Source:MGI Symbol;A... [more]
Lamc16.554e-5731.89laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914][more]
Lamc35.276e-5532.27laminin gamma 3 [Source:MGI Symbol;Acc:MGI:1344394... [more]
back to top
BLAST of Netrin-1a vs. UniProt
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34710|UNC6_CAEEL2.581e-9431.77Netrin unc-6 OS=Caenorhabditis elegans GN=unc-6 PE... [more]
sp|O95631|NET1_HUMAN2.936e-9130.53Netrin-1 OS=Homo sapiens GN=NTN1 PE=1 SV=2[more]
sp|O09118|NET1_MOUSE4.850e-9130.36Netrin-1 OS=Mus musculus GN=Ntn1 PE=1 SV=3[more]
sp|Q90922|NET1_CHICK5.345e-9030.52Netrin-1 OS=Gallus gallus GN=NTN1 PE=1 SV=1[more]
sp|Q2HXW4|NET1_PIG9.801e-9030.50Netrin-1 OS=Sus scrofa GN=NTN1 PE=2 SV=1[more]
back to top
BLAST of Netrin-1a vs. TrEMBL
Analysis Date: 2017-05-17 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
tr|A0A0K0EM36|A0A0K0EM36_STRER8.379e-9731.46Uncharacterized protein OS=Strongyloides stercoral... [more]
tr|A0A090LSV4|A0A090LSV4_STRRB8.648e-9731.80Netrin-1a OS=Strongyloides ratti GN=SRAE_X00006040... [more]
tr|V4AN98|V4AN98_LOTGI3.881e-9631.52Uncharacterized protein OS=Lottia gigantea GN=LOTG... [more]
tr|A0A0N5C6U6|A0A0N5C6U6_STREA4.090e-9631.86Uncharacterized protein OS=Strongyloides papillosu... [more]
tr|E3LD86|E3LD86_CAERE1.602e-9532.22CRE-UNC-6 protein OS=Caenorhabditis remanei GN=Cre... [more]
back to top
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2016-09-29
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002049Laminin EGF domainSMARTSM00180lamegf_3coord: 402..450
e-value: 1.8E-8
score: 44.1
coord: 339..399
e-value: 4.7E-6
score: 36.1
coord: 280..336
e-value: 1.7
score: 8.5
IPR002049Laminin EGF domainPFAMPF00053Laminin_EGFcoord: 285..327
e-value: 3.4E-6
score: 27.0
coord: 402..445
e-value: 1.8E-8
score: 34.2
coord: 339..390
e-value: 2.8E-6
score: 27.2
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 302..336
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 422..450
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 366..402
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 339..401
score: 11.321
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 402..452
score: 17.415
IPR008211Laminin, N-terminalSMARTSM00136LamNT_2coord: 29..281
e-value: 2.6E-14
score: 33.6
IPR008211Laminin, N-terminalPFAMPF00055Laminin_Ncoord: 35..281
e-value: 9.2E-35
score: 120.2
IPR008211Laminin, N-terminalPROSITEPS51117LAMININ_NTERcoord: 31..282
score: 26.341
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 285..329
e-value: 2.2E-11
score: 43.0
coord: 337..389
e-value: 5.5E-12
score: 44.9
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 400..450
e-value: 3.7E-13
score: 48.6
NoneNo IPR availableGENE3DG3DSA:2.40.50.120coord: 463..598
e-value: 3.7E-10
score: 38.9
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..20
score: 0.789
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 285..341
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 339..404
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 402..445
NoneNo IPR availableTMHMMTMhelixcoord: 5..27
NoneNo IPR availableTMHMMTMhelixcoord: 10..32
NoneNo IPR availableTMHMMTMhelixcoord: 15..37
NoneNo IPR availableTMHMMTMhelixcoord: 13..35
IPR018933Netrin module, non-TIMP typePFAMPF01759NTRcoord: 479..593
e-value: 3.5E-11
score: 42.7
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 422..433
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 302..313
IPR001134Netrin domainPROSITEPS50189NTRcoord: 466..602
score: 15.509
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 463..599

Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: INTERPRO
TermDefinition
IPR002049Laminin_EGF
IPR008211Laminin_N
IPR018933Netrin_module_non-TIMP
IPR013032EGF-like_CS
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000058embryonic digestive system
PLANA:0000023temporary embryonic pharynx
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000003Stage 3
PLANA:0000002Stage 2
PLANA:0000004Stage 4
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023593 ID=SMED30023593|Name=Netrin-1a|organism=Schmidtea mediterranea sexual|type=transcript|length=1962bp
GATCTTGAAATTCTTTTTAAAATTTCTAATCTTATTCATTGGTCTTGTGG
CCTTAAATGGAGAACTGCAGACCTGCTACAGTGCCAATGGAGATCCTAAA
CCTTGTGAACCATTATTAATAAATTTGGCTCAGCCAATGCATATTGAAGC
TAGCTCTACGTGTGGAGAAAACGGAGCGGAAAGTATTTGTACAGAATGGT
TTGACAAACTAGGAAAAGCTCATAAGTCCTGTGAGAAATGCAATTCTTTA
GATCCTAAATTATCAAAATCGTCAAAAATGGTGGTTGATTCACATATACG
AGGCAAGGAGACTTGTTGGATTTCAGAAGGTGTTCATGAAAGTAGTTATC
CAACTAGCGTTAATCTTACATTGGGTTTGAAAAAGAGGTCATTAATATCA
TTTATTACTGTGGAATTATGTGGTCACAACCCGGATGGCATTATTATTTA
TAAAATGGACAGTGAAACAGATGATTGGTCTCCTTGGCAATATTTTGCTA
AAGACTGTCAACTGACATTTAAGATGCCGGCTTTAACAACGGATACAGTT
AATACTTTTTCCGATATAAATTCATTGAAACCAGTTTGTTTTGATTTGGA
AAAAAGTATGGACTATGGAGGAGATGAAAAACTATTCAGACTTATCCCAT
TCAATCCAAGACAAGGCAGAAGTTTTGGAGATGTATTATCTAAAAATGAA
CAAAACTGGTTGGCAGCTACAGAAATACGAATCAGTTATATTCTAACTCC
TAAAGAACATTACGGAAATCTGCTGTTGAGAGAAAAGCGAAATGCAGAAA
ATCCTGTTTATCATTTTGGTTCATCTGATATAATGATTGGTGGGCAACCT
TTATGTCATGGACATGCTTCGAGAATAATCAGAACTTCGGATGATACTTA
TCAGTGTGAATGTCAGCACAGTACTGCTGGAAAGGATTGTGAAAAATGCC
ATGAAGAATTCAATGATCAACCGTGGAGTTCAGCAACGATTCGAAACCCA
GCGGTTTGTAAAAGATGCGAGTGTAACAATCATTCGATAAAATGTGTATT
CGATTTTAATGTTTTCCTGAAATCTGGTAGAATTCATGGCAGTTCTTGCA
TAGATTGTGGTGATAACACTGTCGGCCCTCAGTGTGATCAATGCGCTCCC
GGATATTTCCGGCAACATGCTTATCCTATTTACCATAAAAATGCTTGTAA
ACCTTGCTTATGTCATTCAGTTGGATCTCTTTCGGGTACACCCTGCGATC
AAGTAAGTGGGAAATGTTTCTGTAAGCCTGGAGTGACTGGGAAAACATGT
ACCCATTGTGCACCGGGTTATAAACAAACAAATTCCCTAAAGAATCCTTG
CAGAAAGATATCAAAATTGCGTCATTTAGTGAAATCAAATTCGAGTTGCG
ATTTTTGTCAAAGGAAAAGTAAAAGAATTAATTTTAAGAGATTTTGCAGC
AAGGAAACAAATTTCAAAGTAAATATCAAGAGTAGAGAATCAAGGGGTCA
GTGGATTCGGTTCATTTCTGAAATCGAACAGGTCTGGACAAGAAATCAAC
AAGATCCCCGAGTATCCCAACTTAATCTAGAATCTAGTGAAGGGACTTCG
ATGTGGGTTCATAAAGATCTCGTGGACTGCGGTTGCGTTGATTTTGAATT
CGGTCATTCATATTTAGTCATGGCCAATGTGAAAACAACGGAATTTATGG
GCCAAACTGAACTTATTTTAAACCAAAGTGATGTAATTGAGGATTGGAAG
GAGACATGGGAGGAGCAATTTTCTCAGTTTTATACCCAGGATAAAATGGG
AAAATGCAATCGGTTTACTCGACAAAAGCGACACGTCAAGAGGCGTAATT
TTGCCTCAACCTATAACCAATATGCTATCTATTCCTGATCATTTGGACCC
GGGATTAATTTAATTAACATTTTATCTAGCAGCTGAATGTGATGTCTTAT
TGTATTTATAAA
back to top

protein sequence of SMED30023593-orf-1

>SMED30023593-orf-1 ID=SMED30023593-orf-1|Name=SMED30023593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=629bp
ILKFFLKFLILFIGLVALNGELQTCYSANGDPKPCEPLLINLAQPMHIEA
SSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIR
GKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIY
KMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLE
KSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTP
KEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTY
QCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVF
DFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACK
PCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPC
RKISKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQ
WIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEF
GHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMG
KCNRFTRQKRHVKRRNFASTYNQYAIYS*
back to top
Aliases
The feature 'Netrin-1a' has the following synonyms
Synonym
netrin-like