Netrin 1

Overview
NameNetrin 1
Smed IDSMED30023593
Uniprot Best hitNetrin unc-6 OS=Caenorhabditis elegans OX=6239 GN=unc-6 PE=1 SV=1 (E=1.18113e-95)
Length (bp)1962
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Netrin 1 (SMED30023593) t-SNE clustered cells

Violin plots show distribution of expression levels for Netrin 1 (SMED30023593) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top

Expression Details

Netrin 1 ( netrin-like ) is expressed during Stage 2, Stage 3 and Stage 4 in the embryonic digestive system and embryonic pharynx

Click to see image symbols and abbreviations
Abbreviation or symbolDefinition
Ooral hemisphere
Aaboral hemisphere
Ddorsal
Vventral
Llateral
black arrowheadembryonic pharynx
red arrowheaddefinitive pharynx
black arrowsprimitive gut
yellow arrowsprimitive ectoderm cells
cyan arrowsbrain
cyan arrowheadsnerve cords
blue arrowheadseye progenitors (trail cells)
purple arrowheadseyes
scale bar100 µm
Anatomical Expression

PAGE et. al., 2020




SMED30023593

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
embryonic pharynxSMED30023593 SMED30023593smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 3 colorimetric in situ hybridization evidence
embryonic pharynxSMED30023593 SMED30023593smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 6 colorimetric in situ hybridization evidence
embryonic pharynxSMED30023593 SMED30023593smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 5 colorimetric in situ hybridization evidence
embryonic pharynxSMED30023593 SMED30023593smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 2 colorimetric in situ hybridization evidence
embryonic pharynxSMED30023593 SMED30023593smed_20140614PMID:28072387
Davies et al., 2017
whole organism Stage 4 colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Netrin 1 vs. Ensembl Human
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 301.982 bits (772), Expect = 2.966e-93
Identity = 185/606 (30.53%), Postives = 299/606 (49.34%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CN+ DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   +IN K++C K+   +++I   +  G W +F   I  V+   Q   R+ + +       S+W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVY--KQGTSRIRRGD------QSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. Ensembl Human
Match: NTN3 (netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030])

HSP 1 Score: 252.292 bits (643), Expect = 8.392e-75
Identity = 163/578 (28.20%), Postives = 260/578 (44.98%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPV-YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNS----SCD-FCQ--RKSKRINFKRFCSKETNFKVNIKSR-ESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSY----LVMANVKTTEFMGQTELILNQSDVIEDWKETW 1759
            C+   G P+ C P L+N A    + ASSTCG     +                  C++ DP+ + S  ++          CW SE +  +  P +V LT+ L K   + F+++  C   P  + + K       W+P  +F+  C L + ++PA          +      +CF    +   G       L+ F+ +     G  L  +   Q+W+ AT++R+  +LT     G     + R+ E  V Y + ++D+ +GG+  C+GHASR +  +     C+C+H T G DC +C   + D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R     +  + AC+ C CH VG+ +G  C+Q +G+C CK GVTG TC  CAPG++Q+ S   PC K         S+      CD  C+  R S RI+ K+FC K+   +V + +R E+RG W RF   +  V+   ++  R           +++WV      CGC     G  Y                    LI  +  ++  W++ W
Sbjct:   30 CHDEGGAPRGCVPGLVNAALGREVLASSTCGRPATRA------------------CDASDPRRAHSPALLTSPGGTASPLCWRSESLPRA--PLNVTLTVPLGKAFELVFVSLRFCSAPPASVALLKSQDHGRSWAPLGFFSSHCDLDYGRLPAPANGPAGPGPEA-----LCFPAPLAQPDGSG-----LLAFSMQDSSPPGLDLDSSPVLQDWVTATDVRV--VLTRPSTAG-----DPRDMEAVVPYSYAATDLQVGGRCKCNGHASRCLLDTQGHLICDCRHGTEGPDCGRCKPFYCDRPWQRATARESHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRALSDRRACRACDCHPVGA-AGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKTPIPGPTEDSSPVQPQDCDSHCKPARGSYRISLKKFCKKDYAVQVAVGARGEARGAWTRFPVAVLAVFRSGEERARRGS--------SALWVPAGDAACGCPRLLPGRRYLLLGGGPGAAAGGAGGRGPGLIAARGSLVLPWRDAW 561          
BLAST of Netrin 1 vs. Ensembl Human
Match: LAMC1 (laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HGNC:6492])

HSP 1 Score: 211.46 bits (537), Expect = 4.038e-57
Identity = 140/435 (32.18%), Postives = 214/435 (49.20%), Query Frame = 2
Query:   65 LQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-------------KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +  C    G P+ C P  +N A  + + A++TCG    E  C +    +    KSC  C++  P L   +  + D + +   T W S+ +     YP+S+NLTL L K   I+++ ++     P+   IYK   E   W P+QY++  C+ T+             +  AL TD    FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ AT+IR++  L     +G+ +  + +  ++  Y++  SD  +GG+  C+GHAS  ++   D   C C+H+T G DCEKC   FND+PW  AT  + + C  C+CN  S +C FD  ++  +G  HG  C +C DNT G  C++C   +FR     + +  AC  C C  VGSLS T CD   G+C CKPGV G  C  C PG+
Sbjct:   37 MDECTDEGGRPQRCMPEFVNAAFNVTVVATNTCG-TPPEEYCVQT--GVTGVTKSCHLCDAGQPHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPSSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDE---FSDISPLT------------GGN------VAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVT--LNRLNTFGDEVFNDPKVLKS--YYYAISDFAVGGRCKCNGHASECMKNEFDKLVCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG--HGGHCTNCQDNTDGAHCERCRENFFR-----LGNNEACSSCHCSPVGSLS-TQCDSY-GRCSCKPGVMGDKCDRCQPGF 434          

HSP 2 Score: 68.9366 bits (167), Expect = 2.269e-11
Identity = 48/160 (30.00%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  848 PLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEE-FNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSL-SGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            P   G +  ++  + +     C   T GK CE C +  F D    +  +R   +C+ C+C+++      D N      R+ G  C+ C  NT G  CD+C  G+F     P    + CK C C+  G++   + C+ V+G+C C P VTG+ C  C PG+
Sbjct:  774 PCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGYFGDPLGRNGPVR---LCRLCQCSDN-----IDPNAVGNCNRLTGE-CLKCIYNTAGFYCDRCKDGFFGNPLAP-NPADKCKACNCNLYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGF 923          

HSP 3 Score: 61.6178 bits (148), Expect = 4.638e-9
Identity = 45/141 (31.91%), Postives = 65/141 (46.10%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPA-VCKRCECNNHSIKCVFDFNVFLKSGRIHGSSC------IDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHC 1309
            +C ++TAG  C++C + F   P +     NPA  CK C CN             L       SSC       +C  +  G  C  C PG+     Y +     C+ C CH++GS +G  CD  +G+C C+PG+TG+ C  C
Sbjct:  851 KCIYNTAGFYCDRCKDGFFGNPLAP----NPADKCKACNCN-------------LYGTMKQQSSCNPVTGQCECLPHVTGQDCGACDPGF-----YNLQSGQGCERCDCHALGSTNGQ-CDIRTGQCECQPGITGQHCERC 968          

HSP 4 Score: 51.2174 bits (121), Expect = 8.107e-6
Identity = 43/144 (29.86%), Postives = 55/144 (38.19%), Query Frame = 2
Query:  905 CECQHSTAGKDCEKC-----HEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            C C     G+ CE C      E  N  P+S         C  C CN HS  C  +  V             +C DNT GP C++C+ GY+          + C+PC C    S +  P  +      C  G TGK C  C  GY
Sbjct:  690 CTCPVGYGGQFCEMCLSGYRRETPNLGPYSP--------CVLCACNGHSETCDPETGV------------CNCRDNTAGPHCEKCSDGYYGDSTAGT--SSDCQPCPCPGGSSCAVVPKTKEVVCTNCPTGTTGKRCELCDDGY 811          

HSP 5 Score: 50.8322 bits (120), Expect = 9.133e-6
Identity = 40/142 (28.17%), Postives = 61/142 (42.96%), Query Frame = 2
Query:  896 TYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            T QCEC     G+DC  C   F +       +++   C+RC+C  H++    +    +++G+       +C     G  C++C   +F       +    CKPC CH  GSLS    D   G+C C+ G  G  C  C   Y
Sbjct:  902 TGQCECLPHVTGQDCGACDPGFYN-------LQSGQGCERCDC--HALGST-NGQCDIRTGQC------ECQPGITGQHCERCEVNHFG------FGPEGCKPCDCHPEGSLSLQCKD--DGRCECREGFVGNRCDQCEENY 1019          
BLAST of Netrin 1 vs. Ensembl Human
Match: LAMC3 (laminin subunit gamma 3 [Source:HGNC Symbol;Acc:HGNC:6494])

HSP 1 Score: 199.519 bits (506), Expect = 3.601e-53
Identity = 135/432 (31.25%), Postives = 204/432 (47.22%), Query Frame = 2
Query:   65 LQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVH-ESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPA----------LTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +  CY   G P+ C P+  N A     +AS TCG +  E  C         AH  C++C++ DP+   ++  + D H + + T W S  +     YPTSVN+TL L K   I+++ ++     P+   IYK       W P+Q+++  CQ T+  P                 + FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ +TE+ IS  L     +G+ + ++ +  ++  Y++  SD  +GG+  C+GHAS           C CQH+T G DCE+C   F D+PW+  T      C  C C+  S +C FD  +F  +G  HG  C  C D+T GP C++C   ++  H  P   +  C+PC C S GSL    CD  +G C CKP VTG  C  C PG+
Sbjct:   22 MGACYDGAGRPQRCLPVFENAAFGRLAQASHTCG-SPPEDFCPHVGAAGAGAH--CQRCDAADPQRHHNASYLTDFHSQDESTWWQSPSMAFGVQYPTSVNITLRLGKAYEITYVRLKFHTSRPESFAIYKRSRADGPWEPYQFYSASCQKTYGRPEGQYLRPGEDERVAFCTSEFSDISPLS------------GGN------VAFSTLEGRPSAYNFEESPGLQEWVTSTELLIS--LDRLNTFGDDIFKDPKVLQS--YYYAVSDFSVGGRCKCNGHASECGPDVAGQLACRCQHNTTGTDCERCLPFFQDRPWARGTAEAAHECLPCNCSGRSEECTFDRELFRSTG--HGGRCHHCRDHTAGPHCERCQENFY--HWDP---RMPCQPCDCQSAGSLH-LQCDD-TGTCACKPTVTGWKCDRCLPGF 419          

HSP 2 Score: 72.0182 bits (175), Expect = 2.877e-12
Identity = 48/153 (31.37%), Postives = 68/153 (44.44%), Query Frame = 2
Query:  866 ASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLS-GTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            A   I  S +     C     G+ CE C + F   P       +P  C +C+C+ +      D N       + G  C+ C  NT G  C+ C  G++     P    + C PC CH  GS+S   PCD V+G+C C P VT + C+ C PG+
Sbjct:  762 ACTTIPESREVVCTHCPPGQRGRRCEVCDDGFFGDPL--GLFGHPQPCHQCQCSGN-----VDPNAVGNCDPLSGH-CLRCLHNTTGDHCEHCQEGFYGSALAP-RPADKCMPCSCHPQGSVSEQMPCDPVTGQCSCLPHVTARDCSRCYPGF 905          

HSP 3 Score: 55.8398 bits (133), Expect = 2.458e-7
Identity = 41/138 (29.71%), Postives = 58/138 (42.03%), Query Frame = 2
Query:  911 CQHSTAGKDCEKCHEEFNDQPWSSATIRNPA-VCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            C H+T G  CE C E F    + SA    PA  C  C C+          +  +    + G     C  +     C +C PG+F      +     C+ C CH +GS     C   +G+C C+PGVTG+ C  C  G+
Sbjct:  834 CLHNTTGDHCEHCQEGF----YGSALAPRPADKCMPCSCHPQG-----SVSEQMPCDPVTGQ--CSCLPHVTARDCSRCYPGFFD-----LQPGRGCRSCKCHPLGSQEDQ-CHPKTGQCTCRPGVTGQACDRCQLGF 954          
BLAST of Netrin 1 vs. Ensembl Human
Match: NTN5 (netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208])

HSP 1 Score: 183.341 bits (464), Expect = 3.293e-50
Identity = 101/330 (30.61%), Postives = 159/330 (48.18%), Query Frame = 2
Query:  854 CHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVK-------SNSSC-DFCQRKSKRIN--FKRFCSKETNFKVNIKSRESRG-QWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCN 1810
            CHGHA+R    +       C+H T G  CE C     D PW  AT R+P  C  C CN H+ +C F+  +F  SG   G  C  C  +T G  C  C PG++R  + PI+ + AC+ C CH +G+  GT C+Q SG+C CK GVTG TC  C PGY+Q+ S + PC++I +    +        S+  C ++C     R++   +R+C ++   +  + + E+ G  W R    +  V+ +  Q  R    +         WV +  + CGC+  + G  YL++ +         T LIL++  +   W+  W     +   +++ G C 
Sbjct:  159 CHGHAARCAARARPPRC-HCRHHTTGPGCESCRPSHRDWPWRPATPRHPHPCLPCSCNQHARRCRFNSELFRLSGGRSGGVCERCRHHTAGRHCHYCQPGFWRDPSQPIFSRRACRACQCHPIGATGGT-CNQTSGQCTCKLGVTGLTCNRCGPGYQQSRSPRMPCQRIPEATTTLATTPGAYSSDPQCQNYCNMSDTRVHMSLRRYCQQDHVLRAQVLASEAAGPAWQRLAVRVLAVYKQRAQPVRRGDQD--------AWVPRADLTCGCLRLQPGTDYLLLGSAVGDP--DPTRLILDRHGLALPWRPRWARPLKRLQQEERAGGCR 476          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 310.071 bits (793), Expect = 9.285e-97
Identity = 190/598 (31.77%), Postives = 297/598 (49.67%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYI-LTP--KEHYG-----NLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQK 1828
            C+   G P  C P  IN A    + AS TCG N  +  CT      G   + C+ C++ +   S  + ++ D +  G  TCW+S     S  P +V+LTL L K+  ++++++  C   PD + +YK       W+P+Q+++ +C+  F       D   + +  N  + VC      M  GG+   F  +   P   ++F +  S   Q+W+ AT+I++ +  L+P   E YG     N    E  +     Y +   ++ +GG+  C+GHASR I      Y C+C+H+TAG +CE C     D+PW  AT  +   C  C CN H+ +C FD  +F  SG   G  C++C  NT G  C  C PG+ R  + P+ H+ ACK C CH VGSL G  C+Q SG+C CKPGVTG TC  CA GY+Q+ S   PC KI      + S+ S     C  C+   KR+N K+FC ++   ++ + SRE    W ++   +E V+ R  +       N++  E TS+W+    V C C     G  YL++   K      +  L++N   V+ +W++   ++  +F  +DK+G+C   T  +
Sbjct:   37 CHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVST---PSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGR-----DPDVSITKSNEQEAVC-TASHIMGPGGNRVAFPFLENRP-SAQNFEN--SPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSL-GKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTE-------NMQRGE-TSLWISPQGVICKCPKLRVGRRYLLLG--KNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHR 611          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: unc-6 (Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34710])

HSP 1 Score: 310.071 bits (793), Expect = 9.285e-97
Identity = 190/598 (31.77%), Postives = 297/598 (49.67%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYI-LTP--KEHYG-----NLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQK 1828
            C+   G P  C P  IN A    + AS TCG N  +  CT      G   + C+ C++ +   S  + ++ D +  G  TCW+S     S  P +V+LTL L K+  ++++++  C   PD + +YK       W+P+Q+++ +C+  F       D   + +  N  + VC      M  GG+   F  +   P   ++F +  S   Q+W+ AT+I++ +  L+P   E YG     N    E  +     Y +   ++ +GG+  C+GHASR I      Y C+C+H+TAG +CE C     D+PW  AT  +   C  C CN H+ +C FD  +F  SG   G  C++C  NT G  C  C PG+ R  + P+ H+ ACK C CH VGSL G  C+Q SG+C CKPGVTG TC  CA GY+Q+ S   PC KI      + S+ S     C  C+   KR+N K+FC ++   ++ + SRE    W ++   +E V+ R  +       N++  E TS+W+    V C C     G  YL++   K      +  L++N   V+ +W++   ++  +F  +DK+G+C   T  +
Sbjct:   37 CHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVST---PSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGR-----DPDVSITKSNEQEAVC-TASHIMGPGGNRVAFPFLENRP-SAQNFEN--SPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSL-GKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTE-------NMQRGE-TSLWISPQGVICKCPKLRVGRRYLLLG--KNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHR 611          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: lam-2 (Laminin-like protein lam-2 [Source:UniProtKB/Swiss-Prot;Acc:Q18823])

HSP 1 Score: 209.92 bits (533), Expect = 4.593e-57
Identity = 141/443 (31.83%), Postives = 216/443 (48.76%), Query Frame = 2
Query:   74 CYS-ANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESS-YPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF----KMPAL-----TTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTS----DDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQ--TNSLKN 1345
            CY  A   P+ C P  +N A  + ++ ++TCG       C +      ++   CE C+      S  +K + D ++   ET W S+ + E   YPT+ NLTL L K   I+++ ++     P+   IYK      +W PWQ+++  C+ T+    + P L     T      FSDI+ +             GG+      I F+  +GR       ++E  Q W+ A+ IRIS  L     +G+ + ++ +   +  Y++  SD  +GG+  C+GHAS  + +S    ++   C C+H+T G DC +C   +ND+PW S T      C  C C+  S +C FD  +F ++G  HG  CIDC  NT G  C+QC   ++R+       +N C  C C+ +GSLS T CD   GKC CKPGVTG+ C  C  G+    TN  KN
Sbjct:   40 CYDRATRQPQRCVPDFVNAAFNLEVQVTNTCGTKRPTKFCVQSGHTGQRS--VCETCDDRHEGFSHPAKYLTDFNVGNNETWWQSDTMQEGQQYPTTTNLTLVLGKSFDITYVRLKFISPRPESFTIYKKTHTDSEWEPWQFYSGSCRATYGLSDRAPILPGNEATAQCTKEFSDISPIT------------GGN------IAFSTLEGRPSAHAFEESEVLQKWVTASAIRIS--LNRMNTFGDEVFKDPQVLRS--YYYAISDFAVGGRCKCNGHASECVGSSSVDGENRLVCRCEHNTQGADCNECLPFYNDRPWRSGTSVEANECIACNCSQLSNRCYFDQQLFEETG--HGGHCIDCQGNTQGVHCEQCIANHWRRPG-----ENYCVACGCNEIGSLS-TQCDN-EGKCQCKPGVTGRFCDQCLDGFYDFSTNGCKN 449          

HSP 2 Score: 69.707 bits (169), Expect = 4.930e-12
Identity = 47/135 (34.81%), Postives = 63/135 (46.67%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCA 1312
            +C  +T G +CE C   +    W  A I     C+ C C     +   +    L+  +  G    DC  N +G QCDQCA G+     Y I     C+ C C  +GS  G  CD  +G+C CKPGVTG+ C  CA
Sbjct:  858 KCIFNTHGFNCENCKPGY----WGDALIEPKGNCQSCGCFAAGTRRPNNDYTLLECNQQDGQ--CDCLPNVIGIQCDQCAHGF-----YNITSGLGCQECNCDPLGS-EGNTCDVNTGQCQCKPGVTGQRCDRCA 980          

HSP 3 Score: 52.7582 bits (125), Expect = 9.153e-7
Identity = 45/165 (27.27%), Postives = 71/165 (43.03%), Query Frame = 2
Query:  854 CHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVF--DFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLC------HSVGSLSGTPCDQVSGKC-FCKPGVTGKTCTHCAPGY 1321
            CH H++       ++  C C+H+TAG  CE+C   +    +  A       C++C C N    C+   D +V           C +C +   G +CD+C+ GYF            C  C C      +S+G+     CD+++G+C  C     G  C +C PGY
Sbjct:  738 CHNHSNSC---EAESGSCICEHNTAGDTCERCARGY----YGDALQGTEEDCQKCPCPNDG-PCILHADGDVI----------CTECPNGYTGRRCDECSDGYFGNPK----DGTECVECACSGNTDPNSIGN-----CDKITGECKKCIFNTHGFNCENCKPGY 875          

HSP 4 Score: 50.0618 bits (118), Expect = 5.907e-6
Identity = 43/145 (29.66%), Postives = 57/145 (39.31%), Query Frame = 2
Query:  905 CECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYF---RQHAYPIYHKNACK---PCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            CEC     G+ CE C   F  +        +   C +C+C+NHS  C                SCI C  NT G  C++CA GY+    Q       K  C    PC+ H+ G +  T C           G TG+ C  C+ GY
Sbjct:  702 CECLPGFVGQFCESCESGFRRETKFGGPFNH---CIKCDCHNHSNSC-----------EAESGSCI-CEHNTAGDTCERCARGYYGDALQGTEEDCQKCPCPNDGPCILHADGDVICTECPN---------GYTGRRCDECSDGY 822          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: lam-3 (LAMinin related. See also lmb; Laminin alpha chain [Source:UniProtKB/TrEMBL;Acc:G5ECE3])

HSP 1 Score: 166.007 bits (419), Expect = 1.849e-42
Identity = 126/466 (27.04%), Postives = 209/466 (44.85%), Query Frame = 2
Query:  110 PLLINLAQPMHIEASSTCGENGAESIC--TEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFA---KDCQLTFKMPALT-------TDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRN-----AENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDT---YQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFD-------FNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLS--------GTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKN-PCRKISKLRHLVKSNSSC 1399
            P + NLA    I A+ TCG+  AE  C   E        +    +C+  D   +   +  ++  I G    W S  +        VN+T+ L++   +++I +++      G  + +   + + + PWQY+A    +C   F +PA T        D V+  S+ + + P    LE              I  +   GR   +  S   Q +  A  +R+  +++P+    +L++  K++     +    Y +  SDI IGGQ +C+GHA      SD     ++CEC+H+T G+ C +C   FN  PW   T  +P VC++C+C NH+  CV+D       +++  +     G  C++C  NT G  C++C  GY+R      Y ++AC+ C C  VGS+S             Q  G C CKPG  G+ C  CAPGY+   + +  PC +   +       +SC
Sbjct:   50 PNIFNLATNSLITATDTCGQYTAEEYCKLVEHVLLRKTTNTQSPQCDICDAN-NVHKRHPIEYAIDGTRRWWQSPSLANGLRFEKVNITIDLRQEYQVAYIILKMGNSPRPGTWVLEKSLDGEYYEPWQYYAMQDAECMRQFGIPATTGVPRFQKEDEVHCTSEYSKITP----LENGE-----------IHTSLVNGRPGAENTSLELQKFTRARFVRLR-LISPRTLNADLMIINKKSDSLDKSVTMRYFYSISDISIGGQCICYGHAESC--PSDPVTGQFKCECRHNTCGESCNRCCPLFNQLPWKPGTNSHPNVCQQCQCFNHAHSCVYDDELDRNKWSITPEGVYEGGGRCLECAHNTEGFNCERCKDGYYRPSGLSHYREDACRTCECDPVGSVSDACVRDDQSAENGQKPGDCICKPGFGGRRCERCAPGYRNHPTCEPCPCNRAGSVNFDTCDGASC 496          

HSP 2 Score: 75.485 bits (184), Expect = 1.004e-13
Identity = 58/171 (33.92%), Postives = 77/171 (45.03%), Query Frame = 2
Query:  854 CHGHASRIIRTSDDTYQC-ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCEC----NNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPC 1351
            CHGH+      + DT  C +C+H+T G  CE C   +       A       C +C C    N+ S  CV      +  GR  G  C  C     G  C+ C  GY+     P +    C PC CH  GSL G  C+ +SG+C CKPGVTG+TC+ C   +   N +   C
Sbjct: 1542 CHGHSQTC---NPDTSVCTDCEHNTFGDFCEHCLPGY----IGDAREGGANACTKCACPLVENSFSDSCVA-----VDHGR--GYVCNSCKPGYTGQYCETCVAGYYGD---PQHIGGTCSPCDCHPDGSLHGA-CNPLSGQCECKPGVTGRTCSMCQERHAFINRVCTSC 1694          

HSP 3 Score: 73.9442 bits (180), Expect = 3.406e-13
Identity = 52/177 (29.38%), Postives = 77/177 (43.50%), Query Frame = 2
Query:  809 YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSC------IDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +H+G++ +       CH   +   + S++  +CEC+ +  G  C++C E   D       + N   C  C+CN+              +G I GS C       +C     G QCDQC P YF       +    C+ C C+  GS+    CDQ +GKC C+  V G  C  CA GY
Sbjct:  928 HHWGNAQLHTCKPCGCHTQGAVNPQCSEENGECECKENYIGAQCDRCKENHGD-------VENG--CPACDCND--------------TGSI-GSDCDQVSGQCNCKQGVFGKQCDQCRPSYFN------FTDAGCQFCHCNIYGSIEDGKCDQTTGKCECRENVEGTMCEKCADGY 1074          

HSP 4 Score: 63.929 bits (154), Expect = 3.736e-10
Identity = 43/140 (30.71%), Postives = 63/140 (45.00%), Query Frame = 2
Query:  902 QCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            QC C+    GK C++C   + +           A C+ C CN +    + D      +G+       +C +N  G  C++CA GYF      I   + C+ C C   GS     C+ V+G+C CKPGVTG  C  C P +
Sbjct: 1006 QCNCKQGVFGKQCDQCRPSYFN--------FTDAGCQFCHCNIYG--SIEDGKCDQTTGKC------ECRENVEGTMCEKCADGYFN-----ITSGDGCEDCGCDPTGS-EDVSCNLVTGQCVCKPGVTGLKCDSCLPNF 1123          

HSP 5 Score: 59.6918 bits (143), Expect = 7.603e-9
Identity = 50/140 (35.71%), Postives = 71/140 (50.71%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECN---NHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPG 1318
            EC H+T G +CE+C + +  +P   +  R  A C+ CEC+   + S  CV D +   ++G+  G  CI C     G +C++CAPGY R H         C+PC C+  GS++   CD  S  C CK  V G  C  C  G
Sbjct:  389 ECAHNTEGFNCERCKDGYY-RPSGLSHYREDA-CRTCECDPVGSVSDACVRD-DQSAENGQKPGD-CI-CKPGFGGRRCERCAPGY-RNHP-------TCEPCPCNRAGSVNFDTCDGAS--CQCKANVEGIYCDRCKAG 513          

HSP 6 Score: 55.8398 bits (133), Expect = 1.117e-7
Identity = 49/195 (25.13%), Postives = 74/195 (37.95%), Query Frame = 2
Query:  878 IRTSDDTYQC-ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLS----------------------------------------------GTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            + +++D Y C  C     G  CE C + F + P +         C  C CN + I  +   N   ++G+     C+ C  +T G  C+ C     ++H +     + CKPC CH+ G+++                                              G+ CDQVSG+C CK GV GK C  C P Y
Sbjct:  849 VASNEDNYVCINCPLGYEGNKCEYCSDGFFEDPLTGK-------CIECTCNGN-IDPMGIGNCDSETGK-----CLKCIGHTTGDSCESC-----KEHHWGNAQLHTCKPCGCHTQGAVNPQCSEENGECECKENYIGAQCDRCKENHGDVENGCPACDCNDTGSIGSDCDQVSGQCNCKQGVFGKQCDQCRPSY 1025          
BLAST of Netrin 1 vs. Ensembl Celegans
Match: lam-1 (LAMinin related. See also lmb [Source:UniProtKB/TrEMBL;Acc:V6CIX7])

HSP 1 Score: 147.517 bits (371), Expect = 1.841e-36
Identity = 122/444 (27.48%), Postives = 194/444 (43.69%), Query Frame = 2
Query:   98 KPCEPLLINL--AQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSL-------DP-KLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKM-----PALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASR------------IIRTSDDTY-QCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQ--------VSGKCFCKPGVTGKTCTHCAPGY 1321
            + C P+  NL   +   ++A+STCG  G +  C      L +  K C  C+S        +P +LS   + VV   +  K   W        +   +V+++  L+     + + +      P  +II +       W  ++YFA DC  +F       P   TD + T S  + + P            G E ++++I  +      + D +S      L  T +R ++  T     G+ LL + R   +  Y++   +I++ G   C+GHASR            ++  +D  + +CEC H+T G +CEKC   +ND PW  A       C++C CN H+++C FD  V+  SG + G  C DC  NT G  C+QC P ++R     I   + C PC C   GS +   C+         V+GKC+CK  V G  C  C  GY
Sbjct:   35 RSCYPITGNLLIGRKSQLKATSTCGSQGRQRFCI--VSHLEEQTK-CFYCDSRTEWKPQREPYRLSHRIENVVTEVMDDKNRNW----YQSENGAQNVSISFDLEAEFHFTHLIMTFKSFRPAAMIIERSADFGKTWQVYRYFAYDCDSSFPGIPEGPPKKHTDVICT-SQYSDVAPS----------TGGEIVYKVISPHIVTENPYADEIS----TLLKITNLRFNF--TKLHTLGDDLL-DYRPEIDEKYYYAIYEIVVRGSCSCYGHASRCIPIDPHVSPNTVMERADIVHGRCECMHNTEGLNCEKCKAFYNDLPWRPAIGDEKNECRQCNCNRHALRCHFDRAVYESSGFVSGGVCDDCMHNTQGKNCEQCKPFFYRDPRRTIDDPHVCLPCECDKAGSQNKGICEGEEDAERGLVAGKCYCKTNVDGNRCDRCKNGY 453          

HSP 2 Score: 67.781 bits (164), Expect = 2.335e-11
Identity = 45/138 (32.61%), Postives = 67/138 (48.55%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSI--KCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAP 1315
            +C H+T GK+CE+C   F   P    TI +P VC  CEC+      K + +     + G + G     C  N  G +CD+C  GY+      +   + C  C C+ +G+ +   CD+ +G C CK  VTG+ C  C P
Sbjct:  373 DCMHNTQGKNCEQCKPFFYRDPRR--TIDDPHVCLPCECDKAGSQNKGICEGEEDAERGLVAGK--CYCKTNVDGNRCDRCKNGYWNLTETNV---DGCVACTCNLLGTYNNEGCDKYTGMCTCKRLVTGENCDQCLP 503          

HSP 3 Score: 60.4622 bits (145), Expect = 4.075e-9
Identity = 33/81 (40.74%), Postives = 46/81 (56.79%), Query Frame = 2
Query: 1082 IHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKP-GVTGKTCTHCAPGY 1321
            + G  C +C  N VG +CDQCA G +       +  + CK C C +VGSL G  CD+ SG+C C+  G+ G+ C  C PG+
Sbjct:  793 VQGGQC-ECKPNVVGRRCDQCAIGTYG------FGPSGCKKCDCDAVGSL-GNDCDKQSGQCVCREKGIYGRQCNQCQPGF 865          

HSP 4 Score: 58.151 bits (139), Expect = 2.006e-8
Identity = 53/168 (31.55%), Postives = 74/168 (44.05%), Query Frame = 2
Query:  854 CHGHASRIIRTSDD--TYQC-ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECN---NHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSL---SGTP---CDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            C+G+    +  S D  T +C +C H T G  CE C + +    +  A ++    C+RC CN    +S K   D        R+ G     C DN +G QCDQCA  +F      +     C+ C C S G +    G P   C+   G+C CKPG  G+ C  C   Y
Sbjct:  988 CNGNIDMAMEGSCDAATGECLKCLHHTEGAQCEHCVDGY----YGDAKLK---TCQRCVCNELGTNSTKGACD--------RVSGQ--CPCHDNIIGMQCDQCAENHFN-----LASGAGCEACGCDSNGVVLNHEGVPHLQCNIFDGQCQCKPGRGGRKCDQCEDLY 1133          

HSP 5 Score: 55.0694 bits (131), Expect = 1.673e-7
Identity = 46/166 (27.71%), Postives = 71/166 (42.77%), Query Frame = 2
Query:  839 GGQPLCHGHASR-IIRTSDDTYQ---CECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGT-PCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            GG    + HA    +R S +  Q   C C+    G+ C +C +     P           C+RC+CN + I    + +    +G      C+ C  +T G QC+ C  GY     Y       C+ C+C+ +G+ S    CD+VSG+C C   + G  C  CA  +
Sbjct:  928 GGPTSGYQHADTCYLRNSGNNTQDIVCNCKSGYQGERCGECAQNHWGSPREVG-----GTCERCDCNGN-IDMAMEGSCDAATGE-----CLKCLHHTEGAQCEHCVDGY-----YGDAKLKTCQRCVCNELGTNSTKGACDRVSGQCPCHDNIIGMQCDQCAENH 1077          

HSP 6 Score: 49.6766 bits (117), Expect = 8.988e-6
Identity = 43/151 (28.48%), Postives = 62/151 (41.06%), Query Frame = 2
Query:  902 QCECQHSTAGKDCEKCHE-EFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPC 1351
            QC C  +  G  C++C E  FN        + + A C+ C C+++ +    +    L+     G     C     G +CDQC   Y+     P    + C  C C+  GS S   C + +G C C+ G  G  C  CA GY       NPC
Sbjct: 1058 QCPCHDNIIGMQCDQCAENHFN--------LASGAGCEACGCDSNGVVLNHEGVPHLQCNIFDGQ--CQCKPGRGGRKCDQCEDLYWGDPTTP----DGCHRCECNPTGSKS-LQCHRNNGTCECQAGSGGALCNECARGYTGQWPYCNPC 1193          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0073942)

HSP 1 Score: 244.973 bits (624), Expect = 3.881e-71
Identity = 167/576 (28.99%), Postives = 259/576 (44.97%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGH--NPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAEN--------PV-----------------------YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNS-----LKNPCRKISKLR---------------------------------HLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLE 1582
            CY+   +P+ C P  +N A    + ASSTCG +GA+  C E+ D      +SC  C+  DP  S  ++ + D +     TCW SE V  S    +V LTL L K+  ++++ ++LC H   PD ++IYK       W P+Q+F+  C+  F  PA  +   +     N  +  C D+ +         L   I F+  +GR     L  +   Q+W+ AT+IR+ +    +     LL  E   A +        P+                        H+  SD  +GG+  C+GHAS+    +     CEC H+TAG+DCE+C     D+PW+ AT +    CK C CN H+ +C F+  +F  S  + G  C +C  +T G  C QC  G++R    P+ H+  CK C CH +GS SG  C+  SG+C CK GVTG TC  CA GY+Q+ S     +K P R I+ L                                  +  +    C  C+  +KR+N  +FC ++      +  R++  + +    E++    R   DP V+   ++
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDAPVVASSTCGSSGAQRYC-EYQDH----ERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSG--DNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQSTGRH-----NEHEARCSDVTR--------PLVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGS-SGKICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVS--REVQ----RRAMDPDVADYEMD 588          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0346088)

HSP 1 Score: 244.973 bits (624), Expect = 3.881e-71
Identity = 167/576 (28.99%), Postives = 259/576 (44.97%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGH--NPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAEN--------PV-----------------------YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNS-----LKNPCRKISKLR---------------------------------HLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLE 1582
            CY+   +P+ C P  +N A    + ASSTCG +GA+  C E+ D      +SC  C+  DP  S  ++ + D +     TCW SE V  S    +V LTL L K+  ++++ ++LC H   PD ++IYK       W P+Q+F+  C+  F  PA  +   +     N  +  C D+ +         L   I F+  +GR     L  +   Q+W+ AT+IR+ +    +     LL  E   A +        P+                        H+  SD  +GG+  C+GHAS+    +     CEC H+TAG+DCE+C     D+PW+ AT +    CK C CN H+ +C F+  +F  S  + G  C +C  +T G  C QC  G++R    P+ H+  CK C CH +GS SG  C+  SG+C CK GVTG TC  CA GY+Q+ S     +K P R I+ L                                  +  +    C  C+  +KR+N  +FC ++      +  R++  + +    E++    R   DP V+   ++
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDAPVVASSTCGSSGAQRYC-EYQDH----ERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSG--DNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQSTGRH-----NEHEARCSDVTR--------PLVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGS-SGKICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIKQPPRMINMLDTQNTAPEPDEPESSPGSGGDRNGAAGMAAQSQYYRTEGGRECGKCRVSTKRLNLNKFCKRDYAIMAKVIGRDTSSEAVS--REVQ----RRAMDPDVADYEMD 588          
BLAST of Netrin 1 vs. Ensembl Fly
Match: NetA (gene:FBgn0015773 transcript:FBtr0308337)

HSP 1 Score: 242.276 bits (617), Expect = 1.465e-70
Identity = 152/463 (32.83%), Postives = 224/463 (48.38%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGH--NPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAEN--------PV-----------------------YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRK 1357
            CY+   +P+ C P  +N A    + ASSTCG +GA+  C E+ D      +SC  C+  DP  S  ++ + D +     TCW SE V  S    +V LTL L K+  ++++ ++LC H   PD ++IYK       W P+Q+F+  C+  F  PA  +   +     N  +  C D+ +         L   I F+  +GR     L  +   Q+W+ AT+IR+ +    +     LL  E   A +        P+                        H+  SD  +GG+  C+GHAS+    +     CEC H+TAG+DCE+C     D+PW+ AT +    CK C CN H+ +C F+  +F  S  + G  C +C  +T G  C QC  G++R    P+ H+  CK C CH +GS SG  C+  SG+C CK GVTG TC  CA GY+Q+ S   PC K
Sbjct:   40 CYNKAHEPRACIPDFVNAAYDAPVVASSTCGSSGAQRYC-EYQDH----ERSCHTCDMTDPLRSFPARSLTDLNNSNNVTCWRSEPVTGSG--DNVTLTLSLGKKFELTYVILQLCPHAPRPDSMVIYKSTDHGLSWQPFQFFSSQCRRLFGRPARQSTGRH-----NEHEARCSDVTR--------PLVSRIAFSTLEGRPSSRDLDSSPVLQDWVTATDIRVVFHRLQRPDPQALLSLEAGGATDLASGKYSVPLANGPAGNNIEANLGGDVATSGSGLHYAISDFSVGGRCKCNGHASKCSTDASGQLNCECSHNTAGRDCERCKPFHFDRPWARATAKEANECKECNCNKHARQCRFNMEIFRLSQGVSGGVCQNCRHSTTGRNCHQCKEGFYRDATKPLTHRKVCKACDCHPIGS-SGKICNSTSGQCPCKDGVTGLTCNRCARGYQQSRSHIAPCIK 481          
BLAST of Netrin 1 vs. Ensembl Fly
Match: LanB2 (gene:FBgn0267348 transcript:FBtr0345031)

HSP 1 Score: 202.986 bits (515), Expect = 1.205e-54
Identity = 146/439 (33.26%), Postives = 212/439 (48.29%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMP-------------ALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTS----DDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPG-YFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQ 1327
            CY   G P+ C P  IN A  + IE+++TCGE      C +    + + HK+CE C   D   S     + D H     T W SE + E   +P  VNLTL L K   I+++ +      P+   IYK  SE+  W P+Q+++  C+ T+ +P             AL T   + +SDI+ L+    D E              I F+  +GR  G    ++   Q W+ AT+IRI+  L     +G+ L  + +  ++  Y +  SDI +G +  C+GHAS+ + ++    + T  CEC+H+T G DC++C   +ND  W  +T      CK C CN  + KC FD N+F ++G  HG  C+DC +N  GP C++C    Y R   Y       C  C C  VGS S   C+   GKC CKPGVTG  C  C   Y Q
Sbjct:   57 CYDPYGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFCIQ---TMNQNHKNCEFCKYNDHNPS----FLTDLHDPQSPTWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCT---SEYSDISPLR----DGE--------------IAFSTLEGRPSGINFERSGELQEWVTATDIRIT--LDRLNTFGDELFGDSQVLKS--YFYAISDIAVGARCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLFNRTG--HGGHCLDCRENRDGPNCERCKENFYMRDDGY-------CVNCACDPVGSRS-LQCNS-HGKCQCKPGVTGDKCDRCDNNYYQ 452          

HSP 2 Score: 78.9518 bits (193), Expect = 1.003e-14
Identity = 54/154 (35.06%), Postives = 73/154 (47.40%), Query Frame = 2
Query:  878 IRTSDDTYQC-ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNA-CKPCLCHSVGS----LSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            ++ ++DT  C EC     G  CE+C + F   P  +  +     CK C+CN +      D N      R  G  C+ C  NT G  CDQC  G+F     P+   +  C  C C+  G+     S T CDQV+G+C CKP V G+ C  C PGY
Sbjct:  802 LQINEDTVICTECPKGYFGSRCEQCSDGFFGDP--TGLLGEVQTCKSCDCNGN-----VDPNAVGNCNRTTGE-CLKCIHNTAGEHCDQCLSGHF---GDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGY 944          

HSP 3 Score: 72.0182 bits (175), Expect = 1.192e-12
Identity = 46/134 (34.33%), Postives = 64/134 (47.76%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHC 1309
            +C H+TAG+ C++C       P +    R    C RC C  +      D     +  ++ G     C  N +G  C +C PGYF      I   N C+ CLC  VGS + T CD+ SG+C C+PGV G+ C  C
Sbjct:  870 KCIHNTAGEHCDQCLSGHFGDPLALPHGR----CDRCSC--YEAGTEQDEQSITRCDQVTGQ--CQCKPNVIGRDCGECQPGYFN-----IRSGNGCENCLCDPVGSYNST-CDRYSGQCHCRPGVMGQRCDQC 989          

HSP 4 Score: 51.6026 bits (122), Expect = 2.965e-6
Identity = 44/147 (29.93%), Postives = 63/147 (42.86%), Query Frame = 2
Query:  875 IIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLK--SGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHC 1309
            I R    T QC+C+ +  G+DC +C   +         IR+   C+ C C+      V  +N      SG+ H      C    +G +CDQC   ++       +    CKPC C   GS  G  CDQ +G+C C   V G+ C  C
Sbjct:  916 ITRCDQVTGQCQCKPNVIGRDCGECQPGY-------FNIRSGNGCENCLCDP-----VGSYNSTCDRYSGQCH------CRPGVMGQRCDQCENYFYG------FSSEGCKPCECDESGS-KGFQCDQ-NGQCPCNDNVEGRRCDRC 1036          
BLAST of Netrin 1 vs. Ensembl Fly
Match: LanB2 (gene:FBgn0267348 transcript:FBtr0076382)

HSP 1 Score: 202.986 bits (515), Expect = 1.205e-54
Identity = 146/439 (33.26%), Postives = 212/439 (48.29%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMP-------------ALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTS----DDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPG-YFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQ 1327
            CY   G P+ C P  IN A  + IE+++TCGE      C +    + + HK+CE C   D   S     + D H     T W SE + E   +P  VNLTL L K   I+++ +      P+   IYK  SE+  W P+Q+++  C+ T+ +P             AL T   + +SDI+ L+    D E              I F+  +GR  G    ++   Q W+ AT+IRI+  L     +G+ L  + +  ++  Y +  SDI +G +  C+GHAS+ + ++    + T  CEC+H+T G DC++C   +ND  W  +T      CK C CN  + KC FD N+F ++G  HG  C+DC +N  GP C++C    Y R   Y       C  C C  VGS S   C+   GKC CKPGVTG  C  C   Y Q
Sbjct:   57 CYDPYGRPQKCLPEFINAAYQLQIESTNTCGEQNDNHFCIQ---TMNQNHKNCEFCKYNDHNPS----FLTDLHDPQSPTWWQSETMFEGIQHPNYVNLTLHLGKSYDITYVRILFRSPRPESFTIYKRTSESGPWIPYQFYSATCRDTYSLPDSRAIRKGEGEAHALCT---SEYSDISPLR----DGE--------------IAFSTLEGRPSGINFERSGELQEWVTATDIRIT--LDRLNTFGDELFGDSQVLKS--YFYAISDIAVGARCKCNGHASKCVPSTGMHGERTLVCECRHNTDGPDCDRCLPLYNDLKWKRSTSTEVNECKACNCNGLADKCFFDANLFNRTG--HGGHCLDCRENRDGPNCERCKENFYMRDDGY-------CVNCACDPVGSRS-LQCNS-HGKCQCKPGVTGDKCDRCDNNYYQ 452          

HSP 2 Score: 78.9518 bits (193), Expect = 1.003e-14
Identity = 54/154 (35.06%), Postives = 73/154 (47.40%), Query Frame = 2
Query:  878 IRTSDDTYQC-ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNA-CKPCLCHSVGS----LSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            ++ ++DT  C EC     G  CE+C + F   P  +  +     CK C+CN +      D N      R  G  C+ C  NT G  CDQC  G+F     P+   +  C  C C+  G+     S T CDQV+G+C CKP V G+ C  C PGY
Sbjct:  802 LQINEDTVICTECPKGYFGSRCEQCSDGFFGDP--TGLLGEVQTCKSCDCNGN-----VDPNAVGNCNRTTGE-CLKCIHNTAGEHCDQCLSGHF---GDPLALPHGRCDRCSCYEAGTEQDEQSITRCDQVTGQCQCKPNVIGRDCGECQPGY 944          

HSP 3 Score: 72.0182 bits (175), Expect = 1.192e-12
Identity = 46/134 (34.33%), Postives = 64/134 (47.76%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHC 1309
            +C H+TAG+ C++C       P +    R    C RC C  +      D     +  ++ G     C  N +G  C +C PGYF      I   N C+ CLC  VGS + T CD+ SG+C C+PGV G+ C  C
Sbjct:  870 KCIHNTAGEHCDQCLSGHFGDPLALPHGR----CDRCSC--YEAGTEQDEQSITRCDQVTGQ--CQCKPNVIGRDCGECQPGYFN-----IRSGNGCENCLCDPVGSYNST-CDRYSGQCHCRPGVMGQRCDQC 989          

HSP 4 Score: 51.6026 bits (122), Expect = 2.965e-6
Identity = 44/147 (29.93%), Postives = 63/147 (42.86%), Query Frame = 2
Query:  875 IIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLK--SGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHC 1309
            I R    T QC+C+ +  G+DC +C   +         IR+   C+ C C+      V  +N      SG+ H      C    +G +CDQC   ++       +    CKPC C   GS  G  CDQ +G+C C   V G+ C  C
Sbjct:  916 ITRCDQVTGQCQCKPNVIGRDCGECQPGY-------FNIRSGNGCENCLCDP-----VGSYNSTCDRYSGQCH------CRPGVMGQRCDQCENYFYG------FSSEGCKPCECDESGS-KGFQCDQ-NGQCPCNDNVEGRRCDRC 1036          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 311.612 bits (797), Expect = 3.405e-97
Identity = 186/593 (31.37%), Postives = 302/593 (50.93%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAES-ICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  NG P+ C P  +N A    + ASSTCG+  +   + TE  D+    H++C  C++ DPK +     + D +     TCW S+   +  YP +V LTL L K+  +++++++ C   P+ + I+K       W P+QY++  C+  +  P+  T T       N  + +C D    M    GG      LI F+   GR        +   Q+W+ AT+I++++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHASR ++  D    CEC+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI        ++S+     C+   + SK   +IN K++C K+   +V+I   +  G+W +F   I  V+ + +   R     L        WV    V C C   + G  YL++ N + +   GQ+ ++ ++  ++  W++TW  +  +F  ++K GKC +
Sbjct:   40 CYDENGHPRRCIPDFVNAAFGKEVRASSTCGKTPSRYCVVTEKGDE---RHRNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSDNYLQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKSWVPFQYYSTQCRKMYNKPSKATITKQ-----NEQEAICTDSHTDMHPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASRCVKDRDGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCIKIPIAPPTTTASSTEEPSDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKAGEWWKFTVNIISVYKQGESRIRRGDQFL--------WVRAKDVACKCPKIKSGKKYLLLGNDEDSP--GQSGMVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn1a (netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169])

HSP 1 Score: 311.612 bits (797), Expect = 3.405e-97
Identity = 186/593 (31.37%), Postives = 302/593 (50.93%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAES-ICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  NG P+ C P  +N A    + ASSTCG+  +   + TE  D+    H++C  C++ DPK +     + D +     TCW S+   +  YP +V LTL L K+  +++++++ C   P+ + I+K       W P+QY++  C+  +  P+  T T       N  + +C D    M    GG      LI F+   GR        +   Q+W+ AT+I++++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHASR ++  D    CEC+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI        ++S+     C+   + SK   +IN K++C K+   +V+I   +  G+W +F   I  V+ + +   R     L        WV    V C C   + G  YL++ N + +   GQ+ ++ ++  ++  W++TW  +  +F  ++K GKC +
Sbjct:   40 CYDENGHPRRCIPDFVNAAFGKEVRASSTCGKTPSRYCVVTEKGDE---RHRNCHTCDASDPKKNHPPAYLTDLNNPHNLTCWQSDNYLQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKSWVPFQYYSTQCRKMYNKPSKATITKQ-----NEQEAICTDSHTDMHPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASRCVKDRDGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKPISHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCANGYQQSRSPIAPCIKIPIAPPTTTASSTEEPSDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKAGEWWKFTVNIISVYKQGESRIRRGDQFL--------WVRAKDVACKCPKIKSGKKYLLLGNDEDSP--GQSGMVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn2 (netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2])

HSP 1 Score: 296.59 bits (758), Expect = 1.731e-91
Identity = 177/599 (29.55%), Postives = 298/599 (49.75%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLL--REKRNAEN-----PVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLR-----HLVKSNSSCD-FCQ--RKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY   G  + C P  IN A    +  SS CG   + S C+        A ++C+ C++ DP+ +  +  + D +     TCW SE +  S  P +V LTL L K+  I++++++ C   P+ + IYK       W+P+Q+++  C+  +  P     T       N  + +C D    +    GG      LI F+   GR  G     +   Q+W+  T+IR+  + +  +H   L +  RE  +A       P Y++   D  +GG+  C+GHASR +R  D    CEC+H+T G +C++C     D+PW  AT +    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R     I H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  ++        +  + CD +C+  + + +IN K++C K+   +V++   E+ G W +F   +  V+ +++ DP     ++       +WVH   + C C     G  +L++ + + T    +  L  +++ ++  W++ W  +  +F  ++K GKC++
Sbjct:   26 CYEETGAARRCIPEFINAAFGQEVSVSSVCGRPVSRS-CSLVERDDRPAVRTCQICDASDPRNAHPASYLTDLNSAHNLTCWQSENLQSS--PLNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGRTWTPYQFYSSQCRRMYNRPNKAAITKQ-----NEQEALCTDGHTDLYPLSGG------LIAFSTLDGRPSGKDFDSSPVLQDWVTVTDIRV--VFSRPQHTRALPMSGRESEDALGAPGSLPTYYYAVGDFQVGGRCKCNGHASRCVREKDGKLLCECKHNTEGPECDRCKPFHYDRPWQRATGKEANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGKAITHRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVIKPTAVISTTEEPADCDSYCKPLKGNLKINMKKYCKKDYAVQVSVLDMETVGDWAKFSVSLMSVY-KSRGDPLKRGDHM-------LWVHMKDLACKCPRIHMGKRFLILGSTEGTANPERPGLQADKNSLVIQWRDIWTRRLRKFQRKEKKGKCSK 599          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn2 (netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2])

HSP 1 Score: 296.975 bits (759), Expect = 1.761e-91
Identity = 177/599 (29.55%), Postives = 298/599 (49.75%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLL--REKRNAEN-----PVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLR-----HLVKSNSSCD-FCQ--RKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY   G  + C P  IN A    +  SS CG   + S C+        A ++C+ C++ DP+ +  +  + D +     TCW SE +  S  P +V LTL L K+  I++++++ C   P+ + IYK       W+P+Q+++  C+  +  P     T       N  + +C D    +    GG      LI F+   GR  G     +   Q+W+  T+IR+  + +  +H   L +  RE  +A       P Y++   D  +GG+  C+GHASR +R  D    CEC+H+T G +C++C     D+PW  AT +    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R     I H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  ++        +  + CD +C+  + + +IN K++C K+   +V++   E+ G W +F   +  V+ +++ DP     ++       +WVH   + C C     G  +L++ + + T    +  L  +++ ++  W++ W  +  +F  ++K GKC++
Sbjct:   35 CYEETGAARRCIPEFINAAFGQEVSVSSVCGRPVSRS-CSLVERDDRPAVRTCQICDASDPRNAHPASYLTDLNSAHNLTCWQSENLQSS--PLNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGRTWTPYQFYSSQCRRMYNRPNKAAITKQ-----NEQEALCTDGHTDLYPLSGG------LIAFSTLDGRPSGKDFDSSPVLQDWVTVTDIRV--VFSRPQHTRALPMSGRESEDALGAPGSLPTYYYAVGDFQVGGRCKCNGHASRCVREKDGKLLCECKHNTEGPECDRCKPFHYDRPWQRATGKEANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGKAITHRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVIKPTAVISTTEEPADCDSYCKPLKGNLKINMKKYCKKDYAVQVSVLDMETVGDWAKFSVSLMSVY-KSRGDPLKRGDHM-------LWVHMKDLACKCPRIHMGKRFLILGSTEGTANPERPGLQADKNSLVIQWRDIWTRRLRKFQRKEKKGKCSK 608          
BLAST of Netrin 1 vs. Ensembl Zebrafish
Match: ntn1b (netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168])

HSP 1 Score: 291.967 bits (746), Expect = 8.704e-90
Identity = 180/602 (29.90%), Postives = 295/602 (49.00%), Query Frame = 2
Query:   44 LVALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAES-ICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNS-----SCD-FCQ--RKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTR-NQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
              A +     CY  NG+P+ C P  +N A    +  SSTCG   +   + TE   K  +  + C  C++ DPK +     + D +     TCW SE   +  YP +V LTL L K+  +++++++ C   P+ + I+K       W P+Q+++  C+  +  P+    T       N  + +C D    M    GG      LI F+   GR        +   Q+W+ AT+I++++       +G+    +   A +  Y +  SD+ +GG+  C+GHAS+ ++  +    CEC+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R  +  I H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI         +S      CD  C+  +   ++  K++C K+   +V++   +  G+W +F   I  V+ +   +  R  QL         +WV    V C C   + G  YL+M + +  +  GQ+ ++ ++  ++  WK+ W  +  +F  +DK GKC
Sbjct:   30 FAAQSSPPDPCYDENGNPRRCIPDFVNSAFGKDVRVSSTCGSPPSRYCVVTE---KGEERSRDCNICDATDPKKTHPPAYLTDLNNPHNLTCWQSENYVQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIFKSMDYGKTWVPFQFYSTQCKKMYNKPSKAAITKQ-----NEQEAICTDSHTDMQPLTGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKVTFNRL--HTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMSKAISHRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAAPTSSYSSPDGPTDCDSHCKAPKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGGHRIRRGDQL---------LWVRAKDVACKCPKIKPGRKYLLMGSDEEEDSRGQSGVVADRGSLLIPWKDLWARRLRKFQQRDKRGKC 602          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: ntn1 (netrin 1 [Source:NCBI gene;Acc:779839])

HSP 1 Score: 290.041 bits (741), Expect = 8.215e-89
Identity = 181/595 (30.42%), Postives = 289/595 (48.57%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISE-GVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFR-LIPFNPRQGRSFGDVL--SKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKS----------NSSCD-FCQRKSKRI--NFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY A   PK C P  IN+A    +  S+TCG    + +C  + D      + C+ C+   P+ S     + D+     +TCW SE G+   ++P +V LTL L +R  + + ++  C   PD + IYK       W P+Q+++  C+  +        T +  S     +  C D +      G + L + L+ F P  GR        S   Q+W+ AT+IR+ +    + H+G  +   ++ A      +G S+I +GG+  C+GHASR      +   CECQH+T G +C+ C   + D+PW  AT  N   C  CECN HS +C F+  ++  SGR  G  C++C  NT G  C  C  GY R  + PI  + ACKPC CH +G+++   C+Q +G+C CK GVTG TC  CAPGY+Q+ S   PC +I +      S           + C  +C+    R+  N +++C K+   +  + S E  G+W +F + +  V+ + +   R     L        WV    + C C+  + G SYL++ N +  E      LIL+++ +   W++ W  +  +F  Q++ GKC
Sbjct:   42 CYDAKQRPKYCIPDFINVALGQEVITSNTCGRT-PQKLCY-FLDSTNVTSRRCQLCDQKRPENSYPPSYMTDTDA---QTCWKSESGI---TFPQNVTLTLPLGRRFELVYASLRFCSPRPDSMAIYKSMDYGKTWIPFQFYSTHCRRVYDQ-----ATTSAISKPMQHEATCTDFQT-----GVKPLTKGLVAFMPLAGRPSARRFEYSPVLQDWVTATDIRVVFN---RLHHGKKMGIRRKTA-----FYGVSEIQVGGRCKCNGHASRCT-AGKEGLMCECQHNTIGPECDACKPFYYDRPWQRATPSNAHECVACECNLHSHRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKQGYKRDLSKPITSRKACKPCQCHPIGAVNAM-CNQTTGQCQCKTGVTGPTCNRCAPGYQQSRSAHMPCVRIQEEMTTTASYPQEWKAGTNGTECQSYCKPSHSRVHMNLRKYCKKDYVLRAQLLSMEKSGEWWQFTATVLTVYRQRRVPIRRGDQPL--------WVPDHDLACDCLRVQVGKSYLIIGNDE--ESPDPARLILDKNSLALPWRDVWGHKLRRFQQQERRGKC 598          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: rps16 (ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-5786511])

HSP 1 Score: 277.33 bits (708), Expect = 3.177e-84
Identity = 177/593 (29.85%), Postives = 291/593 (49.07%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNA--ENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKL---RHLVKSNSSCD---FCQ--RKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVK-TTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY  +G P+ C P  +N A    ++ASSTCG             +L   H     C++ DP+ S  +  + D +  G  TCW SE     S   +V+LTL L K+  +++++++ C   P+ + I+K       W P+QY++  C+  +  P+  + T       N  + +C D +  +    GG      LI F+   GR     L  +   Q+WL AT+IR+ +   P     +LL  ++  A  E P +++   +  +GG+  C+GHASR  +  +    C+C+H+T G +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R  +  I  + ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  +     L  +    D   +C+  + + +IN K++C K+   +VN+   E  G W +F   I  V+    +D R+ + +        +W+H   + C C        YLVM + +  +E  G   L  +++ ++  W++ W  +  +   ++K GKC
Sbjct:   41 CYDEHGLPRRCVPEFVNAAFNKEVQASSTCG-------------RLATRH-----CDTTDPRKSYPASYLTDLNTAGNMTCWRSETFPRHS-SQNVSLTLSLGKKFEVTYVSLQFCSPRPESVAIFKSMDYGKSWVPYQYYSSQCRKVYGKPSRASVTKQ-----NEQEALCTDGQTELYPLTGG------LIAFSTLDGRPSAQDLDNSPVLQDWLTATDIRV-FFSRP-----HLLGNKESEASDEGPGFYYSVGEFQVGGRCKCNGHASRCGKDKEARLICDCKHNTEGPECDRCKPFHYDRPWQRATAREANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPTPALTSTEEPADCEQYCKPPKGNYKINLKKYCKKDFVVQVNVLEMEMVGSWAKFTVNILSVY--KCRDDRIKRGD------NFLWIHIKDLSCKCPKILLSRRYLVMGSSEGPSERPG---LTADKNSMVIQWRDAWTRRLRKLQRREKKGKC 585          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: rps16 (ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-5786511])

HSP 1 Score: 262.307 bits (669), Expect = 1.029e-78
Identity = 170/587 (28.96%), Postives = 277/587 (47.19%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNA--ENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTE---LILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY  +G P+ C P  +N A    ++ASSTCG             +L   H     C++ DP+ S  +  + D +  G  TCW SE     S   +V+LTL L K+  +++++++ C   P+ + I+K       W P+QY++  C+  +  P+  + T       N  + +C D +  +    GG      LI F+   GR     L  +   Q+WL AT+IR+ +   P     +LL  ++  A  E P +++   +  +GG+  C+GHASR  +  +    C+C+H+T G +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R  +  I  + ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  +       S+                  +    +VN+   E  G W +F   I  V+    +D R+ + +        +W+H   + C C        YLVM + +     G +E   L  +++ ++  W++ W  +  +   ++K GKC
Sbjct:   41 CYDEHGLPRRCVPEFVNAAFNKEVQASSTCG-------------RLATRH-----CDTTDPRKSYPASYLTDLNTAGNMTCWRSETFPRHS-SQNVSLTLSLGKKFEVTYVSLQFCSPRPESVAIFKSMDYGKSWVPYQYYSSQCRKVYGKPSRASVTKQ-----NEQEALCTDGQTELYPLTGG------LIAFSTLDGRPSAQDLDNSPVLQDWLTATDIRV-FFSRP-----HLLGNKESEASDEGPGFYYSVGEFQVGGRCKCNGHASRCGKDKEARLICDCKHNTEGPECDRCKPFHYDRPWQRATAREANECMACTCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDVSRAITDRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSRSPIAPCIKIPAVVPTPALTST-----------------EEPAVVQVNVLEMEMVGSWAKFTVNILSVY--KCRDDRIKRGD------NFLWIHIKDLSCKCPKILLSRRYLVMGSSE-----GPSERPGLTADKNSMVIQWRDAWTRRLRKLQRREKKGKC 560          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: utp4 (UTP4 small subunit processome component [Source:Xenbase;Acc:XB-GENE-977755])

HSP 1 Score: 208.764 bits (530), Expect = 2.521e-56
Identity = 140/442 (31.67%), Postives = 217/442 (49.10%), Query Frame = 2
Query:   44 LVALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFK-------------MPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            L  +   +  CY   G P+ C P  +N A    + A++TCG    E  C +    +    KSC  C+S    L   ++ + D + + + T W S+ +     YP+++NLTL L K   I+++ ++     P+   +YK   E   W P+QY++  C+ T++               AL TD    FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ AT+IR++  L     +G+ +  + +  ++  Y++  SD  +GG+  C+GHAS  +R   +   C C+H+T G DCEKC   +ND+PW  +T  +P  C  C CN  S +C FD  ++  +G  HG  C  C DNT GP C++C   Y+RQ      +   C  C C+ VGSLS T CD   G+C CKPGV G+ C  C PG+
Sbjct:    9 LGTVRAAMDECYE-EGSPQRCMPEFVNAAFNATVVATNTCG-TPPEEYCVQT--GVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTMLAGIQYPSTINLTLHLGKAFDITYVRLKFHTSRPESFALYKRTHEDGPWIPYQYYSGSCEKTYQKFNRGFIRTGEDEQQALCTDE---FSDISPLT------------GGN------VAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVT--LNRLNTFGDEVFSDPKVLKS--YYYAISDFAVGGRCKCNGHASECVRNEFEKIVCNCKHNTFGSDCEKCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELYRSTG--HGGHCTGCADNTDGPNCERCRENYYRQD-----NNEPCHACQCNPVGSLS-TQCDNY-GRCSCKPGVMGEKCDRCQPGF 412          

HSP 2 Score: 70.0922 bits (170), Expect = 1.061e-11
Identity = 48/161 (29.81%), Postives = 75/161 (46.58%), Query Frame = 2
Query:  848 PLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKN--ACKPCLCHSVGSLSG-TPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            P   G +  ++  + +     C   T GK CE C + +   P        P  C+ CEC+N+      D N      R+ G  C+ C  NT G  CD+C  G++     P+       C+ C C+  G++ G + C+QV+G+C C P VT + C+ C PG+
Sbjct:  752 PCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRP--CRICECSNN-----IDPNAVGNCDRLTGE-CLKCIYNTGGFYCDRCRDGFY---GNPLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCSACEPGF 901          

HSP 3 Score: 64.3142 bits (155), Expect = 6.193e-10
Identity = 42/139 (30.22%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAV-CKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +C ++T G  C++C + F   P +    +NP + C+ C CN +         V  +SG    +   +C  +     C  C PG+     Y +     C+ C CHS+GS SG  CD  +G+C C PG++G+ C  C P +
Sbjct:  829 KCIYNTGGFYCDRCRDGFYGNPLA----QNPDLKCRACSCNPYGT-------VKGQSGCNQVTGQCECLPHVTERDCSACEPGF-----YNLLSGRGCERCDCHSLGSTSGQ-CDVRTGQCECHPGISGQQCQQCEPNH 950          

HSP 4 Score: 52.373 bits (124), Expect = 3.049e-6
Identity = 44/154 (28.57%), Postives = 58/154 (37.66%), Query Frame = 2
Query:  905 CECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY----KQTNSLKNPCR 1354
            C C     G+ CE+C   +  +  S       + C  C CN HS  C  +  V             DC  NT GP C++C+ GY+          + C+PC C    S +  P  +      C  G TGK C  C  GY       N    PCR
Sbjct:  668 CSCPTGYIGQFCERCAPGYRRENPSQGPY---SPCVLCTCNGHSDTCDPESGV------------CDCQHNTAGPHCERCSEGYYGDST--TGSASDCQPCPCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRPCR 804          
BLAST of Netrin 1 vs. Ensembl Xenopus
Match: utp4 (UTP4 small subunit processome component [Source:Xenbase;Acc:XB-GENE-977755])

HSP 1 Score: 208.764 bits (530), Expect = 2.767e-56
Identity = 140/442 (31.67%), Postives = 217/442 (49.10%), Query Frame = 2
Query:   44 LVALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFK-------------MPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            L  +   +  CY   G P+ C P  +N A    + A++TCG    E  C +    +    KSC  C+S    L   ++ + D + + + T W S+ +     YP+++NLTL L K   I+++ ++     P+   +YK   E   W P+QY++  C+ T++               AL TD    FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ AT+IR++  L     +G+ +  + +  ++  Y++  SD  +GG+  C+GHAS  +R   +   C C+H+T G DCEKC   +ND+PW  +T  +P  C  C CN  S +C FD  ++  +G  HG  C  C DNT GP C++C   Y+RQ      +   C  C C+ VGSLS T CD   G+C CKPGV G+ C  C PG+
Sbjct:   12 LGTVRAAMDECYE-EGSPQRCMPEFVNAAFNATVVATNTCG-TPPEEYCVQT--GVTGVTKSCHICDSGQFHLQHGAEYLTDYNNQAEITWWQSQTMLAGIQYPSTINLTLHLGKAFDITYVRLKFHTSRPESFALYKRTHEDGPWIPYQYYSGSCEKTYQKFNRGFIRTGEDEQQALCTDE---FSDISPLT------------GGN------VAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVT--LNRLNTFGDEVFSDPKVLKS--YYYAISDFAVGGRCKCNGHASECVRNEFEKIVCNCKHNTFGSDCEKCLPFYNDRPWRRSTADSPNECLPCNCNGRSQECYFDPELYRSTG--HGGHCTGCADNTDGPNCERCRENYYRQD-----NNEPCHACQCNPVGSLS-TQCDNY-GRCSCKPGVMGEKCDRCQPGF 415          

HSP 2 Score: 70.0922 bits (170), Expect = 1.098e-11
Identity = 48/161 (29.81%), Postives = 75/161 (46.58%), Query Frame = 2
Query:  848 PLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKN--ACKPCLCHSVGSLSG-TPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            P   G +  ++  + +     C   T GK CE C + +   P        P  C+ CEC+N+      D N      R+ G  C+ C  NT G  CD+C  G++     P+       C+ C C+  G++ G + C+QV+G+C C P VT + C+ C PG+
Sbjct:  755 PCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRP--CRICECSNN-----IDPNAVGNCDRLTGE-CLKCIYNTGGFYCDRCRDGFY---GNPLAQNPDLKCRACSCNPYGTVKGQSGCNQVTGQCECLPHVTERDCSACEPGF 904          

HSP 3 Score: 64.3142 bits (155), Expect = 6.194e-10
Identity = 42/139 (30.22%), Postives = 67/139 (48.20%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAV-CKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +C ++T G  C++C + F   P +    +NP + C+ C CN +         V  +SG    +   +C  +     C  C PG+     Y +     C+ C CHS+GS SG  CD  +G+C C PG++G+ C  C P +
Sbjct:  832 KCIYNTGGFYCDRCRDGFYGNPLA----QNPDLKCRACSCNPYGT-------VKGQSGCNQVTGQCECLPHVTERDCSACEPGF-----YNLLSGRGCERCDCHSLGSTSGQ-CDVRTGQCECHPGISGQQCQQCEPNH 953          

HSP 4 Score: 51.9878 bits (123), Expect = 3.349e-6
Identity = 44/154 (28.57%), Postives = 58/154 (37.66%), Query Frame = 2
Query:  905 CECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY----KQTNSLKNPCR 1354
            C C     G+ CE+C   +  +  S       + C  C CN HS  C  +  V             DC  NT GP C++C+ GY+          + C+PC C    S +  P  +      C  G TGK C  C  GY       N    PCR
Sbjct:  671 CSCPTGYIGQFCERCAPGYRRENPSQGPY---SPCVLCTCNGHSDTCDPESGV------------CDCQHNTAGPHCERCSEGYYGDST--TGSASDCQPCPCPGGSSCAVVPRTKEVVCTNCPLGTTGKRCELCDDGYFGDPLGENGAPRPCR 807          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 301.212 bits (770), Expect = 3.380e-93
Identity = 184/606 (30.36%), Postives = 300/606 (49.50%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CNS DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y++  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   ++N K++C K+   +++I   +  G W +F   I  V+   Q   R+ + +       S+W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVY--KQGTSRIRRGD------QSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn1 (netrin 1 [Source:MGI Symbol;Acc:MGI:105088])

HSP 1 Score: 301.212 bits (770), Expect = 3.380e-93
Identity = 184/606 (30.36%), Postives = 300/606 (49.50%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CNS DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y++  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   ++N K++C K+   +++I   +  G W +F   I  V+   Q   R+ + +       S+W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVY--KQGTSRIRRGD------QSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Ntn3 (netrin 3 [Source:MGI Symbol;Acc:MGI:1341188])

HSP 1 Score: 253.832 bits (647), Expect = 1.554e-75
Identity = 162/585 (27.69%), Postives = 265/585 (45.30%), Query Frame = 2
Query:   50 ALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQ--RKSKRINFKRFCSKETNFKVNIKSR-ESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTE----LILNQSDVIEDWKETW 1759
             L      CY    +P+ C P L+N A    + ASSTCG +                      C+S DP+ + S+ ++  +       CW S+ + ++  P +V LT+ L K   + F+++  C   P  + + K       W P  +F+  C L + ++PA          +      +CF   ++   GG      L+ F+ + G   G  L  +   Q+W+ AT+IRI  +LT     G+     +       Y + ++++ +GG+  C+GHASR +  +     C+CQH T G DC +C   + D+PW  AT +    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R     +  + AC+ C CH VG+ +G  C+Q +G+C CK GVTG TC  CAPG++Q+ S   PC K      ++    V+       C+  R S RI+ K+FC K+   +V + +R E+RG W RF   +  V+   ++  R           +++WV      CGC     G  YL++                 L   +  ++  W++ W
Sbjct:   22 GLPASADPCYDEAREPRSCIPGLVNAALGREVLASSTCGRSANRV------------------CDSSDPQRAHSADLLTSAPGTASPLCWRSDLLQQA--PFNVTLTVPLGKAFELVFVSLRFCSAPPTSVALLKSQDHGRSWVPLGFFSSSCTLDYGRLPAPADGPSGPGPEA-----LCFPAPQAQPDGGG-----LLAFSVQDGSPQGLDLDNSPVLQDWVTATDIRI--VLTRPAIQGD----TRDGGVTVPYSYSATELQVGGRCKCNGHASRCLLDTHGHLVCDCQHGTEGPDCSRCKPFYCDRPWQRATGQEAHACLACSCNGHARRCRFNMELYRLSGRRSGGVCLNCRHNTAGRHCHYCREGFYRDPGRVLSDRRACRACDCHPVGA-AGKTCNQTTGQCPCKDGVTGLTCNRCAPGFQQSRSPVAPCVKTPVPGPTEESSPVEPQDCESHCRPARGSYRISLKKFCRKDYAVQVAVGARGEARGSWTRFPVAVLAVFRSGEERARRGS--------SALWVPTLDAACGCPRLLPGRRYLLLGGGPGAAAGSTAGRGQGLSAARGSLVLPWRDAW 561          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Lamc1 (laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914])

HSP 1 Score: 211.846 bits (538), Expect = 1.725e-57
Identity = 140/439 (31.89%), Postives = 215/439 (48.97%), Query Frame = 2
Query:   53 LNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHES-SYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-------------KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +   +  C    G P+ C P  +N A  + + A++TCG    E  C +    +    KSC  C++    L   +  + D + +   T W S+ +     YP S+NLTL L K   I+++ ++     P+   IYK   E   W P+QY++  C+ T+             +  AL TD    FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ AT+IR++  L     +G+ +  + +  ++  Y++  SD  +GG+  C+GHAS  ++   D   C C+H+T G DCEKC   FND+PW  AT  + + C  C+CN  S +C FD  ++  +G  HG  C +C DNT G +C++C   +FR     + +  AC PC C  VGSLS T CD   G+C CKPGV G  C  C PG+
Sbjct:   31 VRAAMDECADEGGRPQRCMPEFVNAAFNVTVVATNTCG-TPPEEYCVQT--GVTGVTKSCHLCDAGQQHLQHGAAFLTDYNNQADTTWWQSQTMLAGVQYPNSINLTLHLGKAFDITYVRLKFHTSRPESFAIYKRTREDGPWIPYQYYSGSCENTYSKANRGFIRTGGDEQQALCTDE---FSDISPLT------------GGN------VAFSTLEGRPSAYNFDNSPVLQEWVTATDIRVT--LNRLNTFGDEVFNDPKVLKS--YYYAISDFAVGGRCKCNGHASECVKNEFDKLMCNCKHNTYGVDCEKCLPFFNDRPWRRATAESASECLPCDCNGRSQECYFDPELYRSTG--HGGHCTNCRDNTDGAKCERCRENFFR-----LGNTEACSPCHCSPVGSLS-TQCDSY-GRCSCKPGVMGDKCDRCQPGF 432          

HSP 2 Score: 76.2554 bits (186), Expect = 9.918e-14
Identity = 52/160 (32.50%), Postives = 78/160 (48.75%), Query Frame = 2
Query:  848 PLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEE-FNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSG-TPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            P   G +  I+  + +     C   TAGK CE C +  F D   S+  +R   +C+ C+CN++      D N      R+ G  C+ C  NT G  CD+C  G+F     P    + CK C C+  G++   + C+ V+G+C C P V+G+ C  C PGY
Sbjct:  772 PCPGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGYFGDPLGSNGPVR---LCRPCQCNDN-----IDPNAVGNCNRLTGE-CLKCIYNTAGFYCDRCKEGFFGNPLAP-NPADKCKACACNPYGTVQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGY 921          

HSP 3 Score: 62.7734 bits (151), Expect = 1.428e-9
Identity = 45/135 (33.33%), Postives = 65/135 (48.15%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPA-VCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHC 1309
            +C ++TAG  C++C E F   P +     NPA  CK C CN +         V  +S     +    C  +  G  C  C PGY     Y +     C+ C CH++GS +G  CD  +G+C C+PG+TG+ C  C
Sbjct:  849 KCIYNTAGFYCDRCKEGFFGNPLAP----NPADKCKACACNPYGT-------VQQQSSCNPVTGQCQCLPHVSGRDCGTCDPGY-----YNLQSGQGCERCDCHALGSTNGQ-CDIRTGQCECQPGITGQHCERC 966          

HSP 4 Score: 51.6026 bits (122), Expect = 3.666e-6
Identity = 39/139 (28.06%), Postives = 56/139 (40.29%), Query Frame = 2
Query:  905 CECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            C C     G+ CE C   +  +   + ++   + C  C CN HS  C  +  V             DC DNT GP C++C+ GY+      +   + C+PC C    S +  P  +      C  G  GK C  C  GY
Sbjct:  688 CTCPVGYGGQFCETCLPGYRRE---TPSLGPYSPCVLCTCNGHSETCDPETGV------------CDCRDNTAGPHCEKCSDGYYGDST--LGTSSDCQPCPCPGGSSCAIVPKTKEVVCTHCPTGTAGKRCELCDDGY 809          
BLAST of Netrin 1 vs. Ensembl Mouse
Match: Lamc3 (laminin gamma 3 [Source:MGI Symbol;Acc:MGI:1344394])

HSP 1 Score: 206.068 bits (523), Expect = 1.525e-55
Identity = 141/437 (32.27%), Postives = 202/437 (46.22%), Query Frame = 2
Query:   50 ALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVH-ESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPA----------LTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            A   ++ +CY   G  + C P   N A     EAS TCG    E  C         A   C++C+  DP     +  + D H     T W S  +     YPTSVNLTL L K   I+++ ++     P+   IYK    +  W P+QY++  CQ T+  P                 + FSDI+ L             GG+      + F+  +GR  ++    S   Q W+ +T+I IS  L     +G+ + ++ R  ++  Y++  SD  +GG+  C+GHAS     +     C CQH+T G DCE+C   F D+PW+  T  +   C  C C+ HS +C FD  ++  +G  HG  C  C D+T GP C++C   Y+R        K  C+PC CH  GSLS   CD  SG C CKP VTG  C  C PG+
Sbjct:   26 AAGADMGSCYDGVGRAQRCLPEFENAAFGRRAEASHTCGRP-PEDFCPHVGAP--GAGLQCQRCDDADPGRRHDASYLTDFHSPDDSTWWQSPSMAFGVQYPTSVNLTLSLGKAYEITYVRLKFHTSRPESFAIYKRTYASGPWEPYQYYSASCQKTYGRPEGHYLRPGEDERVAFCTSEFSDISPLN------------GGN------VAFSTLEGRPSAYNFEESPVLQEWVTSTDILIS--LDRLNTFGDDIFKDPRVLQS--YYYAVSDFSVGGRCKCNGHASECEPNAAGQLACRCQHNTTGVDCERCLPFFQDRPWARGTAEDANECLPCNCSGHSEECTFDRELYRSTG--HGGHCQRCRDHTTGPHCERCEKNYYRWSP-----KTPCQPCDCHPAGSLS-LQCDN-SGVCPCKPTVTGWKCDRCLPGF 428          

HSP 2 Score: 76.6406 bits (187), Expect = 6.719e-14
Identity = 48/157 (30.57%), Postives = 71/157 (45.22%), Query Frame = 2
Query:  866 ASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNS 1336
            A   I  S D     C     G+ CE C + F   P   +    P  C+RC+C+ +      D N  + +   H   C+ C  NT G  C+ C  G++   A      + C PC C   GS+S   C+ V+G+C C P V+G+ C+ C+PG+    S
Sbjct:  774 ACATIPESGDVVCTHCPPGQRGRRCESCEDGFFGDPLGLSGAPQP--CRRCQCSGN-----VDLNA-VGNCDPHSGHCLRCLYNTTGAHCEHCREGFYGS-AVATRPVDKCAPCSCDLRGSVSEKTCNPVTGQCVCLPYVSGRDCSRCSPGFYDLQS 921          

HSP 3 Score: 59.6918 bits (143), Expect = 1.365e-8
Identity = 43/138 (31.16%), Postives = 61/138 (44.20%), Query Frame = 2
Query:  911 CQHSTAGKDCEKCHEEFNDQPWSSATIRNPA-VCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            C ++T G  CE C E F    + SA    P   C  C C+          +V  K+       C+ C     G  C +C+PG+     Y +     C+ C CH +GSL    C   +G+C C+PGVTG+ C  C  G+
Sbjct:  846 CLYNTTGAHCEHCREGF----YGSAVATRPVDKCAPCSCD-------LRGSVSEKTCNPVTGQCV-CLPYVSGRDCSRCSPGF-----YDLQSGRGCQSCKCHPLGSLENK-CHPKTGQCPCRPGVTGQACDRCQLGF 965          
BLAST of Netrin 1 vs. UniProt
Match: sp|P34710|UNC6_CAEEL (Netrin unc-6 OS=Caenorhabditis elegans OX=6239 GN=unc-6 PE=1 SV=1)

HSP 1 Score: 310.071 bits (793), Expect = 1.181e-95
Identity = 190/598 (31.77%), Postives = 297/598 (49.67%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYI-LTP--KEHYG-----NLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQK 1828
            C+   G P  C P  IN A    + AS TCG N  +  CT      G   + C+ C++ +   S  + ++ D +  G  TCW+S     S  P +V+LTL L K+  ++++++  C   PD + +YK       W+P+Q+++ +C+  F       D   + +  N  + VC      M  GG+   F  +   P   ++F +  S   Q+W+ AT+I++ +  L+P   E YG     N    E  +     Y +   ++ +GG+  C+GHASR I      Y C+C+H+TAG +CE C     D+PW  AT  +   C  C CN H+ +C FD  +F  SG   G  C++C  NT G  C  C PG+ R  + P+ H+ ACK C CH VGSL G  C+Q SG+C CKPGVTG TC  CA GY+Q+ S   PC KI      + S+ S     C  C+   KR+N K+FC ++   ++ + SRE    W ++   +E V+ R  +       N++  E TS+W+    V C C     G  YL++   K      +  L++N   V+ +W++   ++  +F  +DK+G+C   T  +
Sbjct:   37 CHDHTGRPVRCVPEFINAAFGKPVIASDTCGTNRPDKYCTVKEGPDGIIREQCDTCDARNHFQSHPASLLTDLNSIGNMTCWVST---PSLSPQNVSLTLSLGKKFELTYVSMHFCSRLPDSMALYKSADFGKTWTPFQFYSSECRRIFGR-----DPDVSITKSNEQEAVC-TASHIMGPGGNRVAFPFLENRP-SAQNFEN--SPVLQDWVTATDIKVVFSRLSPDQAELYGLSNDVNSYGNETDDEVKQRYFYSMGELAVGGRCKCNGHASRCIFDKMGRYTCDCKHNTAGTECEMCKPFHYDRPWGRATANSANSCVACNCNQHAKRCRFDAELFRLSGNRSGGVCLNCRHNTAGRNCHLCKPGFVRDTSLPMTHRKACKSCGCHPVGSL-GKSCNQSSGQCVCKPGVTGTTCNRCAKGYQQSRSTVTPCIKIPTKADFIGSSHSEEQDQCSKCRIVPKRLNQKKFCKRDHAVQMVVVSREMVDGWAKYKIVVESVFKRGTE-------NMQRGE-TSLWISPQGVICKCPKLRVGRRYLLLG--KNDSDHERDGLMVNPQTVLVEWEDDIMDKVLRFSKKDKLGQCPEITSHR 611          
BLAST of Netrin 1 vs. UniProt
Match: sp|O95631|NET1_HUMAN (Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2)

HSP 1 Score: 301.982 bits (772), Expect = 1.424e-92
Identity = 185/606 (30.53%), Postives = 299/606 (49.34%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CN+ DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   +IN K++C K+   +++I   +  G W +F   I  V+   Q   R+ + +       S+W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDMGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVY--KQGTSRIRRGD------QSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. UniProt
Match: sp|O09118|NET1_MOUSE (Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=3)

HSP 1 Score: 301.212 bits (770), Expect = 2.364e-92
Identity = 184/606 (30.36%), Postives = 300/606 (49.50%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CNS DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y++  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   ++N K++C K+   +++I   +  G W +F   I  V+   Q   R+ + +       S+W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNSSDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYYYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDMGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKMNMKKYCRKDYAVQIHILKADKAGDWWKFTVNIISVY--KQGTSRIRRGD------QSLWIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREKKGKCKK 603          
BLAST of Netrin 1 vs. UniProt
Match: sp|Q90922|NET1_CHICK (Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=1)

HSP 1 Score: 298.516 bits (763), Expect = 2.672e-91
Identity = 181/593 (30.52%), Postives = 297/593 (50.08%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAES-ICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  +G P+ C P  +N A    ++ SSTCG+  +   + TE   K  +  +SC  CN+ DPK +     + D +     TCW S+   +  YP +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P+    T       N  + +C D    +    GG      LI F+   GR        +   Q+W+ AT+I++++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHASR +R  DD   C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI            +  + CD   + SK   +IN K++C K+   +++I   E    W +F   I  V+ +     R            ++WVH   + C C   +    YL++ +  T +   Q+ +I ++S ++  W++TW  +  +F  ++K GKC +
Sbjct:   43 CYDEHGLPRRCIPDFVNSAFGKEVKVSSTCGKPPSRYCVVTE---KGEEQVRSCHLCNASDPKRAHPPSFLTDLNNPHNLTCWQSDSYVQ--YPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYSTQCRKMYNKPSRAAITKQ-----NEQEAICTDSHTDVRPLSGG------LIAFSTLDGRPTAHDFDNSPVLQDWVTATDIKVTF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASRCVRDRDDNLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKECDCHPVGA-AGQTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPAAPPPTAASSTEEPADCDSYCKASKGKLKINMKKYCKKDYAVQIHILKAEKNADWWKFTVNIISVYKQGSNRLRRGD--------QTLWVHAKDIACKCPKVKPMKKYLLLGS--TEDSPDQSGIIADKSSLVIQWRDTWARRLRKFQQREKKGKCRK 605          
BLAST of Netrin 1 vs. UniProt
Match: sp|Q2HXW4|NET1_PIG (Netrin-1 OS=Sus scrofa OX=9823 GN=NTN1 PE=2 SV=1)

HSP 1 Score: 297.745 bits (761), Expect = 4.901e-91
Identity = 183/600 (30.50%), Postives = 292/600 (48.67%), Query Frame = 2
Query:   41 GLVALNGEL---QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDK 1795
            GL    G+      C   NG P+ C P  +N A    +  SSTCG   A        ++  +  +SC  CN+ DPK +     + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+IR+++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHA+R +R  DD+  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GYFR    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +     V+    CD   + SK   +IN K++C K+   +++I   +  G W +F   I  V+ +     R    NL        W+    + C C   +    YL++ N + +    Q+ ++ ++S ++  W++TW  +  +F  ++K
Sbjct:   27 GLSMFAGQAAQPDPCSDENGHPRRCIPDFVNAAFGKDVRVSSTCGRPPARYCVVS--ERGEERLRSCHLCNASDPKKAHPPAFLTDLNNPHNLTCWQSENYLQ--FPHNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGRTWVPFQFYSTQCRKMYNRPHRAPITKQ-----NEQEAVCTDSHTDMRPLSGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIRVAF--SRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHAARCVRDRDDSLVCDCRHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYFRDLGKPITHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGVTCNRCAKGYQQSRSPIAPCIKIPVAPPTTAASSVEEPEDCDSYCKASKGKLKINMKKYCKKDYAVQIHILKADKAGDWWKFTVNIISVYKQGASRIRRGDQNL--------WIRSRDIACKCPKIKPLKKYLLLGNAEDSP--DQSGIVADKSSLVIQWRDTWARRLRKFQQREK 597          
BLAST of Netrin 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|18695441 (tr|A0A0K0EM36|A0A0K0EM36_STRER Uncharacterized protein OS=Strongyloides stercoralis OX=6248 PE=4 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 8.081e-98
Identity = 185/588 (31.46%), Postives = 305/588 (51.87%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVY-------HFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLV--KSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTS-MWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY ++G P  C P  IN A    + ASSTCG NG    CT   +  G   + C+ C++     +  + ++ D +     TCWISE   + +   +V LT+ L K+  +++I+++ C   PD + IYK      +W P+Q+++  C     M     D  +T S  N  + +C +   +M        F  +   P    +F    S   Q+W+ AT+IRI +      +     + +  N  + +        ++  +++ +GG+  C+GHASR I      Y C+C+H+TAG DCE+C     D+PW+ AT  +   C  C CN H+ KC F+  ++  SG   G  CI+C  NT G  C  C PGY+R +   I H+ ACK C CH VGSLS + C+Q SG+C CKPGVTG+TC  CA GY+Q+ + + PC KI  +   +  K+N +CD C+   KR+NF+++C ++  F+  I SRE    ++++   IE+V+ +N         + +  +G++ +W+ + +  C C     G  Y+++       +  Q+EL ++   ++ DW ET  E+ ++F  ++K G+C
Sbjct:    9 CYDSSGRPIRCVPDFINAAFGKPVIASSTCGVNGPSRYCTIRENTNGLIREVCDICDNKVKNKAHPASLLTDLNNARNLTCWISEPSIDKN--ENVTLTVSLGKKFELTYISMQFCNKIPDSMAIYKSVDGGKNWIPFQFYSSQC-----MEMYQRDVKDTISPKNEQEAICTN-SHTMSPTASRVAFATLEGRPS---AFRFEQSPILQDWVTATDIRIVFNKPSTFNEQLYAVSDSNNITDDMSGDMIAKSYYSMAELAVGGRCKCNGHASRCIYDKKGQYTCDCKHNTAGNDCERCKPFHYDRPWARATSESANACVACNCNLHARKCRFNAELYRLSGNKSGGICINCRHNTAGRNCHYCKPGYYRDNTKAITHRRACKACGCHLVGSLSKS-CNQTSGQCICKPGVTGQTCNRCAKGYQQSRNPQMPCIKIPTVTQSIIPKNNVNCDKCKVSPKRVNFRKYCKRQHAFQFYIISREILTDYVKYEISIEKVYKKN---------DYKIKKGSNYLWLPEKMAICKCPKLRIGQRYIILGTNNAKNYK-QSELYIDNHSIVVDWSETHVERMARFVRREKNGEC 574          
BLAST of Netrin 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|16721906 (tr|A0A090LSV4|A0A090LSV4_STRRB Netrin-1a OS=Strongyloides ratti OX=34506 GN=SRAE_X000060400 PE=4 SV=1)

HSP 1 Score: 321.242 bits (822), Expect = 8.343e-98
Identity = 187/588 (31.80%), Postives = 302/588 (51.36%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVY-------HFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI--SKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCN 1810
            CY ++G P  C P  IN A    + ASSTCG NG    C    +  G   + C+ C++     +  + ++ D +     TCWISE     +   +V LT+ L K+  +++I+++ C   PD + IYK      +W P+Q+++  C     M     D  +T S  N  + +C +   +M        F  +   P    +F    S   Q+W+ AT+IRI +      +     + +  N  + +        ++  +++ +GG+  C+GHASR I      Y C+C+H+TAG DCE+C     D+PW+ AT  +   C  C CN H+ KC F+  ++  SG   G  CI+C  NT G  C  C PGY+R +   I H+ ACK C CH VGSLS + C+Q SG+C CKPGVTG+TC  CA GY+Q+ + + PC KI  S    + KSN +C+ C+   KR+NF++FC ++  F+  I SRE    ++++   IE+V+ +N  D ++ +          +W+ + +  C C     G  Y+++      +   Q+EL +N   ++ DW ET  E+ ++F  ++K G+C+
Sbjct:    9 CYDSSGRPIRCVPDFINAAFGKPVIASSTCGVNGPSKFCAIRENVNGLIREVCDICDNTIKSKAHPASLLTDLNNARNLTCWISEPSINKN--ENVTLTVSLGKKFELTYISMQFCNKIPDSMAIYKSVDNGKNWIPFQFYSSQC-----MEMYQRDVKDTISPKNEQEAICTN-SHTMSPTASRVAFATLEGRPS---AFRFEQSPILQDWVTATDIRIIFNKPSTFNEQLYAITDSNNITDDISNDMIAKSYYSMAELAVGGRCKCNGHASRCIYDKKGQYTCDCKHNTAGNDCERCKPFHYDRPWARATSESANACVACNCNLHARKCRFNAELYRLSGNKSGGICINCRHNTAGRNCHYCKPGYYRDNTKAITHRRACKACGCHLVGSLSKS-CNQTSGQCICKPGVTGQTCNRCAKGYQQSRNPQMPCIKIASSTQNSIPKSNINCEKCKISPKRVNFRKFCKRQHVFQFYIISREIMTDYVKYEISIEKVYKKN--DYKIKK------GPNYLWLPEKMAICKCPKLRIGQRYMILG-TNNDQDNKQSELYINSHSIVVDWTETLVERMARFVKREKNGECD 575          
BLAST of Netrin 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|24665679 (tr|A0A5K3F5Z3|A0A5K3F5Z3_9CEST Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 327.405 bits (838), Expect = 1.610e-97
Identity = 203/695 (29.21%), Postives = 313/695 (45.04%), Query Frame = 2
Query:   71 TCYSANGDPKPCEPLLINLAQPMHIEASSTCGENG-AESICTEWFDKLGKAHKS-CEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPK-------EHYGN----LLLREKRNA-------ENPVYHFGSSDIMIGGQPL---------------------------------------------------CHGHASRIIR-------------TSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI----------------SKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVW--------------TRNQQDPRVSQ-LNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCN 1810
             CY A+     C P   N+A+ + + A+STCG+ G AE +C  W  + G+  ++ CE C+S     S+ ++ + D HI   +TCW+S  V   S   +VNLTL L KR  I +I+++ CG  PD I +YK       W PWQYF+ DC   F +P  +       S  N  + +C  ++  + Y    ++  +I F+   GR      S    +W+  T+++IS    P        E  G     +L R  R++       + PV+  G   +   G  L                                                   C+GHA+R +R              +    +C+CQH+T G DCE+C   + D+PW+ AT  +   CK C+CNNH+  C+FD N++ KSG   G  C+ CG NT G  C +C  G+ R+  + I+   AC+ C CH +GS+   PCD+ +G+C CK GVTG+TC  C  GYKQT S   PC K                 + +     ++ +C  C++ +KR  FK+FC ++  F+  + S+E+RG+ +R +  I  VW               R  Q P +   + L     TS   H     C C  F+   SYL ++ V    F  + EL+L+Q   I  W E W  +  +F  + + G+C+
Sbjct:   44 VCY-ADNKAYLCTPPFTNIAEGIPVVATSTCGQGGRAERVCKSWTSQNGQKRQTYCETCDSRKAATSRGAERLTDRHITSNQTCWVSGKVAPGS---TVNLTLSLGKRFEIFYISLQPCGPLPDSIALYKSSDFGRTWKPWQYFSTDCYRAFGLPTSSEHNAQ-ISSANIQEVLCVAIKPPVKYNAQGQVSNVIAFSTTIGRPTSQSWSPALIDWMTMTDLQISLSRFPARRKSRTVERSGGDNTVVLHRRDRSSGQRRVPQKAPVFRLGGGRLFHQGAELEEMQADGTTLNATASTATNARNEVNTHEIHHDEDDAVYFAFSDIAVGGRCKCNGHANRCVRDRIVEKNAAGEEIVTWGPLRCDCQHNTVGADCERCAPGYLDRPWARATNEDANECKACQCNNHTTSCMFDINIYRKSGGQSGGVCLGCGQNTEGVNCQECIAGFTRRPGHSIFSLAACQECQCHPIGSIGSRPCDRKTGQCHCKTGVTGQTCNRCLDGYKQTRSKITPCVKAVDALVFAGSATRSSPQTSIVGQPTADDACPPCEKNNKRFRFKKFCRRQAVFRATVISQEARGELVRLVIRIHDVWRNKGSLAQRYLPAHVRRNQAPIIPLWVPLTKKPSTSRESH---AVCVCPRFKIDQSYLFISQVYEIPFHERNELLLDQKSTILPWVENWRRRLMRFAIRQERGRCD 730          
BLAST of Netrin 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|23850796 (tr|V4AN98|V4AN98_LOTGI Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_201560 PE=4 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 3.770e-97
Identity = 185/587 (31.52%), Postives = 302/587 (51.45%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI--SKLRHLVKSNS---SCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCN 1810
            CY  + +PK C P  +N A  M + ASSTCG   +   C    DK GK  ++C  C++  PK    SK + D +     TCW+SE   +  YP +V LTL L K+  +++I+++ C   PD + IYK       W P+QY++ +C+  + K P+         +  N  + +C +   ++D     +    + F+  +GR        +   Q+W+ AT+I++  +      YG+    E+   E+  Y++  SD  +GG+  C+GHAS+ I   +    C+C+H+TAG DCE+C     D+PWS A+ R    C  C CN H+ +C F+  ++  SG   G  C+ C  NT G  C+ C  GY+R  + PI H+ ACK C CH VG+L G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  + +R   +  +   SC  C+++S+R++ K+FC ++      + SRE    W++F   +   + R       S ++     GT +WV K  + C C        YL++   K  +   ++  ++++  V+  WK+ W+ +  +F   ++ GKC+
Sbjct:   12 CYE-DSNPKRCIPDFVNAAFGMEVVASSTCGSPPSR-YCKSTTDKEGKIIRNCFICDANHPKRKHPSKYLTDLNNPNNLTCWMSEPFVQ--YPNNVTLTLSLGKKYELTYISLQFCSARPDSMTIYKSVDYGKTWIPFQYYSSNCKEMYNKAPSAIV------TKANEQEALCTEAYSNIDPLSGAR----VAFSTLEGRPSAYAFDHSPVLQDWVTATDIKV--VFNKLNTYGDEEKDEEGARES--YYYSLSDFAVGGRCKCNGHASQCIPLKNGRLGCDCKHNTAGDDCERCKPFHYDRPWSRASAREANECVACNCNLHARQCRFNMELYTLSGYKSGGVCLKCRHNTAGRNCNYCKEGYYRDRSKPITHRKACKACDCHPVGAL-GKTCNQTTGQCPCKDGVTGLTCNRCAKGYQQSKSPIAPCIKIPVTDMRGPNRQPTQEDSCKKCKKRSRRLSIKKFCRRDFAIHAQVVSREKVDDWVKFTINVLNSYKRG-----TSPIDRARRGGTYLWVPKKDLQCKCPKIRLSRRYLIVGKHKRND--SRSGFVIDRKSVVIRWKDKWQRRLRRFVKHERRGKCH 572          
BLAST of Netrin 1 vs. TrEMBL
Match: gnl|BL_ORD_ID|19079765 (tr|A0A0N5C6U6|A0A0N5C6U6_STREA Uncharacterized protein OS=Strongyloides papillosus OX=174720 PE=4 SV=1)

HSP 1 Score: 319.316 bits (817), Expect = 3.993e-97
Identity = 187/587 (31.86%), Postives = 298/587 (50.77%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPT-SVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVY-------HFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-SKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY ++G P  C P  IN A    + ASSTCG NG    C       G   + C+ C+      S  + ++ D +     TCWISE    S  P  SV LT+ L K+  +++I+++ C    D + IYK      +W P+Q+++  C     M     ++ +T S  N  + +C +   S+        F  +   P    +F    S   Q+W+ AT+IRI +      +    ++ +  N  + +        ++  +++ +GG+  C+GHASR I      Y C+C+H+TAG DCE+C     D+PW+ AT  +   C  C CN H+ KC F+  ++  SG   G  CI+C  NT G  C  C PGY+R +   I H+ ACK C CH VGSLS + C+Q SG+C CKPGVTG+TC  CA GY+Q+ + + PC KI S    ++K+N  C+ C+   KR+NFK+FC ++  F+  I SRE    ++++   IE+++ +N    R             +W+ + +  C C     G  Y+++      ++  ++EL +N   ++ DW ET  E+ ++F  ++K G C
Sbjct:    9 CYDSSGRPIRCVPDFINAAFGKPVIASSTCGVNGPSKFCAIRESANGLIREVCDICDGAIKSKSHPASLLTDLNNARNLTCWISE---PSINPNESVTLTVSLGKKFELTYISMQFCNRIADSMAIYKSVDGGKNWIPFQFYSSQC-----MEVYGRESKDTISPKNEQEAICTN-SHSLSPTASRVAFATLEGRPS---AFRFEQSPILQDWVTATDIRIVFNKPSAMNEQLYVISDSNNITDEISNDMIAKSYYSMAELAVGGRCKCNGHASRCIYDKKGQYTCDCKHNTAGNDCERCKPFHYDRPWARATSESANACVACNCNLHARKCRFNGELYRLSGNKSGGICINCRHNTAGRNCHYCKPGYYRDNTKAITHRRACKACGCHIVGSLSKS-CNQTSGQCICKPGVTGQTCNRCAKGYQQSRNPQTPCIKIPSPQEGVLKNNVVCEKCKVSPKRVNFKKFCKRQHAFQFYIISREIVADYVKYEISIERIFKKNDYKIR--------KGAQFLWLPEKMAICKCPKLRTGQRYIILGTNNLRDYK-RSELYINNHSIVVDWSETHVEKLARFGRREKNGDC 573          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 300.827 bits (769), Expect = 2.949e-93
Identity = 182/592 (30.74%), Postives = 293/592 (49.49%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISE-GVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSD-DTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNS-----SCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  +G  + C P  +N A    + ASSTCG  G    C +  DK  +  ++C  C++ DPK +     + D +     TCW SE GV   +   +V LTL L K+  +++++V+ C   PD + I+K       W P+Q+++  C+  F  P     T       N  + VC D        G      L+ F+   GR        +   Q+W+ AT++R+++          L    + + +     +  SD+ +GG+  C+GHASR ++  D     C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI        ++S      CD   + SK   +IN K++C K+   +V+I   +  G+W +F   I  V+   Q + R+ + +        +WV    V C C   + G  YL++ N + +   GQ+ ++ ++  ++  W++TW  +  +F  ++K GKC +
Sbjct:   37 CYDEHGAARRCIPDFVNAAFGKEVRASSTCGLKGPSRYCAQ--DKGEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQ--ALQGNVTLTLSLGKKFEVTYVSVQFCSKRPDSMAIFKSMDYGKTWVPFQFYSTQCRKVFNRPNRAAITKQ-----NEQEAVCTDAHAD----GRPLSGGLVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTF--------SRLTAPGEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTTASSPEEPADCDSYCKASKGKLKINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVY--KQGESRIRRGD------QLLWVRAKDVACKCPKIKTGKKYLLLGNDEDSP--GQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 596          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: ntn1b (netrin-1-like [Source:NCBI gene;Acc:111191060])

HSP 1 Score: 297.745 bits (761), Expect = 9.912e-92
Identity = 182/592 (30.74%), Postives = 292/592 (49.32%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDT-YQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVS-QLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY  NG P+ C P  +N A    + ASSTCG   A   C    ++  +  + C  C++ DPK +  +  + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  F  P+    T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT++R+++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHAS+ ++  D     CEC+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R     I H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI          S+     CD   + SK   ++  K++C K+   +V++   +  G+W +F   I  V+ + +   R   QL         +WV    V C C   + G  YL++ +    +  GQ+ ++ ++  ++  WK+ W  +  +F  +DK GKC
Sbjct:   57 CYDENGQPRRCIPDFVNAAFGKEVRASSTCGAQTAARYCVV-TERGEERSRECHTCDAADPKKAHPAAYLTDLNNPHNLTCWQSESYVQ--HPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYSTQCKKMFNRPSRAAITKQ-----NEQEAVCTDSHTDMRPLAGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTF--SRLHTFGDENEDDSELARDS-YFYAVSDLQVGGRCKCNGHASKCVKDRDGGGLVCECKHNTAGAECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKAISHRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVASPTATYTSAEEPTDCDSHCKASKGKMKVTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGEHRIRRGDQL---------LWVRAKDVACKCPKIKPGKKYLLLGS-DDDDSRGQSGVVADKGSLLIPWKDLWARRLRKFQQRDKRGKC 620          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 301.212 bits (770), Expect = 1.323e-91
Identity = 182/592 (30.74%), Postives = 293/592 (49.49%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISE-GVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSD-DTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNS-----SCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  +G  + C P  +N A    + ASSTCG  G    C +  DK  +  ++C  C++ DPK +     + D +     TCW SE GV   +   +V LTL L K+  +++++V+ C   PD + I+K       W P+Q+++  C+  F  P     T       N  + VC D        G      L+ F+   GR        +   Q+W+ AT++R+++          L    + + +     +  SD+ +GG+  C+GHASR ++  D     C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI        ++S      CD   + SK   +IN K++C K+   +V+I   +  G+W +F   I  V+   Q + R+ + +        +WV    V C C   + G  YL++ N + +   GQ+ ++ ++  ++  W++TW  +  +F  ++K GKC +
Sbjct:  214 CYDEHGAARRCIPDFVNAAFGKEVRASSTCGLKGPSRYCAQ--DKGEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQ--ALQGNVTLTLSLGKKFEVTYVSVQFCSKRPDSMAIFKSMDYGKTWVPFQFYSTQCRKVFNRPNRAAITKQ-----NEQEAVCTDAHAD----GRPLSGGLVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTF--------SRLTAPGEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVAPPTTTASSPEEPADCDSYCKASKGKLKINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVY--KQGESRIRRGD------QLLWVRAKDVACKCPKIKTGKKYLLLGNDEDSP--GQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 773          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: NTN1 (netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029])

HSP 1 Score: 237.269 bits (604), Expect = 3.340e-68
Identity = 154/584 (26.37%), Postives = 260/584 (44.52%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISE-GVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDT-YQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  +G  + C P  +N A    + ASSTCG  G    C +  DK  +  ++C  C++ DPK +     + D +     TCW SE GV   +   +V LTL L K+  +++++V+ C   PD + I+K       W P+Q+++  C+  F  P     T       N  + VC D        G      L+ F+   GR        +   Q+W+ AT++R+++          L    + + +     +  SD+ +GG+  C+GHASR ++  D     C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R  + PI H+ ACK        + + +P +      +CK    GK                                           +IN K++C K+   +V+I   +  G+W +F   I  V+   Q + R+ + +        +WV    V C C   + G  YL++ N + +   GQ+ ++ ++  ++  W++TW  +  +F  ++K GKC +
Sbjct:  214 CYDEHGAARRCIPDFVNAAFGKEVRASSTCGLKGPSRYCAQ--DKGEEGARTCHTCDASDPKRAHPGSYLTDLNNPHNLTCWQSETGVQ--ALQGNVTLTLSLGKKFEVTYVSVQFCSKRPDSMAIFKSMDYGKTWVPFQFYSTQCRKVFNRPNRAAITKQ-----NEQEAVCTDAHAD----GRPLSGGLVAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTF--------SRLTAPGEPDEDEDSLFYAVSDLQVGGRCKCNGHASRCVKERDTGGLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREAHECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGYYRDLSKPISHRKACKEIPVAPPTTTASSPEEPADCDSYCK-ASKGKL------------------------------------------KINMKKYCKKDYAVQVHILKSDKAGEWWKFTVNIISVY--KQGESRIRRGD------QLLWVRAKDVACKCPKIKTGKKYLLLGNDEDSP--GQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 723          
BLAST of Netrin 1 vs. Ensembl Cavefish
Match: ntn1b (netrin-1-like [Source:NCBI gene;Acc:111191060])

HSP 1 Score: 232.261 bits (591), Expect = 1.245e-67
Identity = 158/584 (27.05%), Postives = 263/584 (45.03%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDT-YQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVS-QLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY  NG P+ C P  +N A    + ASSTCG   A   C    ++  +  + C  C++ DPK +  +  + D +     TCW SE   +  +P +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  F  P+    T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT++R+++  +    +G+    +   A +  Y +  SD+ +GG+  C+GHAS+ ++  D     CEC+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GY+R     I H+ ACK                        +  V   T T+         S + P             +S C   + K K +  K++C K+   +V++   +  G+W +F   I  V+ + +   R   QL         +WV    V C C   + G  YL++ +    +  GQ+ ++ ++  ++  WK+ W  +  +F  +DK GKC
Sbjct:   57 CYDENGQPRRCIPDFVNAAFGKEVRASSTCGAQTAARYCVV-TERGEERSRECHTCDAADPKKAHPAAYLTDLNNPHNLTCWQSESYVQ--HPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKTWVPFQFYSTQCKKMFNRPSRAAITKQ-----NEQEAVCTDSHTDMRPLAGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDVRVTF--SRLHTFGDENEDDSELARDS-YFYAVSDLQVGGRCKCNGHASKCVKDRDGGGLVCECKHNTAGAECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYYRDMTKAISHRRACK------------------------EIPVASPTATY--------TSAEEP----------TDCDSHCKASKGKMK-VTMKKYCKKDFAVQVHVLKGDKAGEWWKFTINIISVYKQGEHRIRRGDQL---------LWVRAKDVACKCPKIKPGKKYLLLGS-DDDDSRGQSGVVADKGSLLIPWKDLWARRLRKFQQRDKRGKC 570          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009682.1 (pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 gene:ENSPMAG00000008750.1 transcript:ENSPMAT00000009682.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 156.377 bits (394), Expect = 8.950e-43
Identity = 101/324 (31.17%), Postives = 162/324 (50.00%), Query Frame = 2
Query:  395 ISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTF-------------KMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGR--SFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            I+++ ++     P+   IYK  S    W+P+QY++  C+ T+             +   L TD    FSDI+ L             GG+      + F+  +GR  ++    S   Q+W+ +TEIR++  L     +G+ +  + +   +  Y++  SD  +GG+  C+GHAS  ++       C+C+H+T G DCEKC   +ND+PW  AT  +   C  C+CN  + +C FD  ++  +G  HG  C +C DNT G  C++C   ++R+ A        C PC C+ VGS S   CD+  G+C CK GV G+ C  C PG+
Sbjct:    6 ITYVRLKFHTSRPESFAIYKRASMDGPWTPYQYYSGSCEPTYGKRNRGFLRSGDDEQTPLCTDE---FSDISPLT------------GGN------VAFSTLEGRPSAYNFDNSPVLQDWVTSTEIRVT--LNRLNTFGDEVFNDHKVLRS--YYYAISDFAVGGRCKCNGHASECVKNELGALACKCRHNTMGADCEKCLPLYNDRPWHRATSESANECTLCDCNGRADECYFDPELYRATG--HGGHCTNCRDNTDGKTCERCLENFYRRSA-----SEHCLPCNCNPVGSYS-RQCDE-QGRCSCKQGVMGERCDQCLPGF 295          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004606.1 (pep scaffold:Pmarinus_7.0:GL477874:5526:15188:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004606.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 100.138 bits (248), Expect = 1.969e-24
Identity = 61/211 (28.91%), Postives = 100/211 (47.39%), Query Frame = 2
Query:  395 ISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPAL----------TTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKN---EQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSAT 988
            I+++ +      P+   IYK  S    W P+Q+++  C+ TF +P+           T    + FSDI+ L             GG+      + F+  +GR        N   +Q W+ AT++R+S  L     +G+ +  + +   +  Y++  SD+ +GG+  CHGHAS   R SD    C CQH+T G DCE+C    N +PW+ A+
Sbjct:    8 ITYVRLRFHTSRPESFAIYKRTSPASPWQPYQFYSGTCERTFGLPSRGFLRAGDEERTALCSDEFSDISPLT------------GGN------VAFSTLEGRPGALAFDGNDKLQQEWVTATDVRVS--LRRLNTFGDEVFGDPKVLRS--YYYAVSDLAVGGRCKCHGHASECGRGSDGRLVCRCQHNTTGDDCERCLPSHNSRPWAQAS 196          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000004614.1 (pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 gene:ENSPMAG00000004198.1 transcript:ENSPMAT00000004614.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 98.2117 bits (243), Expect = 7.790e-24
Identity = 63/209 (30.14%), Postives = 100/209 (47.85%), Query Frame = 2
Query:  395 ISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPAL----------TTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQG--RSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSA 985
            I+++ +      P+   IYK  S    W P+Q+++  C+ TF +P+           T    + FSDI+ L             GG+      + F+  +G   S G  LS   Q W+ AT++R+S  L     +G+ +  + +   +  Y++  SD+ +GG+  CHGHAS   R SD    C CQH+T G DCE+C    N +PW+ A
Sbjct:    3 ITYVRLRFHTSRPESFAIYKRTSPASPWQPYQFYSGTCERTFGLPSRGFLRAGDEERTALCSDEFSDISPLT------------GGN------VAFSTLEGLFHSTGP-LSSATQEWVTATDVRVS--LRRLNTFGDEVFGDPKVLRS--YYYAVSDLAVGGRCKCHGHASECGRGSDGRLVCRCQHNTTGDDCERCLPSHNSRPWAQA 188          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008925.1 (pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 gene:ENSPMAG00000008054.1 transcript:ENSPMAT00000008925.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 103.99 bits (258), Expect = 3.666e-23
Identity = 88/346 (25.43%), Postives = 141/346 (40.75%), Query Frame = 2
Query:  395 ISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFA---KDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISY--ILTPKEHYGNLLLREKRNAENPV---YHFGSSDIMIGGQPLCHGHASRIIRTSD-DTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNV------FLKSGRIHGSS-CIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPC-----------DQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPC 1351
            ++++ V+       G  I +   +   + PWQY++    +C   + +     + V    D    + +C      +      K+   +      GR   D  S    ++ +A  IR+    I T       L  R+ R  +  V   Y++   DI +GG  +C GHAS      D    +C+C+H+T G++C+ C   +N + W   TI N   C++C C+  +  C +D  V          GR  G   C++C  NT G  C+ C  G++R           C+ C C   GSLS   C           D   G+C C+PG  G+ C  CA  Y+     K PC
Sbjct:    5 VAYVIVKAANSPRPGNWILERSLDGATYHPWQYYSVSDSECLTRYGITPTVGNPVYRRDD----EVICTSYYVVLLMLARGKIHTSL----INGRPSADDPSPKLLDFTSARYIRLRLQRIRTLNADLMTLSHRDPREVDPIVTRRYYYSIKDISVGGMCICSGHASTCPWNEDTQKMECQCEHNTCGENCQHCCPGYNQRRWRPGTINNGNTCEKCNCHGKTEDCYYDAEVDRTNRSLSVHGRFSGGGVCVNCSANTAGTNCETCRDGFYRPTGVLPNDPYPCRLCQCDPQGSLSQV-CIKDEKHADPEKDLSPGQCLCRPGFAGERCERCAFAYRGYPDCK-PC 340          

HSP 2 Score: 71.2478 bits (173), Expect = 4.647e-13
Identity = 53/191 (27.75%), Postives = 82/191 (42.93%), Query Frame = 2
Query:  848 PLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRI---HGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKN----PCRKISKLRHLVKSNSSC 1399
            P CH    R + T D     +C     G  CE+C ++F  +P S         C+RCECN +              GR+       C+ C + T G  C++CA G++            C+PC CH  G+ +   CD+++G+C C+P V G+TC  CA G+   +S       PC  +        ++  C
Sbjct:  692 PTCH-QDPRGVLTCD-----QCLPGYIGLRCERCADDFFGEPSSPG-----GSCRRCECNGNEEA--------WGGGRVCDARTGQCLRCRERTAGFHCERCADGFYGDAT----GTGGCQPCQCHPEGA-TAPQCDRINGQCPCRPSVVGRTCEQCAIGFYGLSSGAGCSPCPCHPVGTAGVACSADGRC 858          

HSP 3 Score: 58.151 bits (139), Expect = 5.955e-9
Identity = 47/143 (32.87%), Postives = 66/143 (46.15%), Query Frame = 2
Query:  896 TYQC-ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            T QC  C+  TAG  CE+C + F    +  AT      C+ C+C+              +  RI+G     C  + VG  C+QCA G+     Y +     C PC CH VG+ +G  C    G+C C PGV G++C  C  G+
Sbjct:  756 TGQCLRCRERTAGFHCERCADGF----YGDAT--GTGGCQPCQCHPEGA-------TAPQCDRINGQ--CPCRPSVVGRTCEQCAIGF-----YGLSSGAGCSPCPCHPVGT-AGVAC-SADGRCHCWPGVEGRSCDRCTSGH 876          
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000007784.1 (pep scaffold:Pmarinus_7.0:GL477336:382472:417638:1 gene:ENSPMAG00000007035.1 transcript:ENSPMAT00000007784.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 92.4337 bits (228), Expect = 1.172e-19
Identity = 77/305 (25.25%), Postives = 128/305 (41.97%), Query Frame = 2
Query:  254 PKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTS-VNLTLGLKKRSL-ISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKM----PALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNE-QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPV--YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCEC--QHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSG---RIHGSSCIDCGDNTVG 1126
            P++S  ++ +   +     T W+S        P   V +++ L+  S  + ++ V+     P+G+ I +  +    W  WQ FAKDC   + M    P    D+VN           C    + +        F ++   P     +    +    Q ++ A E+R+  +L  +      LL     A  P+  YH   S++++ G+  CHGHA R   +S   Y+C C  Q +T G +CE C   F D+PW +   RN   C+ C C   ++ C ++  +    G   R  G  C DC  NT G
Sbjct:   71 PRVSPHARPLSHVNDDDASTVWVSAPSPGPGQPPPSVAVSIELRGGSYQVFYVIVQFLSPQPEGVRIQRRPAAGSPWVDWQVFAKDCVSMYNMSKNGPLEKPDSVN-----------CLQFPREVPLSRGNVTFSVLTPEPNLRPGYNAFYATPALQAFVLAAEVRV--LLEGR------LLGVAGVAGGPLRPYH-AVSEVIVSGRCECHGHAERC-DSSTTPYRCLCSAQSNTEGPNCELCRPLFRDKPWRAGDTRNQNACRPCLCYGRALSCRYEAILDPHPGLHWRGGGGVCQDCTQNTTG 354          

HSP 2 Score: 50.8322 bits (120), Expect = 9.386e-7
Identity = 35/102 (34.31%), Postives = 48/102 (47.06%), Query Frame = 2
Query: 1076 GRIHGSSCID-------CGDNTVGPQCDQCAPGYFRQHAYPIYHKNA--CKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCR 1354
            GR +G++  D       C     G  C  C PG     +Y +   NA  C+PCLC   G+  GT CD  SG+C C PG  G+ C+ C  G+ +     + CR
Sbjct:  591 GRTNGTAGCDARTGRRHCKALASGSLCSLCRPG-----SYNLSETNAAGCEPCLCDPQGTEFGTVCDGSSGQCACLPGWAGRRCSTCQAGFYRLEGDASGCR 687          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO36836 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SHI5])

HSP 1 Score: 234.958 bits (598), Expect = 2.540e-69
Identity = 166/594 (27.95%), Postives = 266/594 (44.78%), Query Frame = 2
Query:   62 ELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFD--LEKSMDYGGDEKLFRLIPFNPRQGRSFGDVL--SKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNS------SCDFCQRKSKRINFKRFCSKETNFKVNIKSRESR--GQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            + + CY+     + C+P   +LA    +  S TCGE  +   C     +      +C  C+  + K S  +K + D H     TCW ++ V       +V L L   K   I++++++ CG  PD + IYK       W  +Q+++  C+   KM    T+     S  N    +C D  L + + YGG       I F+  +GR     +  S   Q W+ AT+I++ +         N++ R  R  ++   ++  S+  +GG+  C+GHAS  +   +    C+C+H+T G DC  C   FND+PW  AT  +   CK C CN H+  CVF   +F  SG   G  C+ C  NT G  C  C  G+++     I H   C+ C CH  GS  G  C+Q +G+C CK GV G++C  CAPGYK T S   PC +   +    +S++       C  C+R   ++  KRFC K+   KV +   E +    W+R    I  ++       + S+          +W+ K    C C   + G SY +  N++      +  ++LN   V+  W E   ++  +F    +   C
Sbjct:    1 QAKDCYNEFNRAQLCQPAFHDLAYNKDVYVSHTCGEK-SRRFCPPMSVR---GRTACGFCDERNAKTSHPAKYLTDVHNENNVTCWQADPVQSRE---NVTLILSFGKTYDITYVSLQFCGIRPDSMGIYKSMDYGKSWQAYQFYSSRCE---KMYGRVTN--GEISPENEQVALCTDGHLLRPL-YGGR------IAFSTLEGRPSASKMDYSAVMQEWVMATDIKVEF---------NMISRSARPRDS--LYYAVSEFNVGGRCHCNGHASECVSDRNGRQVCDCKHNTVGVDCGACRPFFNDRPWRPATHHSANECKMCNCNLHARTCVFSMELFKLSGGRSGGVCVKCRHNTAGRYCHYCREGFYKDPNKHITHIKVCRQCNCHPHGS-RGRVCNQSTGQCPCKEGVVGRSCDKCAPGYKSTKSNIVPCIETPNVVMSQESSTPRSRDQGCSQCRRVPLKV--KRFCRKDFALKVTVVRVEKKLPNSWVRATVNINTLF-------KRSRTRRVRRGDGYVWIKKRDFRCRCPKLKPGRSYFIAGNLRGQS--RKRSIVLNGRSVVLPWNEKLLKRIYRFIKLQRNNNC 552          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO36523 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF3])

HSP 1 Score: 191.43 bits (485), Expect = 3.197e-51
Identity = 161/579 (27.81%), Postives = 249/579 (43.01%), Query Frame = 2
Query:   59 GELQT-CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDI-NSLKPVCFDLEKSMD-YGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRT----SDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY---------------KQTNSLKNPCRKISKL---RHLVKSNSSCDFCQRKSKRINFKR-------FCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFM 1699
            G+LQ  CY + G  + C P   N A    + +++TCG+   +  C +    + +  K CE CNS DP L   +  + D       T W SE + E+     V LTL L K   +S+I +      P+ + IYK  + +  W P+QYF+  C+ T+ +      T N   D  N    +C D   ++    G    F  +   P    +F +  S   Q W+ A  +RI   L     +G+ +  +     +  Y++   D+ IGG+  C+GHAS    T         QC+CQH T G DCE+C   +ND+PW+ A+ RN   C RC CN  +  CVFD  ++ ++G  HG  C +C  NT GP C++C   ++R+ +        C  C C+ VGS+S   C+   G+C CKPGVTG  C  C   Y                 T+  K  C +  +    RH+V   + C  C+     +           FC   +          SR     F + +E     N Q      +++ +    S++    LV  G     +G ++  M  V T + M
Sbjct:   15 GQLQIQCYDSQGRAQRCMPQFGNAAFGKRVISNNTCGDP-PKKFCVQ--TGVLEVRKECEMCNSSDPALEHPALKITDIKDDTNRTWWQSETLLENP-DKPVTLTLDLGKSYDVSYIRIRFRSPRPESMAIYKKTTPSSKWIPYQYFSATCEKTYGV------TTNGIVDPRNQQVALCTDAFSTITPLTGGNVAFSTLEDRP-DAYNFDN--SPALQEWVTAVAVRIH--LRRMNTFGDEVFGDPNVLRS--YYYAIIDLSIGGRCKCNGHASECEETRLWDGQTRLQCKCQHDTEGVDCERCKPLYNDRPWARASSRNANECVRCNCNGLAESCVFDEALYRQTG--HGGRCQNCKQNTDGPNCERCKENFYRKTSL-----EPCVACGCNPVGSVS-LQCNS-EGQCRCKPGVTGIKCDKCQANYFGFSQTGCRPCQCFGPGTDPAKTQCNEKGECTCKRHVV--GAKCTLCRSGYFGLEASNPHGCKQCFCYGHSTVCKAAPGYTSRNITTDFTTGLEGWAVENDQGDSAGFVSVTAIGKESLFARASLVYIGNRRSSYGQTFGFMFRVGTVDGM 565          

HSP 2 Score: 61.6178 bits (148), Expect = 9.030e-10
Identity = 52/175 (29.71%), Postives = 73/175 (41.71%), Query Frame = 2
Query:  866 ASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTV-GP--QCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGT--------PCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKN--PC 1351
             +R I+   +    +C     G  C+ C + +   P        P  C++C C+ +      D N      R+ G  C+ C  NT  GP  QC+ CA GY+    +  Y K  CK C C+  G++S          PCD   G+C C P V+G  C  C P Y    S K   PC
Sbjct:  758 GTRCIQIGANVVCTDCPEGHVGNLCDMCQDGYYGDPMGKRGA--PTTCQKCNCSGN-----IDPNAIGSCDRLTGD-CLKCIHNTRNGPISQCELCAIGYYGNATH--YPKPQCKACECYVQGTVSPPGHDPTLPFPCDD-KGRCTCLPNVSGDKCDTCRPEYWNVASGKGCEPC 921          

HSP 3 Score: 50.0618 bits (118), Expect = 3.369e-6
Identity = 41/154 (26.62%), Postives = 68/154 (44.16%), Query Frame = 2
Query:  860 GHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            GH   +    DD  +C C  + +G  C+ C  E+    W+ A+ +    C+ C C+       ++    + +G+ H      C     G +CDQC+  ++       + +  C  C C+  GSL+ T CD+  G C C+PGV G  C  C   +
Sbjct:  876 GHDPTLPFPCDDKGRCTCLPNVSGDKCDTCRPEY----WNVASGKG---CEPCNCDTTG---SWNNTCSVTTGQCH------CKPGVTGRRCDQCSIDHY------AFSELGCLACNCNLQGSLNVT-CDE-QGVCQCRPGVLGIKCDSCQENF 1005          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO39502 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S9X8])

HSP 1 Score: 168.318 bits (425), Expect = 1.614e-43
Identity = 126/436 (28.90%), Postives = 195/436 (44.72%), Query Frame = 2
Query:   68 QTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICT-EWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDS-HIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGD-EKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRII------RTSDDTY-QCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQ--------VSGKCFCKPGVTGKTCTHCAPGY 1321
            ++CY A GD      LL+   +   I ASSTCG  G E  C        G  H    +    +P+ S   K ++ S   R K+  W SE   E+ Y     L L L+     + + +      P G++I +       W  ++YF+ DC   F  P +         D+     +C +   +++   + E +FR +    +      +  S   QN L  T IRI++  T     G+ LL + R      Y++   D++I G   C+GHA + +       T    Y +C C H+T GK+CE+C + + D PW  A   NP  C++C CN H++KC FD  V+  SG + G  C DC  NTVG  C++C P +++  +      +AC  C C   G ++G  C+         V+G+C CK  V G  C  C  G+
Sbjct:   21 RSCYPATGD------LLV--GRENKIYASSTCGLRGPEEYCVVSNLQDYGDCHICDSRPYQTNPQFSHVPKYMLSSFDGRKKDEWWQSENGRENVY-----LQLDLESEFHFTHLIMRFRTFRPAGMVIERSWDYGKKWQIYRYFSADCDKIF--PGIPKGEPKDIDDV-----ICTNKYSTVEPSTNGEVIFRAL----KSQIPIKNAYSSKVQNLLKITNIRINF--TKLHTLGDDLL-DPRPEIKRKYYYAVYDLVIRGSCSCYGHAEQCLPEPGQPTTPGMVYGRCNCTHNTTGKNCERCQDGYFDVPWRPADADNPNECRKCNCNGHAVKCRFDPAVYQASGNVSGGVCQDCEHNTVGRNCERCKPLHYQDPSKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGRCICKRNVGGVRCDRCKAGF 429          

HSP 2 Score: 74.3294 bits (181), Expect = 1.093e-13
Identity = 54/160 (33.75%), Postives = 76/160 (47.50%), Query Frame = 2
Query:  854 CHGHASRIIRTSDDTYQC-ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSS-CIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLC-HSVGSLSGTPCDQVSGKCF-CKPGVTGKTCTHCAPGY 1321
            C+GHAS     +  T  C +CQH+T GK+CE C   F    +  AT   P  CKRC+C   S    F  + ++ +     S  C  C     G QC++CA GY+     P+    +CKPC C +++       CD+++G C  C     G  C  C PGY
Sbjct:  852 CYGHASSC---NPKTGVCVDCQHNTVGKNCEACAVGF----YGIATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDKCQVGYTGRQCEECADGYY---GNPLVPGGSCKPCSCNNNIDPTVSGNCDRLTGSCLQCLYNTAGFNCERCKPGY 1001          

HSP 3 Score: 66.6254 bits (161), Expect = 2.363e-11
Identity = 46/140 (32.86%), Postives = 62/140 (44.29%), Query Frame = 2
Query:  908 ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSG--TPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +CQ    G+ CE+C + +   P           CK C CNN+      D  V     R+ GS C+ C  NT G  C++C PGYF            C  C+C   G+  G    C+  +G+C C P V GK C  CA G+
Sbjct:  930 KCQVGYTGRQCEECADGYYGNPLVPG-----GSCKPCSCNNN-----IDPTVSGNCDRLTGS-CLQCLYNTAGFNCERCKPGYFGDAI-----ARNCTSCVCDKKGTNPGFHYSCNHKTGQCNCLPDVEGKQCDRCAEGF 1053          

HSP 4 Score: 49.2914 bits (116), Expect = 5.359e-6
Identity = 47/156 (30.13%), Postives = 61/156 (39.10%), Query Frame = 2
Query:  896 TYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHK---NACKPCLCHSVGS-----------LSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            T QC+C++  +G+ C  C       P          +C+ C C  H+  C     V           C+DC  NTVG  C+ CA G+     Y I  K   N CK C C    S            S TP   +  K  C+ G TG+ C  CA GY
Sbjct:  820 TGQCQCRNWASGRQCSLCPPNMWGFP----------LCRPCRCYGHASSCNPKTGV-----------CVDCQHNTVGKNCEACAVGF-----YGIATKGTPNDCKRCQCPGGSSGNKFSESCYVDTSTTPPSVLCDK--CQVGYTGRQCEECADGY 947          

HSP 5 Score: 48.9062 bits (115), Expect = 7.217e-6
Identity = 54/219 (24.66%), Postives = 79/219 (36.07%), Query Frame = 2
Query:  854 CHGHASRIIRTSDDTYQC----------ECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCEC------NNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGS-------------------------------LSGTP-----------------CDQVSGKCFCKPGVTGKTCTHCAPG 1318
            C+GHA +  R     YQ           +C+H+T G++CE+C       P  S    +P  C  C C      N    +   D    L +GR     CI C  N  G +CD+C  G+F        + + CK C C+ +G+                               LS TP                 CD+ +G+C C+ G+TG+ C     G
Sbjct:  322 CNGHAVKC-RFDPAVYQASGNVSGGVCQDCEHNTVGRNCERCKPLHYQDP--SKKFSDPDACIACNCDPTGGVNGGECEAKNDPAAGLVAGR-----CI-CKRNVGGVRCDRCKAGFFN---LTTDNPDGCKACGCNPLGTIGECNPDTGRCTCKRYVEGEDCDRCASEYWGLSSTPAGCSNCACDVGGSYDNQCDKQTGQCRCRKGITGRQCERVKTG 528          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO46759 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RNY2])

HSP 1 Score: 126.716 bits (317), Expect = 2.933e-30
Identity = 94/333 (28.23%), Postives = 148/333 (44.44%), Query Frame = 2
Query:  395 ISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRL---IPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRII-----RTSDDTYQCECQHST--AGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRI---HGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSG-TPCDQV-SGKCFCKPGVTGKTCTHCAPGYKQTNSLKNP 1348
            I F+ +   G  P+ I+I +       + PWQYFA DCQ +F M        N  + +N     C   ++ + Y      F+L   IP  P          S    +++ A+ +RI       + Y + L++ +++      +F    +++ G+  CHGHA ++       +S    +CEC  ST   G+ CE C   +N++ +   T  +P  C +CECNNH+  C ++ ++           G  CI+C  NT G  C  C   +FR+    +   + C PC C   G  +G T C +V SG C CK  V   TC  C  GY   +S  NP
Sbjct:  334 IFFVIMVFYGPPPEAILIERSRDRGSTYEPWQYFASDCQSSFGME-------NNGNLVNPDSINCIQYQRPLPYSSATIAFKLERSIPARPFGAPCSNLYCSTRFLDFIKASNVRI-------QLYNHTLIQNEKHR-----YFALKRVLVTGRCECHGHAQKVTFIKGNSSSPGRCRCECDPSTFTQGEKCESCLPMYNNKAFLRGTNDDPYPCVKCECNNHATACYYNSSLDPSPASRTVGGGGVCINCLHNTAGQFCHVCRDDFFREPGKSLSAVDVCSPCQCTGPGVETGKTSCARVSSGNCTCKKYVREPTCGQCMKGYFNLSS-SNP 646          

HSP 2 Score: 54.6842 bits (130), Expect = 9.313e-8
Identity = 42/144 (29.17%), Postives = 60/144 (41.67%), Query Frame = 2
Query:  911 CQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSG--TP-----CDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            C H+TAG+ C  C ++F  +P  S +  +  VC  C+C    ++            R+   +C  C      P C QC  GYF   +    +   C+ C C+  G+L G  TP     C   +GKC C   V G  C  C   Y
Sbjct:  565 CLHNTAGQFCHVCRDDFFREPGKSLSAVD--VCSPCQCTGPGVE-----TGKTSCARVSSGNCT-CKKYVREPTCGQCMKGYFNLSSS---NPEGCQACNCNPKGTLGGDRTPAGELECSGSNGKCACLTNVQGLRCDKCVSAY 697          
BLAST of Netrin 1 vs. Ensembl Nematostella
Match: EDO36500 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SIF5])

HSP 1 Score: 126.716 bits (317), Expect = 3.996e-30
Identity = 119/445 (26.74%), Postives = 182/445 (40.90%), Query Frame = 2
Query:   44 LVALNGE----LQTCYSAN-GDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISE--------GVHESSYPTSVNLTLGLKKRSLIS-FITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKM-PALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDE-KLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHA---SRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGY 1321
            +V LN +     +TCY  + G   PC P    ++   ++  S+TCG   A+       +       +    N   P  +     +V      K T W S+        G+     P  VN+TL   KR  +S  I        P  +   K +     W     +A  C   + M P    D  N F      K  C +     +Y G E +   ++ F   +     D  +   Q++L+ T++R+       +  G  LL +     N +Y +  S++ + G+  C+GHA   S  I +     +CEC+H+T G DCE C   FN++PW  A   +   C+ C CNNH+  CV  +N  L  G      C  C  NT G  C  C   ++R  + PI H NAC     +       T  +Q+ G+C CKP V G+ C  C PG+
Sbjct:   18 VVCLNSQNTCRFETCYERDTGRATPCMPFTSFMSLTRNVTTSNTCGTTRAKYCELPGPEPCYYCDANSSNSNEQHPVTNLVDNELVLPFYAQKYTWWQSQTWWETNQLGLSSIENPPKVNITLSFGKRYQLSGHIKATFYSKRPKAMCFDKSNDFGHTWETLLCYAWRCDRFYNMEPQSNPDPANPF------KLYCTE-----EYSGHEPRKLGIVEFIASKRYEICDYFNPEVQDYLSVTDVRLRLEYPASD--GMELLYQDEQTLNKLY-YAISNVEVTGRCSCNGHAMGCSGPIMSR----RCECEHNTMGTDCEMCEPLFNNRPWMRANQTHGNECQECNCNNHATSCV--YNETLGYGL-----CKGCQHNTQGDHCQNCTAKHYRDLSKPINHVNACLGITNNGSCLTQATDTEQI-GQCSCKPNVYGRRCDQCIPGH 436          

HSP 2 Score: 60.8474 bits (146), Expect = 1.705e-9
Identity = 48/153 (31.37%), Postives = 69/153 (45.10%), Query Frame = 2
Query:  902 QCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFL--KSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSL--SGTPCDQVSGKCFCKPG--VTGKTCTHCAP-GYKQTNSL 1339
            + EC  +  G  CE C E +  QP           C  C CN+ S  C  +  V    K G  HG  C  C +N  GP+C +C P Y+         K+ CK C C+  G+L  + + CDQ +G+C C     + G+ C  C    Y +++SL
Sbjct: 1073 RAECHRNYTGLSCEVCAEGYTRQPMGGTPFDR---CVLCSCNDRSRFCHPETGVCTDCKIG-THGYRCELCTNNVQGPECVRCKPQYWG------LSKDGCKACDCNLPGTLYSNTSVCDQTTGQCSCNATLHIGGQLCDRCEENAYNKSDSL 1215          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: NTN1 (netrin-1 [Source:NCBI gene;Acc:101155405])

HSP 1 Score: 303.138 bits (775), Expect = 5.166e-94
Identity = 179/592 (30.24%), Postives = 297/592 (50.17%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  +G+P+ C P  +N A    ++ SSTCG+  +        +K  +  ++C  C++ DPK       + D +     TCW SE   +  YP +V LTL L K+  +++++++ C   P+ ++IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+I++  + +    +G+    +   A +  Y +  SD+ +GG+  C+GHASR ++  D +  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI        ++S+     C+   + SK   +IN K++C K+   +V+I   +  G+W +F   I  V+ + +   R     L        WV    V C C   + G  YL++ N + +    Q+ ++ ++  ++  W++TW  +  +F  ++K GKC +
Sbjct:   38 CYDEHGNPRRCIPDFVNAAFGKEVKVSSTCGKTPSRYCVVTSAEKGEERTRNCHSCDASDPKKYHPPAYLTDLNNPHNLTCWQSENFIQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMVIYKSMDNGKTWVPFQFYSTQCRKMYNKPNRAVITKQ-----NEQEAVCTDSHTDMYPLTGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKV--VFSRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASRCVKDRDGSLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVSPPTTPASSTEEASDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKMGEWWKFTVNIISVYKQGESRIRRGDQFL--------WVRAKDVACKCPKIKPGKKYLLLGNDEVSP--SQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 602          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: ntn1b (netrin-1 [Source:NCBI gene;Acc:101161061])

HSP 1 Score: 295.819 bits (756), Expect = 2.745e-91
Identity = 184/591 (31.13%), Postives = 291/591 (49.24%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVS-QLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY  NG+P+ C P  +N A    +  SSTCG N A   C    +K  +  + C  C+S DPK +     + D +     TCW SE   +  YP +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +           T +  N  + +C D    M    GG      LI F+   GR        +   Q+W+ AT+I++  I +    +G+    +   A +  Y +  SD+ +GG+  C+GHAS+ ++  +    CEC+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GYFR  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +      +  S CD   + SK   +I  K++C K+   +V++   +  G+W +F   I  V+ + +   R   QL         +WV    V C C   + G  YL++      +  G + ++ ++  ++  WK+ W  +  +F  +DK GKC
Sbjct:   40 CYDENGNPRRCIPDFVNSAFGKDVRVSSTCG-NPAARFCVV-SEKGEERTRDCHTCDSNDPKKAHPPAYLTDLNNPHNLTCWQSETYVQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKSWVPFQFYSTQCKKMY-----NRQNKATITKQNEQEAICTDSHTDMHPLTGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKV--IFSRLHTFGDENEDDSELARDS-YFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYFRDMSKPISHRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVASPTSTYSSYEEPSDCDSYCKASKGKMKITMKKYCKKDYAVQVHVLKGDKAGEWWKFTVNIISVYKQGRHRIRRGDQL---------LWVRAKDVACRCPKIKPGRKYLLLGT--DDDSPGHSGVVADKGSLLIPWKDLWGRRLRKFQQRDKRGKC 600          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: ntn1b (netrin-1 [Source:NCBI gene;Acc:101161061])

HSP 1 Score: 295.819 bits (756), Expect = 3.298e-91
Identity = 184/591 (31.13%), Postives = 291/591 (49.24%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI-----SKLRHLVKSNSSCDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVS-QLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKC 1807
            CY  NG+P+ C P  +N A    +  SSTCG N A   C    +K  +  + C  C+S DPK +     + D +     TCW SE   +  YP +V LTL L K+  +++++++ C   P+ + IYK       W P+Q+++  C+  +           T +  N  + +C D    M    GG      LI F+   GR        +   Q+W+ AT+I++  I +    +G+    +   A +  Y +  SD+ +GG+  C+GHAS+ ++  +    CEC+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  GYFR  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI     +      +  S CD   + SK   +I  K++C K+   +V++   +  G+W +F   I  V+ + +   R   QL         +WV    V C C   + G  YL++      +  G + ++ ++  ++  WK+ W  +  +F  +DK GKC
Sbjct:   41 CYDENGNPRRCIPDFVNSAFGKDVRVSSTCG-NPAARFCVV-SEKGEERTRDCHTCDSNDPKKAHPPAYLTDLNNPHNLTCWQSETYVQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMAIYKSMDYGKSWVPFQFYSTQCKKMY-----NRQNKATITKQNEQEAICTDSHTDMHPLTGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKV--IFSRLHTFGDENEDDSELARDS-YFYAVSDLQVGGRCKCNGHASKCVKDREGNLVCECKHNTAGPECDRCKPFHYDRPWQRATAREANECVACHCNLHARRCRFNMELYKLSGRRSGGVCLNCRHNTAGRHCHYCKEGYFRDMSKPISHRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVASPTSTYSSYEEPSDCDSYCKASKGKMKITMKKYCKKDYAVQVHVLKGDKAGEWWKFTVNIISVYKQGRHRIRRGDQL---------LWVRAKDVACRCPKIKPGRKYLLLGT--DDDSPGHSGVVADKGSLLIPWKDLWGRRLRKFQQRDKRGKC 601          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: NTN1 (netrin-1 [Source:NCBI gene;Acc:101155405])

HSP 1 Score: 291.582 bits (745), Expect = 6.911e-90
Identity = 177/592 (29.90%), Postives = 290/592 (48.99%), Query Frame = 2
Query:   74 CYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CDFCQRKSK---RINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            CY  +G+P+ C P  +N A    ++ SSTCG+                       C++ DPK       + D +     TCW SE   +  YP +V LTL L K+  +++++++ C   P+ ++IYK       W P+Q+++  C+  +  P     T       N  + VC D    M    GG      LI F+   GR        +   Q+W+ AT+I++  + +    +G+    +   A +  Y +  SD+ +GG+  C+GHASR ++  D +  C+C+H+TAG +C++C     D+PW  AT R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R  + PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI        ++S+     C+   + SK   +IN K++C K+   +V+I   +  G+W +F   I  V+ + +   R     L        WV    V C C   + G  YL++ N + +    Q+ ++ ++  ++  W++TW  +  +F  ++K GKC +
Sbjct:   38 CYDEHGNPRRCIPDFVNAAFGKEVKVSSTCGKT----------------------CDASDPKKYHPPAYLTDLNNPHNLTCWQSENFIQ--YPQNVTLTLSLGKKFEVTYVSLQFCSPRPESMVIYKSMDNGKTWVPFQFYSTQCRKMYNKPNRAVITKQ-----NEQEAVCTDSHTDMYPLTGG------LIAFSTLDGRPSAHDFDNSPVLQDWVTATDIKV--VFSRLHTFGDENEDDSELARD-SYFYAVSDLQVGGRCKCNGHASRCVKDRDGSLVCDCKHNTAGPECDRCKPFHYDRPWQRATAREANECVACNCNLHARRCRFNMELYKLSGRKSGGVCLNCRHNTAGRHCHYCKEGFYRDLSKPISHRKACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPIAPCIKIPVSPPTTPASSTEEASDCESYCKASKGKLKINMKKYCKKDYAVQVHILKADKMGEWWKFTVNIISVYKQGESRIRRGDQFL--------WVRAKDVACKCPKIKPGKKYLLLGNDEVSP--SQSGVVADKGSLVIQWRDTWARRLRKFQQREKKGKCKK 580          
BLAST of Netrin 1 vs. Ensembl Medaka
Match: ntn2 (netrin-3 [Source:NCBI gene;Acc:101160359])

HSP 1 Score: 281.182 bits (718), Expect = 1.942e-85
Identity = 175/619 (28.27%), Postives = 296/619 (47.82%), Query Frame = 2
Query:   65 LQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMD--YGGDEKLFRLIPFNPRQGRSFGDVLSKNE--QNWLAATEIRISYILTPKEHYGNLLLREKRNA---ENPV--------YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSS-----CD-FCQ--RKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVK-------------TTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNR 1813
            L  CY   G  + C P  IN A    +  SS CG   + S           + ++C+ C++ DP+ +  +  + D +     TCW SE ++ S  P +V LTL L K+  I++++++ C   P+ + IYK       W P+Q+++  C+  +  P   T T       N  + +C D    +    GG      LI F+   GR        +   Q+W+  T+IR+ +   P+     +L     N    ++PV        Y +   D  +GG+  C+GHASR ++  +    C+C+H+T G +C++C     D+PW  A  R    C  C CN H+ +C F+  ++  SGR  G  C++C  NT G  C  C  G++R    PI H+ ACK C CH VG+ +G  C+Q +G+C CK GVTG TC  CA GY+Q+ S   PC KI  +      +S+     C+ +C+  + + +IN K++C K+   +VN+   E+ G W +F   +  V+ +++ +P     N+       +WVH   + C C   +    +LVM   +             T+    +  L+ +++ ++  W++ W  +  +F  ++K GKC++
Sbjct:   34 LDPCYDETGTARRCIPEFINAAFGKEVMVSSVCGRPPSRSCSVVERGDERPSVRTCQICDAADPRRAHPASYLTDLNSAHNLTCWQSENLNTS--PHNVTLTLSLGKKFEITYVSLQFCSPRPESLAIYKSMDYGKTWMPYQFYSSQCRRMYNKPNKATITKQ-----NEQEALCTDGHTDLYPLSGG------LIAFSTLDGRPSSKDFDNSPVLQDWVTVTDIRVVF-GRPQLSREFVLGAGSNNGGRDDDPVAVTSTLSTYFYAVGDFQVGGRCKCNGHASRCLKDKEGKLVCDCKHNTEGPECDRCKPFHYDRPWQRANAREANECLPCNCNLHARRCRFNMELYKLSGRKSGGVCMNCRHNTAGRHCHYCKEGFYRDMGRPITHRRACKACDCHPVGA-AGKTCNQTTGQCPCKDGVTGITCNRCAKGYQQSRSPVAPCIKIPVVNPTAVVSSTEEPADCESYCKPVKGNLKINMKKYCKKDYAVQVNVLDMETVGDWAKFSVSLVSVY-KSRGEPLKRGDNI-------LWVHMKDLACKCPKIQMSKKFLVMGGSEGGTGPAAGPGVGATSPGAERVGLVADKNSLVIQWRDVWSRRLRKFQRKEKKGKCSK 629          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000006779.1 (SMESG000006779.1)

HSP 1 Score: 404.06 bits (1037), Expect = 5.145e-133
Identity = 219/607 (36.08%), Postives = 333/607 (54.86%), Query Frame = 2
Query:   44 LVALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGA-ESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTPKEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPA--VCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGT--SMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQKRHVKRRN 1849
            L  + G   +C+S +G  K CEP  IN+AQ    E +STCG+ G+ + IC  W+   G     C KC+   P+LS++  +V D +I+G ET W+S  + + S   S+N+T+ L K   + +I VE  G  PD +++YK D     W PW YF+  C+ +FKM       +   S  N + P CF  + S+         +++PFNP  GR+     S+  + W++ T+I IS +LT           +KRN ++P  H   SDI IG +  C+GHA  +I+ +  T  C+C H TAG DC +C +  NDQPW       PA  +C+RC CNNH+ +C FD  ++  S   HGS C+ C  +T GP C+ C+PGY+R  A+PI H   C+ C CH  GSL  + C+  +G C CK GV GK C  C  GY+QT S   PC   +K  +L+ +   C  C +   RI F++FC K    K++I+S+E  G+W RF   + ++W R QQ  + SQ+NL  SE +   +WV    + C C + + GH+YL++  +K   ++ Q ELI+++     DW + W  +   F  +++ GKC+R+  +++H K  N
Sbjct:   17 LTIIKG-FSSCFSESGRAKFCEPDFINVAQNATFEVTSTCGQKGSTDRICRNWYTSSGLNEGKCLKCDDRIPELSRNISLVFDRNIQGHETVWVSGRIPKFSGIHSINITINLNKLYEVYYIIVEFAGQLPDSMVLYKRDKNGKTWLPWNYFSSSCKKSFKMKRSKPLHIQQRS-FNKISPACFSFKHSVQNITSN--IKVLPFNPMTGRTSLLPNSRLIKEWVSVTDIMIS-LLTDGS--------KKRN-KSPYDHLSISDITIGARSQCYGHAKSLIKKNGTTV-CDCLHKTAGPDCSQCLKTHNDQPWKIIFPSEPAGNICERCFCNNHAEECKFDEKIYKNSSGKHGSRCLHCLHHTTGPHCNSCSPGYYRNRAFPINHPQVCQKCGCHPYGSLPQSYCNPDNGICQCKIGVEGKLCNRCKKGYQQTKSSSTPCAPETK-NNLMATEERCGSCGKNRPRIRFRKFCKKHIMIKISIQSKEIHGEWTRFGVRVLKIW-RIQQSLK-SQVNLYESEYSIYPIWVENADIRCKCPNLQLGHTYLLLTKIKLKNYLNQPELIVDRKSSALDWSDDWIRRLDMFKMREEQGKCDRYQYKRKHSKLMN 605          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000050895.1 (SMESG000050895.1)

HSP 1 Score: 395.201 bits (1014), Expect = 1.364e-128
Identity = 206/616 (33.44%), Postives = 329/616 (53.41%), Query Frame = 2
Query:   47 VALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKL-GKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDL---EKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYI-LTPKE----------HYGNLLLREKRNAEN----PVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQKRHV 1837
            V    +   CY  NG P+ C P   N+ + +  E +STCG NG E IC  W+DK   +A + C  C++       S   + D HI   +TCW S  + E+     VN+T+ LKK   + +I +++CG  PD I IYK       W PWQ+F++DC   FKMP  T +  +  +  N  + +C +L   E+  DYG  E +   +PF+   GR  G   S++   W+  T++RIS +  TP++          ++   L +   N  N    P+ HFG SD+ +GG+  C+GHA+R +   +D  +C+C H+T G++CE+C   + D+PW  AT +N  VCK C+C NHS KC+F   ++ ++   HG  C++C  NT G  CD+CA  ++R    P+ H  AC  C CH++GS+    CD+ +G+C+C+ GVTG+TC  C  GYKQ+NS   PC   S +  +  ++  C  C  K KRI FK+FC +++ F+    S+E  G  IR+  +I+++W  ++           +      W++ + V C C   E G SYL++   K   ++   EL ++   V+  W  +WE +  +F  ++K GKC ++ ++K  +
Sbjct:   21 VIFESQSSPCY-LNGRPQQCLPSFTNIIENVKAETTSTCGTNGPEQICRNWYDKTTAEARQYCSICDAKHRSYPPSH--ITDRHIPKNQTCWFSGPLQENPGQNEVNITVSLKKSFEVYYIALQICGTLPDSIAIYKSLDFGVSWKPWQFFSQDCYRAFKMPT-TNEQNSQITPANIHEVLCVELKAPERYNDYGQAETV---LPFSTIYGRPSGPPWSQDLVEWMTMTDLRISLMRFTPEKSTPYRLKELYYHTESLPQAPPNLVNHKTEPIVHFGLSDLAVGGRCKCNGHANRCLIDDNDEIKCDCHHNTEGQECERCKSNYLDRPWQRATRQNANVCKLCQCYNHSDKCMFSMGMYKQTRGQHGGVCLECKHNTEGHACDECAAFHYRDITKPVTHPQACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGYKQSNSTVRPCIPSSGMADMANTSPVCKKCNEKRKRIVFKKFCRRKSVFRATALSKEIHGNMIRYELKIDEIWRVDKNVWEFLPRETPAMHTYRAWINSEDVRCNCPKVELGQSYLILTRAKYYLYLRNKELYIDSRSVMLPWHNSWERRLQKFQKREKRGKCEQYFKKKMKI 629          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000050895.1 (SMESG000050895.1)

HSP 1 Score: 393.66 bits (1010), Expect = 5.483e-128
Identity = 204/616 (33.12%), Postives = 329/616 (53.41%), Query Frame = 2
Query:   47 VALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKL-GKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDL---EKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYI-LTPKE----------HYGNLLLREKRNAEN----PVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQKRHV 1837
            V    +   CY  NG P+ C P   N+ + +  E +STCG NG E IC  W+DK   +A + C  C++       S   + D HI   +TCW S  + E+     VN+T+ LKK   + +I +++CG  PD I IYK       W PWQ+F++DC   FKMP  T +  +  +  N  + +C +L   E+  DYG  E +   +PF+   GR  G   S++   W+  T++RIS +  TP++          ++   L +   N  N    P+ HFG SD+ +GG+  C+GHA+R +   +D  +C+C H+T G++CE+C   + D+PW  AT +N  VCK C+CN HS +C F+  +++++   +G  CI+C  +T G  C+ C  G+FR    P  H+ AC  C CH++GS+    CD+ +G+C+C+ GVTG+TC  C  GYKQ+NS   PC   S +  +  ++  C  C  K KRI FK+FC +++ F+    S+E  G  IR+  +I+++W  ++           +      W++ + V C C   E G SYL++   K   ++   EL ++   V+  W  +WE +  +F  ++K GKC ++ ++K  +
Sbjct:   21 VIFESQSSPCY-LNGRPQQCLPSFTNIIENVKAETTSTCGTNGPEQICRNWYDKTTAEARQYCSICDAKHRSYPPSH--ITDRHIPKNQTCWFSGPLQENPGQNEVNITVSLKKSFEVYYIALQICGTLPDSIAIYKSLDFGVSWKPWQFFSQDCYRAFKMPT-TNEQNSQITPANIHEVLCVELKAPERYNDYGQAETV---LPFSTIYGRPSGPPWSQDLVEWMTMTDLRISLMRFTPEKSTPYRLKELYYHTESLPQAPPNLVNHKTEPIVHFGLSDLAVGGRCKCNGHANRCLIDDNDEIKCDCHHNTEGQECERCKSNYLDRPWQRATRQNANVCKYCDCNLHSYRCYFNSQIYVRNNYTNGGVCINCRHHTTGNNCENCENGFFRNWTKPQEHRAACTSCKCHTIGSIKQNECDKKTGQCYCRDGVTGQTCDRCKDGYKQSNSTVRPCIPSSGMADMANTSPVCKKCNEKRKRIVFKKFCRRKSVFRATALSKEIHGNMIRYELKIDEIWRVDKNVWEFLPRETPAMHTYRAWINSEDVRCNCPKVELGQSYLILTRAKYYLYLRNKELYIDSRSVMLPWHNSWERRLQKFQKREKRGKCEQYFKKKMKI 629          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000076695.1 (SMESG000076695.1)

HSP 1 Score: 362.459 bits (929), Expect = 5.598e-116
Identity = 209/659 (31.71%), Postives = 319/659 (48.41%), Query Frame = 2
Query:   41 GLVALNGELQTCYSANGDPKPCEPLLINLAQPMHIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYI-----LTPKEHYGNLLLREKRNAENPV--------------YHFGSSDIMIGGQPLCHGHASRIIRTSDDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKI---------------SKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVWTRNQQDPRVSQLNLESSE---GTSMWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQKRHVK----------RRNFASTYNQYA 1876
             +  L    QT    +G    C P  IN+AQ   I  +S+CGE   + IC  W        + C  C++       S K + D   +   TCW S  V+       VN+++  KK   + ++ ++ C   PD I IYK       W PWQY++K+CQ  F +P      +    +  SL P CFDL +    G   +   ++PF+   GR   D L K    W+  T++RI+       ++    YG   L + R   + +               ++G SD+ +GG+  C+GH+++ I  +D    C+C+H+T G DC+KC E F+D  W  A+  NP  CKRC+CN HS  C F+ NV++K+G+  G  C  C  NT G QC  C  GY+R    P+ H  ACK C CH+VGS +   CD+  G+CFCK GV G+ C  C  GY QT S+  PC K                SK   +  + S C  C  K KRI FK+FC +++ F   I+S+E  G+ +RF  +I++VW   +   ++SQ   E S+      +W+  + V C C +   G SYL++   K      + EL+L+   V+  W+ +WE +  +F T+    KC +F ++K  +K          +R+F  T N ++
Sbjct:   21 AISVLYENKQTTCEFHGKDYYCTPPFINIAQRAKITVTSSCGEILPDDICPHWKYYSSNHFRDCSICDNDRKNSIYSIKSLTDPLNQFNHTCWFSGPVYNQHGLNHVNISIAFKKNFEVFYVALQFCSELPDSITIYKSHDNGKKWIPWQYYSKNCQKAFNLPPTQEFPIQEGLEY-SLSPTCFDLNQKQKDGNLGQAESILPFSSTIGRKMNDTLIK----WITITDLRITLSRFDDQMSSYFDYGKYFLLKHRRGRDILNMSTFSVNDKSMSKVYYGVSDLSVGGRCQCYGHSNKCIINNDGNIVCDCKHNTEGADCDKCKEGFHDLQWERASKLNPFSCKRCQCNLHSQHCKFEKNVYMKTGQKSGGVCRKCQHNTAGNQCHFCDNGYYRDWTKPLSHDLACKKCKCHAVGSTNVNSCDKKLGQCFCKEGVIGRKCDKCKIGYLQTRSMLKPCVKTYDIIESSQTKKSDLNSKYMDMPNTESECKPCDEKRKRIRFKKFCRRDSVFMGVIESKEVHGKMVRFELQIKEVW---RVSGKISQFISEISQEQYAVPLWISHEEVRCDCPNISLGRSYLILMKYKIYHHRHREELLLDSRTVMLQWRPSWERRLQKFQTKANEEKCEKFLQKKSKIKHNRINRVGKNKRSFLLTKNPFS 671          
BLAST of Netrin 1 vs. Planmine SMEST
Match: SMESG000006806.1 (SMESG000006806.1)

HSP 1 Score: 300.442 bits (768), Expect = 1.962e-92
Identity = 202/660 (30.61%), Postives = 310/660 (46.97%), Query Frame = 2
Query:   59 GELQTCYSANGDPKPCEPLLINLAQPM-HIEASSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIRGKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGH-NPDGIIIYKMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLEKSMDYGGDEKLFRLI------PFNPRQGRSFGDVLSKNEQNWLAATEIRIS---------------YILTP-----------KEHYGNLL-----LREKRNAENPVYH----FGSSDIMIGGQPLCHGHASRIIRTS-DDTYQCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVFDFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACKPCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPCRKISKLRHLVKSNS---SCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQWIRFISEIEQVW-------TRNQQDPRVSQLNLESSEGTS----MWVHKDLVDCGCVDFEFGHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMGKCNRFTRQKRHVKRRNFASTY 1864
            G    CYS  G    C P   N+ + M   E +STCG+N  + IC +        H +C  C     K + S   + D H+    T W S+ V+      +VN+T    K   I +I++ L     PD III K       W+ W YF+KDC  +F +  +     N +SD + +     D   +     D KL  L+       F       F    S    +W++AT IRI+               +   P           K +Y ++L     L++K+     V      F  +DI IGG+  C+GHA R ++   D+TY C+CQH+TAGKDCE C E F D+ WS AT+ + A CKRC CN HS KC F+  +++ S +  G  C+ C  NT G  C QC  GY R  + P+ H + C  C CH +GS+    CDQ + +C CK GV G +C  C  G++QT S   PC  +  L  +  + +    C  C  K KRI FK++C K+    V ++SRE  G+  RF  ++  V+       T    D   S   + S++       MW+ +  + C C   + G +YLV+  +   +++ ++EL+L+Q  V   W++TWE +  +F  ++  G C ++  ++R+ +R+     Y
Sbjct:   30 GSNSLCYSE-GKAFRCVPPFTNIIENMIPDEITSTCGQNKKQRICVD--------HINCHSC----MKDTHSINYLTDQHLNNNITFWASDFVNHGD---NVNITFSFGKLFEIYYISLVLIPLLEPDSIIISKSIDNGTSWTEWHYFSKDCYRSFGIQPMD---FNHYSD-SKITESTVDQSLTCTSIPDSKLGNLVNSPSVLAFTTNNPNFFSHA-SDQYNSWMSATNIRITLRKSETNFLNSHLDGFTYPPHLKQYFNRIYRKNNYSSILPVNRKLKQKKRNSPSVLKISDFFALADISIGGRCQCYGHAGRCLKNPVDNTYHCDCQHNTAGKDCEMCREGFVDKRWSVATVNSAAECKRCNCNLHSKKCEFNEKLYIVSNKQSGGVCVGCEHNTDGRYCHQCNKGYHRDWSKPLSHHHVCIKCRCHPIGSIYPDVCDQRNSQCTCKTGVGGLSCNRCQKGFQQTKSPITPCVDVIDLHKIPMAQAPENRCQHCNNKRKRIRFKKYCRKDAVLLVTMQSREQHGEMARFEMKVNYVYRIDTSKFTEMHPDFLASMNGIMSNQFIHSTFPMWIKETDLKCKCPSLQLGMTYLVILKLHAIKYLERSELLLDQKSVALPWQKTWERRMKKFSNKEHQGLCEKWKLKRRYYRRQKHTKNY 668          
The following BLAST results are available for this feature:
BLAST of Netrin 1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN12.966e-9330.53netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN38.392e-7528.20netrin 3 [Source:HGNC Symbol;Acc:HGNC:8030][more]
LAMC14.038e-5732.18laminin subunit gamma 1 [Source:HGNC Symbol;Acc:HG... [more]
LAMC33.601e-5331.25laminin subunit gamma 3 [Source:HGNC Symbol;Acc:HG... [more]
NTN53.293e-5030.61netrin 5 [Source:HGNC Symbol;Acc:HGNC:25208][more]
back to top
BLAST of Netrin 1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
unc-69.285e-9731.77Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
unc-69.285e-9731.77Netrin unc-6 [Source:UniProtKB/Swiss-Prot;Acc:P34... [more]
lam-24.593e-5731.83Laminin-like protein lam-2 [Source:UniProtKB/Swis... [more]
lam-31.849e-4227.04LAMinin related. See also lmb; Laminin alpha chain... [more]
lam-11.841e-3627.48LAMinin related. See also lmb [Source:UniProtKB/T... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NetA3.881e-7128.99gene:FBgn0015773 transcript:FBtr0073942[more]
NetA3.881e-7128.99gene:FBgn0015773 transcript:FBtr0346088[more]
NetA1.465e-7032.83gene:FBgn0015773 transcript:FBtr0308337[more]
LanB21.205e-5433.26gene:FBgn0267348 transcript:FBtr0345031[more]
LanB21.205e-5433.26gene:FBgn0267348 transcript:FBtr0076382[more]
back to top
BLAST of Netrin 1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ntn1a3.405e-9731.37netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
ntn1a3.405e-9731.37netrin 1a [Source:ZFIN;Acc:ZDB-GENE-990415-169][more]
ntn21.731e-9129.55netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2][more]
ntn21.761e-9129.55netrin 2 [Source:ZFIN;Acc:ZDB-GENE-050310-2][more]
ntn1b8.704e-9029.90netrin 1b [Source:ZFIN;Acc:ZDB-GENE-990415-168][more]
back to top
BLAST of Netrin 1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ntn18.215e-8930.42netrin 1 [Source:NCBI gene;Acc:779839][more]
rps163.177e-8429.85ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-... [more]
rps161.029e-7828.96ribosomal protein S16 [Source:Xenbase;Acc:XB-GENE-... [more]
utp42.521e-5631.67UTP4 small subunit processome component [Source:Xe... [more]
utp42.767e-5631.67UTP4 small subunit processome component [Source:Xe... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ntn13.380e-9330.36netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn13.380e-9330.36netrin 1 [Source:MGI Symbol;Acc:MGI:105088][more]
Ntn31.554e-7527.69netrin 3 [Source:MGI Symbol;Acc:MGI:1341188][more]
Lamc11.725e-5731.89laminin, gamma 1 [Source:MGI Symbol;Acc:MGI:99914][more]
Lamc31.525e-5532.27laminin gamma 3 [Source:MGI Symbol;Acc:MGI:1344394... [more]
back to top
BLAST of Netrin 1 vs. UniProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P34710|UNC6_CAEEL1.181e-9531.77Netrin unc-6 OS=Caenorhabditis elegans OX=6239 GN=... [more]
sp|O95631|NET1_HUMAN1.424e-9230.53Netrin-1 OS=Homo sapiens OX=9606 GN=NTN1 PE=1 SV=2[more]
sp|O09118|NET1_MOUSE2.364e-9230.36Netrin-1 OS=Mus musculus OX=10090 GN=Ntn1 PE=1 SV=... [more]
sp|Q90922|NET1_CHICK2.672e-9130.52Netrin-1 OS=Gallus gallus OX=9031 GN=NTN1 PE=1 SV=... [more]
sp|Q2HXW4|NET1_PIG4.901e-9130.50Netrin-1 OS=Sus scrofa OX=9823 GN=NTN1 PE=2 SV=1[more]
back to top
BLAST of Netrin 1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
gnl|BL_ORD_ID|186954418.081e-9831.46tr|A0A0K0EM36|A0A0K0EM36_STRER Uncharacterized pro... [more]
gnl|BL_ORD_ID|167219068.343e-9831.80tr|A0A090LSV4|A0A090LSV4_STRRB Netrin-1a OS=Strong... [more]
gnl|BL_ORD_ID|246656791.610e-9729.21tr|A0A5K3F5Z3|A0A5K3F5Z3_9CEST Uncharacterized pro... [more]
gnl|BL_ORD_ID|238507963.770e-9731.52tr|V4AN98|V4AN98_LOTGI Uncharacterized protein OS=... [more]
gnl|BL_ORD_ID|190797653.993e-9731.86tr|A0A0N5C6U6|A0A0N5C6U6_STREA Uncharacterized pro... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN12.949e-9330.74netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
ntn1b9.912e-9230.74netrin-1-like [Source:NCBI gene;Acc:111191060][more]
NTN11.323e-9130.74netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
NTN13.340e-6826.37netrin 1 [Source:HGNC Symbol;Acc:HGNC:8029][more]
ntn1b1.245e-6727.05netrin-1-like [Source:NCBI gene;Acc:111191060][more]
back to top
BLAST of Netrin 1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000009682.18.950e-4331.17pep scaffold:Pmarinus_7.0:GL479835:738:11671:-1 ge... [more]
ENSPMAT00000004606.11.969e-2428.91pep scaffold:Pmarinus_7.0:GL477874:5526:15188:-1 g... [more]
ENSPMAT00000004614.17.790e-2430.14pep scaffold:Pmarinus_7.0:GL477874:5547:15173:-1 g... [more]
ENSPMAT00000008925.13.666e-2325.43pep scaffold:Pmarinus_7.0:GL476496:30277:70426:-1 ... [more]
ENSPMAT00000007784.11.172e-1925.25pep scaffold:Pmarinus_7.0:GL477336:382472:417638:1... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Netrin 1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO368362.540e-6927.95Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365233.197e-5127.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO395021.614e-4328.90Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO467592.933e-3028.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO365003.996e-3026.74Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Netrin 1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
NTN15.166e-9430.24netrin-1 [Source:NCBI gene;Acc:101155405][more]
ntn1b2.745e-9131.13netrin-1 [Source:NCBI gene;Acc:101161061][more]
ntn1b3.298e-9131.13netrin-1 [Source:NCBI gene;Acc:101161061][more]
NTN16.911e-9029.90netrin-1 [Source:NCBI gene;Acc:101155405][more]
ntn21.942e-8528.27netrin-3 [Source:NCBI gene;Acc:101160359][more]
back to top
BLAST of Netrin 1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000006779.15.145e-13336.08SMESG000006779.1[more]
SMESG000050895.11.364e-12833.44SMESG000050895.1[more]
SMESG000050895.15.483e-12833.12SMESG000050895.1[more]
SMESG000076695.15.598e-11631.71SMESG000076695.1[more]
SMESG000006806.11.962e-9230.61SMESG000006806.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023593 ID=SMED30023593|Name=Netrin 1|organism=Schmidtea mediterranea sexual|type=transcript|length=1962bp
GATCTTGAAATTCTTTTTAAAATTTCTAATCTTATTCATTGGTCTTGTGG
CCTTAAATGGAGAACTGCAGACCTGCTACAGTGCCAATGGAGATCCTAAA
CCTTGTGAACCATTATTAATAAATTTGGCTCAGCCAATGCATATTGAAGC
TAGCTCTACGTGTGGAGAAAACGGAGCGGAAAGTATTTGTACAGAATGGT
TTGACAAACTAGGAAAAGCTCATAAGTCCTGTGAGAAATGCAATTCTTTA
GATCCTAAATTATCAAAATCGTCAAAAATGGTGGTTGATTCACATATACG
AGGCAAGGAGACTTGTTGGATTTCAGAAGGTGTTCATGAAAGTAGTTATC
CAACTAGCGTTAATCTTACATTGGGTTTGAAAAAGAGGTCATTAATATCA
TTTATTACTGTGGAATTATGTGGTCACAACCCGGATGGCATTATTATTTA
TAAAATGGACAGTGAAACAGATGATTGGTCTCCTTGGCAATATTTTGCTA
AAGACTGTCAACTGACATTTAAGATGCCGGCTTTAACAACGGATACAGTT
AATACTTTTTCCGATATAAATTCATTGAAACCAGTTTGTTTTGATTTGGA
AAAAAGTATGGACTATGGAGGAGATGAAAAACTATTCAGACTTATCCCAT
TCAATCCAAGACAAGGCAGAAGTTTTGGAGATGTATTATCTAAAAATGAA
CAAAACTGGTTGGCAGCTACAGAAATACGAATCAGTTATATTCTAACTCC
TAAAGAACATTACGGAAATCTGCTGTTGAGAGAAAAGCGAAATGCAGAAA
ATCCTGTTTATCATTTTGGTTCATCTGATATAATGATTGGTGGGCAACCT
TTATGTCATGGACATGCTTCGAGAATAATCAGAACTTCGGATGATACTTA
TCAGTGTGAATGTCAGCACAGTACTGCTGGAAAGGATTGTGAAAAATGCC
ATGAAGAATTCAATGATCAACCGTGGAGTTCAGCAACGATTCGAAACCCA
GCGGTTTGTAAAAGATGCGAGTGTAACAATCATTCGATAAAATGTGTATT
CGATTTTAATGTTTTCCTGAAATCTGGTAGAATTCATGGCAGTTCTTGCA
TAGATTGTGGTGATAACACTGTCGGCCCTCAGTGTGATCAATGCGCTCCC
GGATATTTCCGGCAACATGCTTATCCTATTTACCATAAAAATGCTTGTAA
ACCTTGCTTATGTCATTCAGTTGGATCTCTTTCGGGTACACCCTGCGATC
AAGTAAGTGGGAAATGTTTCTGTAAGCCTGGAGTGACTGGGAAAACATGT
ACCCATTGTGCACCGGGTTATAAACAAACAAATTCCCTAAAGAATCCTTG
CAGAAAGATATCAAAATTGCGTCATTTAGTGAAATCAAATTCGAGTTGCG
ATTTTTGTCAAAGGAAAAGTAAAAGAATTAATTTTAAGAGATTTTGCAGC
AAGGAAACAAATTTCAAAGTAAATATCAAGAGTAGAGAATCAAGGGGTCA
GTGGATTCGGTTCATTTCTGAAATCGAACAGGTCTGGACAAGAAATCAAC
AAGATCCCCGAGTATCCCAACTTAATCTAGAATCTAGTGAAGGGACTTCG
ATGTGGGTTCATAAAGATCTCGTGGACTGCGGTTGCGTTGATTTTGAATT
CGGTCATTCATATTTAGTCATGGCCAATGTGAAAACAACGGAATTTATGG
GCCAAACTGAACTTATTTTAAACCAAAGTGATGTAATTGAGGATTGGAAG
GAGACATGGGAGGAGCAATTTTCTCAGTTTTATACCCAGGATAAAATGGG
AAAATGCAATCGGTTTACTCGACAAAAGCGACACGTCAAGAGGCGTAATT
TTGCCTCAACCTATAACCAATATGCTATCTATTCCTGATCATTTGGACCC
GGGATTAATTTAATTAACATTTTATCTAGCAGCTGAATGTGATGTCTTAT
TGTATTTATAAA
back to top

protein sequence of SMED30023593-orf-1

>SMED30023593-orf-1 ID=SMED30023593-orf-1|Name=SMED30023593-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=629bp
ILKFFLKFLILFIGLVALNGELQTCYSANGDPKPCEPLLINLAQPMHIEA
SSTCGENGAESICTEWFDKLGKAHKSCEKCNSLDPKLSKSSKMVVDSHIR
GKETCWISEGVHESSYPTSVNLTLGLKKRSLISFITVELCGHNPDGIIIY
KMDSETDDWSPWQYFAKDCQLTFKMPALTTDTVNTFSDINSLKPVCFDLE
KSMDYGGDEKLFRLIPFNPRQGRSFGDVLSKNEQNWLAATEIRISYILTP
KEHYGNLLLREKRNAENPVYHFGSSDIMIGGQPLCHGHASRIIRTSDDTY
QCECQHSTAGKDCEKCHEEFNDQPWSSATIRNPAVCKRCECNNHSIKCVF
DFNVFLKSGRIHGSSCIDCGDNTVGPQCDQCAPGYFRQHAYPIYHKNACK
PCLCHSVGSLSGTPCDQVSGKCFCKPGVTGKTCTHCAPGYKQTNSLKNPC
RKISKLRHLVKSNSSCDFCQRKSKRINFKRFCSKETNFKVNIKSRESRGQ
WIRFISEIEQVWTRNQQDPRVSQLNLESSEGTSMWVHKDLVDCGCVDFEF
GHSYLVMANVKTTEFMGQTELILNQSDVIEDWKETWEEQFSQFYTQDKMG
KCNRFTRQKRHVKRRNFASTYNQYAIYS*
back to top
Aliases
The feature 'Netrin 1' has the following synonyms
Synonym
netrin-like
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000023embryonic pharynx
PLANA:0000058embryonic digestive system
Vocabulary: INTERPRO
TermDefinition
IPR038684Laminin_N_sf
IPR002049Laminin_EGF
IPR008211Laminin_N
IPR018933Netrin_module_non-TIMP
IPR013032EGF-like_CS
IPR001134Netrin_domain
IPR008993TIMP-like_OB-fold
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
Vocabulary: cellular component
TermDefinition
GO:0005576extracellular region
Vocabulary: Schmidtea mediterranea Developmental Stages
TermDefinition
PLANA:0000004Stage 4
PLANA:0000002Stage 2
PLANA:0000003Stage 3
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR002049Laminin EGF domainSMARTSM00180lamegf_3coord: 278..334
e-value: 1.7
score: 8.5
coord: 400..448
e-value: 1.8E-8
score: 44.1
coord: 337..397
e-value: 4.7E-6
score: 36.1
IPR002049Laminin EGF domainPFAMPF00053Laminin_EGFcoord: 400..443
e-value: 2.0E-8
score: 34.2
coord: 283..325
e-value: 3.7E-6
score: 27.0
coord: 337..388
e-value: 3.0E-6
score: 27.3
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 420..448
IPR002049Laminin EGF domainPROSITEPS01248EGF_LAM_1coord: 364..400
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 400..450
score: 17.415
IPR002049Laminin EGF domainPROSITEPS50027EGF_LAM_2coord: 337..399
score: 11.321
IPR008211Laminin, N-terminalSMARTSM00136LamNT_2coord: 27..279
e-value: 2.8E-14
score: 33.4
IPR008211Laminin, N-terminalPFAMPF00055Laminin_Ncoord: 33..279
e-value: 7.4E-35
score: 120.6
IPR008211Laminin, N-terminalPROSITEPS51117LAMININ_NTERcoord: 29..280
score: 26.307
IPR038684Laminin, N-terminal domain superfamilyGENE3DG3DSA:2.60.120.1490coord: 12..302
e-value: 1.2E-49
score: 171.1
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldGENE3DG3DSA:2.40.50.120coord: 459..602
e-value: 8.6E-10
score: 40.5
IPR008993Tissue inhibitor of metalloproteinases-like, OB-foldSUPERFAMILYSSF50242TIMP-likecoord: 461..597
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 303..402
e-value: 1.4E-25
score: 91.4
NoneNo IPR availableGENE3DG3DSA:2.10.25.10coord: 403..450
e-value: 7.2E-11
score: 43.8
NoneNo IPR availablePANTHERPTHR10574:SF292NETRIN-3coord: 17..601
NoneNo IPR availablePANTHERPTHR10574NETRIN/LAMININ-RELATEDcoord: 17..601
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 399..449
e-value: 1.13988E-11
score: 57.7494
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 283..323
e-value: 8.94551E-6
score: 41.1858
NoneNo IPR availableCDDcd00055EGF_Lamcoord: 336..385
e-value: 0.00142557
score: 35.0226
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..18
score: 0.778
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 283..339
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 400..443
NoneNo IPR availableSUPERFAMILYSSF57196EGF/Laminincoord: 337..402
IPR018933Netrin module, non-TIMP typePFAMPF01759NTRcoord: 477..591
e-value: 1.1E-10
score: 41.3
IPR013032EGF-like, conserved sitePROSITEPS00022EGF_1coord: 300..311
IPR001134Netrin domainPROSITEPS50189NTRcoord: 464..600
score: 15.354