G_PROTEIN_RECEP_F1_2 domain-containing protein

Overview
NameG_PROTEIN_RECEP_F1_2 domain-containing protein
Smed IDSMED30023585
Length (bp)1164
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30023585) t-SNE clustered cells

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30023585) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30023585) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for G_PROTEIN_RECEP_F1_2 domain-containing protein (SMED30023585) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023585

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 1

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023585SMESG000049782.1 dd_Smed_v6_33148_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: GNRHR (gonadotropin releasing hormone receptor [Source:HGNC Symbol;Acc:HGNC:4421])

HSP 1 Score: 76.6406 bits (187), Expect = 7.046e-15
Identity = 92/373 (24.66%), Postives = 161/373 (43.16%), Query Frame = 2
Query:   20 PILRNYTIELGWYHKMKFCVLLTMFVMSLGTNV-FVLAFAYRIRRIK-----STLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDT---AQAPAPYPLPFIQCV-HISLFMKVQQWRLKVVFWMHYVFN--YALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPR------DPGIYSFF-FGHLNAIINPIICGVFQL 1081
            P+++     L    K++  V   +F++S   N  F+L      ++ +     S + +L+ HL  A++L  ++ M  + +W +T+QW A   LCK   +   FS+     ++ V+S+DR+L I  PL     +K  + ++G+ ++ S +    Q+ +F     A +     + F QCV H S      QW  +  F+  + F+  + +PL I+++C + I+  L            HQ       P  + ++Q                                      SKN +  RA+ K++K+T +   +F VCWTPYY++       G  + FDP       DP  + FF F  LN   +P+I G F L
Sbjct:   22 PLMQGNLPTLTLSGKIRVTVTFFLFLLSATFNASFLLKLQKWTQKKEKGKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITRPLALKSNSKVGQSMVGLAWILSSVFAGPQLYIFRMIHLADSSGQTKV-FSQCVTHCSF----SQWWHQ-AFYNFFTFSCLFIIPLFIMLICNAKIIFTLTRV--------LHQD------PHELQLNQ--------------------------------------SKNNI-PRARLKTLKMTVAFATSFTVCWTPYYVL-------GIWYWFDPEMLNRLSDPVNHFFFLFAFLNPCFDPLIYGYFSL 328          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: AVPR1B (arginine vasopressin receptor 1B [Source:HGNC Symbol;Acc:HGNC:896])

HSP 1 Score: 75.8702 bits (185), Expect = 2.012e-14
Identity = 75/343 (21.87%), Postives = 144/343 (41.98%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKM-AKRIKILIGIMYMGSCLINISQVTMF---DTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSL----ILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPG-IYSFFFGHLNAIINPII 1063
            K++  VL T+ V++ G N+ VL    ++ R +S +++ ++HL   D+   +  +  + LW +T ++     LC+  K+    S+  ST ++  M++DR L + +PL  L+   +   +LI   ++ + + ++ QV +F   +  Q         + C     F     W  +       +  + LP+ ++  CYSL    I   LK  ++  ++     R      PS ++                               +       + S NT+  RAK +++K+TF IVL ++ CW P++ V     +       D  +     S   G+LN+  NP I
Sbjct:   35 KVEIGVLATVLVLATGGNLAVLLTLGQLGRKRSRMHLFVLHLALTDLAVALFQVLPQLLWDITYRFQGPDLLCRAVKYLQVLSMFASTYMLLAMTLDRYLAVCHPLRSLQQPGQSTYLLIAAPWLLAAIFSLPQVFIFSLREVIQGSG-----VLDCWADFGF----PWGPRAYLTWTTLAIFVLPVTMLTACYSLICHEICKNLKVKTQAWRVGGGGWRTWDRPSPSTLA------------------------------ATTRGLPSRVSSINTI-SRAKIRTVKMTFVIVLAYIACWAPFFSVQMWSVWDKNAPDEDSTNVAFTISMLLGNLNSCCNPWI 337          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: AVPR1A (arginine vasopressin receptor 1A [Source:HGNC Symbol;Acc:HGNC:895])

HSP 1 Score: 74.7146 bits (182), Expect = 4.547e-14
Identity = 84/361 (23.27%), Postives = 147/361 (40.72%), Query Frame = 2
Query:   11 SGPP-ILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKM-AKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKV-VFWMHYVFNYALPLIIIIVCYSLIL------TRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIY-SFFFGHLNAIINPII 1063
            +GPP  +RN  +      K++  VL   F +++  N  VL   +R  R  S +++ I HL  AD+      +  +  W +T ++    WLC+  K    F +  S  ++ VM+ DR + + +PL  L+  A+R +++I   ++ S +++  Q  +F   +      +  +          +Q W  +  V WM     +  P++I+  CY  I        R K ASR +K         F K      +   C SS+ S                                     RAK +++K+TF IV  ++VCW P++I+     +       +  +P I  +   G LN+  NP I
Sbjct:   39 NGPPRDVRNEELA-----KLEIAVLAVTFAVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQMCWDITYRFRGPDWLCRVVKHLQVFGMFASAYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAAAWVLSFVLSTPQYFVFSMIE------VNNVTKARDCWATFIQPWGSRAYVTWMTGGI-FVAPVVILGTCYGFICYNIWCNVRGKTASRQSK-GAEQAGVAFQKG----FLLAPCVSSVKS-----------------------------------ISRAKIRTVKMTFVIVTAYIVCWAPFFIIQMWSVWDPMSVWTESENPTITITALLGSLNSCCNPWI 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: HTR1B (5-hydroxytryptamine receptor 1B [Source:HGNC Symbol;Acc:HGNC:5287])

HSP 1 Score: 71.2478 bits (173), Expect = 6.163e-13
Identity = 89/361 (24.65%), Postives = 152/361 (42.11%), Query Frame = 2
Query:    5 NLSGPPILRNYTIELGWYHKMKFCVLLTMFVMSLG-TNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDR----TLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMF-DTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFF--FGHLNAIINPII 1063
            N S    +   +I L W  K+   +LL +  ++   +N FV+A  YR R++ +  N LI  L   D+L  IL M    ++ +T +W     +C F+  S     + S   +CV+++DR    T  + Y   R    KR  ++I ++++ S  I+IS    F   A+A        +   HI          L  V+    V  +  P +++I  Y  I    +        N   +R   ++   +I+ S   +SS+ S      +      S ++        S  L  K  L    ++K+ K    I+  F+VCW P++I+  +         F      I+ FF   G+LN++INPII
Sbjct:   32 NCSAKDYIYQDSISLPW--KVLLVMLLALITLATTLSNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASILHLCVIALDRYWAITDAVEYSAKR--TPKRAAVMIALVWVFS--ISISLPPFFWRQAKAEEEVSECVVNTDHI----------LYTVY--STVGAFYFPTLLLIALYGRIYVEARSRILKQTPNRTGKRLTRAQ---LITDSPGSTSSVTSINSRVPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWF---HLAIFDFFTWLGYLNSLINPII 368          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Match: DRD3 (dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:3024])

HSP 1 Score: 64.6994 bits (156), Expect = 7.233e-11
Identity = 73/357 (20.45%), Postives = 148/357 (41.46%), Query Frame = 2
Query:   56 YHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQ-----WNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLN-----RLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSP---TSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSF--FFGHLNAIINPIICGVFQL 1081
            Y+ + +C L+   V     N  V     + R +++T N L++ L  AD+L   L M     W++ ++     WN S   C  +        + S   +C +SIDR   ++ P++          +R+ ++I  +++ +  ++   +  F+T   P    +     V  S                  V ++ LP  + ++ Y+ I   LK   R   L   + + C S  P      Q+  S   +  ++K   SI   + +  P             K++N+L    +KK+ ++   ++  F+VCW P+++ + + ++    H      P +YS   + G++N+ +NP+I   F +
Sbjct:   31 YYALSYCALILAIVFG---NGLVCMAVLKERALQTTTNYLVVSLAVADLLVATLVM----PWVVYLEVTGGVWNFSRICCDVFVTLDVMMCTASILNLCAISIDRYTAVVMPVHYQHGTGQSSCRRVALMITAVWVLAFAVSCPLLFGFNTTGDPTVCSISNPDFVIYS-----------------SVVSFYLPFGVTVLVYARIYVVLKQRRRKRILTRQNSQ-CNSVRPG---FPQQTLSPDPAHLELKRYYSICQDTALGGPGFQERGGELKREEKTRNSLMPLREKKATQMVAIVLGAFIVCWLPFFLTHVLNTHCQTCH----VSPELYSATTWLGYVNSALNPVIYTTFNI 355          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: gnrr-1 (GoNadotropin-Releasing hormone Receptor (GnRHR) related [Source:UniProtKB/TrEMBL;Acc:H1ZUW9])

HSP 1 Score: 81.6481 bits (200), Expect = 7.782e-17
Identity = 90/368 (24.46%), Postives = 160/368 (43.48%), Query Frame = 2
Query:   83 LTMFVMSLGTNVFVLAFAYR-----IRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFW---MHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQLIQKARRV*KYKKEQLKRNCQNQQKRNR 1162
            L +F+++   NV +     R     +RR+ S    L++H+  A +L  ++ M  E L    + W A   +C+  KF   F+ISLS  ++  +++DR   I +PL  ++  K ++ ++   +  S + +  Q+ +F TA  P      + QCV  +   ++      VVF+   ++ +  Y  PL + +VCYSLIL R+                  S+   ++   +   SS L  ++  +NN                             +AK +++K+TF IVL F+ CWTPY I+ F+         + P+D   + + F  LN+ I+P + G F    +       K+ QL   C      +R
Sbjct:   28 LALFILAFVGNVTMFLILCRNQLVKVRRVHS----LLLHMNIAHLLVTLVVMPKEILHNYMVAWFAGDVMCRICKFFDVFAISLSMNVLICITLDRFYSIFFPLYAMRARKSVQRMVSFAWTISFVTSAPQLYLFKTATHPCFD--WYTQCVSKNFIGELSN---DVVFFFSIVNIIQVYIAPLFVTVVCYSLILWRI------------------SRKSKLVGEKESEKSSELLLRRNGQNN---------------------------LEKAKSRTLKMTFVIVLAFIFCWTPYSILMFLHFLRHT--DWIPKDIRKFIYAFAVLNSAISPYLYGYFSFDIR-------KELQLLFACSKATAADR 332          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: gnrr-1 (GoNadotropin-Releasing hormone Receptor (GnRHR) related [Source:UniProtKB/TrEMBL;Acc:H1ZUW9])

HSP 1 Score: 81.6481 bits (200), Expect = 8.413e-17
Identity = 85/340 (25.00%), Postives = 152/340 (44.71%), Query Frame = 2
Query:   83 LTMFVMSLGTNVFVLAFAYR-----IRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFW---MHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQ 1078
            L +F+++   NV +     R     +RR+ S    L++H+  A +L  ++ M  E L    + W A   +C+  KF   F+ISLS  ++  +++DR   I +PL  ++  K ++ ++   +  S + +  Q+ +F TA  P      + QCV  +   ++      VVF+   ++ +  Y  PL + +VCYSLIL R+                  S+   ++   +   SS L  ++  +NN                             +AK +++K+TF IVL F+ CWTPY I+ F+         + P+D   + + F  LN+ I+P + G F 
Sbjct:   28 LALFILAFVGNVTMFLILCRNQLVKVRRVHS----LLLHMNIAHLLVTLVVMPKEILHNYMVAWFAGDVMCRICKFFDVFAISLSMNVLICITLDRFYSIFFPLYAMRARKSVQRMVSFAWTISFVTSAPQLYLFKTATHPCFD--WYTQCVSKNFIGELSN---DVVFFFSIVNIIQVYIAPLFVTVVCYSLILWRI------------------SRKSKLVGEKESEKSSELLLRRNGQNN---------------------------LEKAKSRTLKMTFVIVLAFIFCWTPYSILMFLHFLRHT--DWIPKDIRKFIYAFAVLNSAISPYLYGYFS 311          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: daf-38 (G-protein coupled receptor daf-38 [Source:UniProtKB/Swiss-Prot;Acc:Q9U320])

HSP 1 Score: 66.6254 bits (161), Expect = 7.609e-12
Identity = 88/412 (21.36%), Postives = 176/412 (42.72%), Query Frame = 2
Query:    5 NLSGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKST-LNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRL--KMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQW-------RLKVVFW---MHYVFNYALPLIIIIVCYSLIL---------------------------TRLKDASRWNKLNNFHQRYCFSKPPSVIS-----MSQECSSSILSCKQIKENN-SIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHL---------NAIINPIICGVF 1075
             L   PIL +Y +E+       F ++L   V   G  + + A+     R  ST L++L   L Y+D+L   + +     W+LT  W     LCK  K   +F+   S+ +I  +++DR L ++ P +    K  KR K+++ + ++ + +I+  Q+ ++    A   Y   + QC+ I    +++++            FW   +H    + +P III++ Y +++                           T L  AS WN L  F +     +P   ++     +S E    +     I  +  S ++ + +H+ T   S++ NL          + ++++++  +V+ +++CW PY ++  I        +F  RD   +S +  H+         N+++NP + G F
Sbjct:   26 GLPPEPILSDY-VEM-------FTLVLNFIV---GAPLNLAAYTQLSERPTSTRLDLLKRSLNYSDLLVLFIYVPSRACWLLTYDWRGGDALCKIVKMFHTFAFQSSSNVIVCIAVDRLLSVLSPSHHSPNKALKRTKMMLIVAWIVALVISCPQLFIWKAYLALPEY--NWSQCLQIWEIARMEKFNKPQVVPEFDAEFWYSILHISLVFWIPCIIIMLSYIIVISWVWINSRPSIRHTSSFSFHTGCDTVDTVLTRASEWNPLKTFSRHVNIKEPEKPMTTPRIVVSDETEVPLTQRPSISPSEASAVMRTGVHTST---SYNANLN---------RSRALRVSLLLVVAYIICWLPYNLISLI--------QFLDRD--FFSSYLKHVHFCQQLIIFNSVVNPWLYGFF 402          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 55.0694 bits (131), Expect = 3.562e-8
Identity = 77/371 (20.75%), Postives = 150/371 (40.43%), Query Frame = 2
Query:   80 LLTMFVMSLGTNVFVLAFAYRIRRIK-STLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDR----TLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVF-----NYALPLIIIIVCYSLILT--------RLKDASRWNKLNN-----------FHQRYCFSKPPSVISMSQE------------CSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRR-----AKKKSIKLTFSIVLT-FVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFF--GHLNA 1045
            +LT+ ++ +  N+ V+   YR R+++    N LI+ L  AD+L G+L M     + +  +W   + LC+ +       ++ S   IC +S+DR    T  + YP  R  +  R+ I IG+ ++ S LI +  +  +   +A         +C               V   + YV      ++ +P++I+I+ Y+ I +        RLK+  R +   N           ++  Y   +    I   +E            C       +++      I     H+       +  L+ K    +R     AK++   L   I+L+ F++ W P++++Y I ++           P ++ FFF  G+ N+
Sbjct:   28 MLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPL--RMFIYIGVSWIVSLLICLPPIFGWRPERAEG-------EC--------------SVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKIALDTNHNSPPASDLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFG------HEAPPLVFKFFFWLGYCNS 369          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Match: octr-1 (OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEMBL;Acc:Q7JP61])

HSP 1 Score: 55.0694 bits (131), Expect = 3.610e-8
Identity = 81/374 (21.66%), Postives = 158/374 (42.25%), Query Frame = 2
Query:   80 LLTMFVMSLGTNVFVLAFAYRIRRIK-STLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDR----TLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVF-----NYALPLIIIIVCYSLILT--------RLKDASRWNKLNNF-------HQRYCF------------SKPPSVISMSQECSSSILSCKQIKEN-------NSIILFSKIHSPTSNHSFSHNLKSKNTLFRR-----AKKKSIKLTFSIVLT-FVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFF--GHLNA 1045
            +LT+ ++ +  N+ V+   YR R+++    N LI+ L  AD+L G+L M     + +  +W   + LC+ +       ++ S   IC +S+DR    T  + YP  R  +  R+ I IG+ ++ S LI +  +  +   +A         +C               V   + YV      ++ +P++I+I+ Y+ I +        RLK+  R +   N        ++RY               +   V++     +      ++I E         SI L +  +SP ++   +  L+ K    +R     AK++   L   I+L+ F++ W P++++Y I ++           P ++ FFF  G+ N+
Sbjct:   28 MLTVMLLIIFGNLLVVVTVYRDRKLRMQRQNWLIVSLAVADMLVGLLVMPLTLTYEIVGEWTMGNILCEIWLALDVLFVTASILHICAISLDRYFSVTSPLTYPATRTPL--RMFIYIGVSWIVSLLICLPPIFGWRPERAEG-------EC--------------SVSTDLGYVLYSSLGSFYIPVVILIIVYAKIYSITIRHSRQRLKETERRDHTLNMLTIRSSTNERYNMEYELEENSDPIEDEKEKVVTNRDMINKVCWQLRKISEELPRQGVKVSIALDTNHNSPPAS-DLTRKLEEKKFCEKRKRKLKAKERQATLLLGIILSAFILSWLPFFLIYVIGAFG------HEAPPLVFKFFFWLGYCNS 371          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CrzR (gene:FBgn0036278 transcript:FBtr0075989)

HSP 1 Score: 118.627 bits (296), Expect = 7.883e-29
Identity = 98/363 (27.00%), Postives = 167/363 (46.01%), Query Frame = 2
Query:   17 PPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIK-------STLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRF-DPRDPGIYSFFFGHLNAIINPIICGVFQL 1081
            P  + ++  +L     +K  VL  M + SL  N+  +   Y+ R  +       S +  L+ HL  AD+L    C+ GE  W  T+QW A+   CK  K    FS+ LST ++ ++ +DR + + YP+  L MAKR   L+G  Y+ S ++++ Q  +F  A+   P+   F QCV    +    Q ++   F +  VF + LPL I+   Y               ++ F                     +I S +++ + + +  +S    PT  +        +  L  +AK KS++++  I++ F++CWTPYY++  +  +  P  R  D     I  FFFG  N+++NP+I G F L
Sbjct:  104 PEHVMDHAPQLSRSGLLKVYVLAVMALFSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIADVLVTWFCIIGEAAWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKSLNMAKRCHRLLGGTYILSLVLSLPQFFIFHVAR--GPFVEEFYQCVTHGFYTADWQEQMYATFTL--VFTFLLPLCILFGTY---------------MSTFR--------------------TISSSEKMFQGSKLANYSTAKLPTQTN--------RQRLIHKAKMKSLRISVVIIIAFLICWTPYYVMMIMFMFLNPDKRLGDDLQDAI--FFFGMSNSLVNPLIYGAFHL 417          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: CrzR (gene:FBgn0036278 transcript:FBtr0330069)

HSP 1 Score: 118.242 bits (295), Expect = 1.210e-28
Identity = 98/363 (27.00%), Postives = 167/363 (46.01%), Query Frame = 2
Query:   17 PPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIK-------STLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRF-DPRDPGIYSFFFGHLNAIINPIICGVFQL 1081
            P  + ++  +L     +K  VL  M + SL  N+  +   Y+ R  +       S +  L+ HL  AD+L    C+ GE  W  T+QW A+   CK  K    FS+ LST ++ ++ +DR + + YP+  L MAKR   L+G  Y+ S ++++ Q  +F  A+   P+   F QCV    +    Q ++   F +  VF + LPL I+   Y               ++ F                     +I S +++ + + +  +S    PT  +        +  L  +AK KS++++  I++ F++CWTPYY++  +  +  P  R  D     I  FFFG  N+++NP+I G F L
Sbjct:  104 PEHVMDHAPQLSRSGLLKVYVLAVMALFSLLGNLLTIWNIYKTRISRRNSRHTWSAIYSLMFHLSIADVLVTWFCIIGEAAWCYTVQWLANELTCKLVKLFQMFSLYLSTYVLVLIGVDRWIAVKYPMKSLNMAKRCHRLLGGTYILSLVLSLPQFFIFHVAR--GPFVEEFYQCVTHGFYTADWQEQMYATFTL--VFTFLLPLCILFGTY---------------MSTFR--------------------TISSSEKMFQGSKLANYSTAKLPTQTN--------RQRLIHKAKMKSLRISVVIIIAFLICWTPYYVMMIMFMFLNPDKRLGDDLQDAI--FFFGMSNSLVNPLIYGAFHL 417          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: AkhR (gene:FBgn0025595 transcript:FBtr0332331)

HSP 1 Score: 82.8037 bits (203), Expect = 4.982e-17
Identity = 87/347 (25.07%), Postives = 158/347 (45.53%), Query Frame = 2
Query:   59 HKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTL--NILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIV---YFIRSYS-GPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQL 1081
            H++   V   +FV+S   N  VL    + RR++  L  +I+++HL  AD++  +L M  E +W  T+QW ++  +C+   F   F + LS+ ++  +S+DR   I+ PL R     R +I++   ++GS + +I Q  +F   + PA     + QCV  + F      +L     M  +  YA PLI+ I CY  I                           +   SQ     +++ +  + N+ ++                          RAKK+++K+T +IV+ F++CWTPYY +   Y++  +S G I+    +      F F   N+ +NP++ G++ +
Sbjct:   38 HRLSITVYSILFVISTIGNSTVLYLLTK-RRLRGPLRIDIMLMHLAIADLMVTLLLMPMEIVWAWTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLKR--SYNRGRIMLACAWLGSVVCSIPQAFLFHLEEHPA--VTGYFQCVIFNSFRSDFDEKLYQAASMCSM--YAFPLIMFIYCYGAIYLE------------------------IYRKSQRVLKDVIAERFRRSNDDVL-------------------------SRAKKRTLKMTITIVIVFIICWTPYYTISMWYWLDKHSAGKINPLLRK----ALFIFASTNSCMNPLVYGLYNI 324          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: AkhR (gene:FBgn0025595 transcript:FBtr0079309)

HSP 1 Score: 82.8037 bits (203), Expect = 4.982e-17
Identity = 87/347 (25.07%), Postives = 158/347 (45.53%), Query Frame = 2
Query:   59 HKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTL--NILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIV---YFIRSYS-GPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQL 1081
            H++   V   +FV+S   N  VL    + RR++  L  +I+++HL  AD++  +L M  E +W  T+QW ++  +C+   F   F + LS+ ++  +S+DR   I+ PL R     R +I++   ++GS + +I Q  +F   + PA     + QCV  + F      +L     M  +  YA PLI+ I CY  I                           +   SQ     +++ +  + N+ ++                          RAKK+++K+T +IV+ F++CWTPYY +   Y++  +S G I+    +      F F   N+ +NP++ G++ +
Sbjct:   38 HRLSITVYSILFVISTIGNSTVLYLLTK-RRLRGPLRIDIMLMHLAIADLMVTLLLMPMEIVWAWTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLKR--SYNRGRIMLACAWLGSVVCSIPQAFLFHLEEHPA--VTGYFQCVIFNSFRSDFDEKLYQAASMCSM--YAFPLIMFIYCYGAIYLE------------------------IYRKSQRVLKDVIAERFRRSNDDVL-------------------------SRAKKRTLKMTITIVIVFIICWTPYYTISMWYWLDKHSAGKINPLLRK----ALFIFASTNSCMNPLVYGLYNI 324          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Match: AkhR (gene:FBgn0025595 transcript:FBtr0079308)

HSP 1 Score: 82.8037 bits (203), Expect = 4.982e-17
Identity = 87/347 (25.07%), Postives = 158/347 (45.53%), Query Frame = 2
Query:   59 HKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTL--NILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIV---YFIRSYS-GPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQL 1081
            H++   V   +FV+S   N  VL    + RR++  L  +I+++HL  AD++  +L M  E +W  T+QW ++  +C+   F   F + LS+ ++  +S+DR   I+ PL R     R +I++   ++GS + +I Q  +F   + PA     + QCV  + F      +L     M  +  YA PLI+ I CY  I                           +   SQ     +++ +  + N+ ++                          RAKK+++K+T +IV+ F++CWTPYY +   Y++  +S G I+    +      F F   N+ +NP++ G++ +
Sbjct:   38 HRLSITVYSILFVISTIGNSTVLYLLTK-RRLRGPLRIDIMLMHLAIADLMVTLLLMPMEIVWAWTVQWLSTDLMCRLMSFFRVFGLYLSSYVMVCISLDRYFAILKPLKR--SYNRGRIMLACAWLGSVVCSIPQAFLFHLEEHPA--VTGYFQCVIFNSFRSDFDEKLYQAASMCSM--YAFPLIMFIYCYGAIYLE------------------------IYRKSQRVLKDVIAERFRRSNDDVL-------------------------SRAKKRTLKMTITIVIVFIICWTPYYTISMWYWLDKHSAGKINPLLRK----ALFIFASTNSCMNPLVYGLYNI 324          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: gnrhr2 (gonadotropin releasing hormone receptor 2 [Source:ZFIN;Acc:ZDB-GENE-090128-3])

HSP 1 Score: 94.7449 bits (234), Expect = 5.764e-21
Identity = 87/339 (25.66%), Postives = 157/339 (46.31%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYS-GPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF 1075
            +++  + L +  +S   N+ VL  A   +R +S + ++I +L  AD+L   + M  + +W +T+QW A    C+   F    ++     +  V+S+DR   I+ PL+  K  +R K+L+G+ +  S +++I QV +F   +  +P    F+QC     F    +W+        + F + LPL I+I CY+ IL  +                                      K++ E+   +L +K+             +SKN +  +A+ +++K+T  IVL+F+VCWTPYY++     +S   +     +      F FG LNA ++PII G+F
Sbjct:   45 QVRVTLTLVLCALSACCNLAVLYSANNNQRKRSHVRLIITNLAAADLLVTFVVMPTDAVWNITLQWRAGDLACRTLMFLKLVAMYSCAFVTVVISLDRQAAILNPLSINKAMRRNKVLLGVAWTMSVVLSIPQVFVFHVVEIDSPK--QFVQCTTYGSFSS--RWQETFYNMFTFTFLFLLPLFIMISCYTRILFEIS-------------------------------------KKMTEDR--LLSNKVQLR----------RSKNNI-PKARMRTLKMTVVIVLSFMVCWTPYYMLGLWYWFSPAGLEETVSQSLSHILFIFGLLNACLDPIIYGLF 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: gnrhr2 (gonadotropin releasing hormone receptor 2 [Source:ZFIN;Acc:ZDB-GENE-090128-3])

HSP 1 Score: 94.7449 bits (234), Expect = 5.987e-21
Identity = 87/339 (25.66%), Postives = 157/339 (46.31%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYS-GPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF 1075
            +++  + L +  +S   N+ VL  A   +R +S + ++I +L  AD+L   + M  + +W +T+QW A    C+   F    ++     +  V+S+DR   I+ PL+  K  +R K+L+G+ +  S +++I QV +F   +  +P    F+QC     F    +W+        + F + LPL I+I CY+ IL  +                                      K++ E+   +L +K+             +SKN +  +A+ +++K+T  IVL+F+VCWTPYY++     +S   +     +      F FG LNA ++PII G+F
Sbjct:   45 QVRVTLTLVLCALSACCNLAVLYSANNNQRKRSHVRLIITNLAAADLLVTFVVMPTDAVWNITLQWRAGDLACRTLMFLKLVAMYSCAFVTVVISLDRQAAILNPLSINKAMRRNKVLLGVAWTMSVVLSIPQVFVFHVVEIDSPK--QFVQCTTYGSFSS--RWQETFYNMFTFTFLFLLPLFIMISCYTRILFEIS-------------------------------------KKMTEDR--LLSNKVQLR----------RSKNNI-PKARMRTLKMTVVIVLSFMVCWTPYYMLGLWYWFSPAGLEETVSQSLSHILFIFGLLNACLDPIIYGLF 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: gnrhr1 (gonadotropin releasing hormone receptor 1 [Source:ZFIN;Acc:ZDB-GENE-090128-2])

HSP 1 Score: 91.6633 bits (226), Expect = 5.061e-20
Identity = 83/340 (24.41%), Postives = 144/340 (42.35%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVL--AFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF 1075
            + +    L +FV +  +N+ VL      R R + S L  LI  L  AD++   + M  + +W +T+QW A   +CK   F   F++  +  I+ V+S+DR   I++PL  L   +R + ++   ++ S L+   Q+ +F   +A     + F+QC     F    +W+       H+V  Y  PL+++  CY+ IL  +                                      +Q+          K   P    S +        +  +A+ K++K+T  IV +FVVCWTPYY++     +   + +  P       F FG+LN   +P+I G F
Sbjct:   39 RYRVVATLVLFVFAAVSNLSVLISVTRGRGRHLASHLRPLIASLASADLVMTFVVMPLDAIWNITVQWYAGDAMCKLLCFLKLFAMHSAAFILVVVSLDRHHAILHPLEALDAGRRNRRMLLAAWILSVLLASPQLFIFRAIKAEG---VDFVQCATHGSFQ--HRWQETAYNMFHFVTLYVFPLLVMSFCYTRILVEIN-------------------------------------RQMPRGK-----GKGGEPCLRRSGAD-------MIPKARMKTLKMTIIIVASFVVCWTPYYLLGIWYWFQPRMLQVTPEYVHHALFVFGNLNTCCDPVIYGFF 324          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: gnrhr4 (gonadotropin releasing hormone receptor 4 [Source:ZFIN;Acc:ZDB-GENE-050419-76])

HSP 1 Score: 89.7373 bits (221), Expect = 2.694e-19
Identity = 92/388 (23.71%), Postives = 169/388 (43.56%), Query Frame = 2
Query:    5 NLSGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRD-PGIYS-------FFFGHLNAIINPIICGVFQLIQKARRV*KYKKEQLKRNCQN 1144
            N +G   L+  T  +    K++  +  T+  +S   N+ VL  A    + KS + ILI++L  AD+L   + M  +  W +T+QW A    C+   F    ++     +  V+S+DR   I+ PL   K  K+ KI++ + +  S ++++ Q+ +F       P    F QC     F+K   W+  +     ++  + +PL I+I CY+ IL                           + +S+  +   +S K++                       +L+  ++   +A+ +++K++  IV +F+VCWTPYY++       G  + F P D     S       F FG  NAI++PI  G+F +         + ++ LKR C++
Sbjct:   32 NNTGEAALQLPTFSMA--AKVRVIITFTLCAVSAVCNLGVLWAASTNNKRKSHVRILIMNLTVADLLVTFIVMPVDAAWNITVQWLAGDLACRLLMFLKLVAMYSCAFVTVVISLDRQSAILNPLAINKAKKKNKIMLSVAWAMSVVLSVPQMFLFHNVTITVPA--NFTQCTTRGSFVK--HWQETIYNMFTFICLFLIPLAIMICCYTRIL---------------------------VEISRRMTKGNISSKEV-----------------------HLRRSHSNIPKARMRTLKMSIVIVTSFIVCWTPYYLL-------GLWYWFLPEDLEETVSHSLTHMLFIFGLFNAILDPITYGLFTI---------HFRKGLKRYCRS 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Match: gnrhr4 (gonadotropin releasing hormone receptor 4 [Source:ZFIN;Acc:ZDB-GENE-050419-76])

HSP 1 Score: 89.7373 bits (221), Expect = 2.694e-19
Identity = 92/388 (23.71%), Postives = 169/388 (43.56%), Query Frame = 2
Query:    5 NLSGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRD-PGIYS-------FFFGHLNAIINPIICGVFQLIQKARRV*KYKKEQLKRNCQN 1144
            N +G   L+  T  +    K++  +  T+  +S   N+ VL  A    + KS + ILI++L  AD+L   + M  +  W +T+QW A    C+   F    ++     +  V+S+DR   I+ PL   K  K+ KI++ + +  S ++++ Q+ +F       P    F QC     F+K   W+  +     ++  + +PL I+I CY+ IL                           + +S+  +   +S K++                       +L+  ++   +A+ +++K++  IV +F+VCWTPYY++       G  + F P D     S       F FG  NAI++PI  G+F +         + ++ LKR C++
Sbjct:   32 NNTGEAALQLPTFSMA--AKVRVIITFTLCAVSAVCNLGVLWAASTNNKRKSHVRILIMNLTVADLLVTFIVMPVDAAWNITVQWLAGDLACRLLMFLKLVAMYSCAFVTVVISLDRQSAILNPLAINKAKKKNKIMLSVAWAMSVVLSVPQMFLFHNVTITVPA--NFTQCTTRGSFVK--HWQETIYNMFTFICLFLIPLAIMICCYTRIL---------------------------VEISRRMTKGNISSKEV-----------------------HLRRSHSNIPKARMRTLKMSIVIVTSFIVCWTPYYLL-------GLWYWFLPEDLEETVSHSLTHMLFIFGLFNAILDPITYGLFTI---------HFRKGLKRYCRS 347          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: nrg3 (neuregulin 3 [Source:Xenbase;Acc:XB-GENE-984146])

HSP 1 Score: 105.145 bits (261), Expect = 1.192e-24
Identity = 87/338 (25.74%), Postives = 149/338 (44.08%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF 1075
            K++  V    F+++  +NV VL  +   +R KS L +LI+ L  AD+L   L M  + LW + +QW A    CK   F   F++  +  ++ V+S+DR   I+YPL+     +R +I++   ++ S L+   Q+ +F    AP    + F QC     F   Q W+        +   +  PL+++IVCY+ IL  +                                      KQ+K  N +                   +SKN L  +A+ K++K+T  IV++F+VCWTPYY++     +   +    P       F FG L+   +P++ G++
Sbjct:   41 KVRVGVTCCFFLIASFSNVAVLC-SISGKRCKSHLRVLILSLSVADLLVTFLVMPLDALWNVMVQWYAGELSCKVLNFGKLFAMYSAALVLVVISLDRHWAILYPLSFTSAGQRNRIMLWTAWITSLLLASPQLFLFRLRTAPG---VNFTQCATHGSF--TQHWQETAYNMFTFCTLFVTPLVVMIVCYTRILWEIG-------------------------------------KQMKHKNELA------------------RSKNDLISKARLKTLKMTLVIVVSFMVCWTPYYLLGLWYWFQPEMINQTPEYLNHSLFLFGLLHTCTDPLVYGLY 317          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: ccbe1 (collagen and calcium binding EGF domains 1 [Source:Xenbase;Acc:XB-GENE-920172])

HSP 1 Score: 105.145 bits (261), Expect = 2.025e-24
Identity = 90/344 (26.16%), Postives = 157/344 (45.64%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVL-AFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIV---YFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQL 1081
            K +  +   +F +S   N+ V+ A     R+ +S + ILI++L  AD+L   + M  + +W +T+QW A    C+   F    S+     +  V+SIDR   I+ PL   +  KR KI++ + ++ S L+++ Q+ +F T     P    F QC     F   + W+  V   + +V  + LPL+I+I CYS IL                           I +S+  S   LS K++                      +  +SKN +  +A+ +++K++  IV +F++CWTPYY++   Y+   Y   +     +      F FG +NA ++PI  G+F +
Sbjct:   52 KARVIITFVIFALSAFCNLAVVWASTNTSRKKRSHVRILILNLTTADLLVTFIVMPLDAIWNITVQWQAGDLACRILMFLKLLSMYSCAFVTVVISIDRQSAILNPLGISEAKKRNKIMLSVAWLMSILLSLPQLFLFHTVTITEPQN--FTQCTTRGSFQ--EHWQETVYNMVSFVCLFLLPLLIMISCYSRIL---------------------------IEISRRMSKGALSSKEV----------------------YLRRSKNNI-PKARMRTLKMSIVIVSSFIICWTPYYLLGLWYWF--YPEAMEERVSQSLTHILFIFGLVNACLDPITYGLFTI 339          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: gnrhr (gonadotropin releasing hormone receptor [Source:NCBI gene;Acc:100135417])

HSP 1 Score: 96.6709 bits (239), Expect = 1.466e-21
Identity = 90/352 (25.57%), Postives = 162/352 (46.02%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVL-AFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYS--FFFGHLNAIINPIICGVFQL--IQKARRV 1102
            K++  +   +FV S   NV  L    Y+ R+ KS + ILII+L  AD+   ++ M  + +W +T+QW A    C+   F    ++  S  +  V+S+DR   ++ PL      K+ KI++ + +  S L+ I Q+ +F T       P+ F+QC  +  F     W+  +     +   + LPL+I++ CY+ IL                           + ++ +  ++ +S K+I                       +L+  +    RA+ +++K++  IVLTF+VCWTPYY++     +S  +   +   P +    F FG LN  ++PII G+F +   ++ RRV
Sbjct:   48 KIRVAITCILFVFSTCFNVAALWTITYKYRK-KSHIRILIINLVAADLFITLVVMPLDAVWNVTLQWYAGDLACRVLMFLKLAAMYSSAFVTVVISLDRQAAVLNPLGIRDAKKKNKIMLCVAWSLSYLLAIPQLFVFHTVSRSE--PVHFVQCATVGSFQ--AHWQETIYNMFTFFCLFLLPLLIMVFCYARIL---------------------------MEITHKMKAACVSSKEI-----------------------DLRRSSNNIPRARMRTLKMSLVIVLTFIVCWTPYYLLGIWYWFSPEMLTKEKVPPSLSHILFLFGLLNTCLDPIIYGLFTIHFRREIRRV 344          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: AVPR1B (arginine vasopressin receptor 1B [Source:NCBI gene;Acc:100487856])

HSP 1 Score: 81.6481 bits (200), Expect = 2.061e-16
Identity = 69/299 (23.08%), Postives = 140/299 (46.82%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKM-AKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIV 955
            K +  +L  + V++ G+N+ VL   Y+ R+  + +++ I+HL + D+   +  +  + +W +T ++  S  LC+  K++   S+  ST ++ +M+IDR + + +PL  L+  +K+  ++IG  ++ SC++++ Q+ +F   +      +  I C     +     W  K       V  + +P+ I+++CYSLI   +                                     CK +K     +  S +    SN     +  S      RAK +++K+TF IVL++++CWTP++ V
Sbjct:   30 KAEVALLGAILVITTGSNLIVLFAIYQRRKKMTRMHLFIVHLTFTDLAVALFQILPQMIWDITFRFIGSDILCRAVKYTQVMSMFASTYMLMMMTIDRYIAVCHPLKTLQQPSKQAYLMIGGTWILSCILSLPQIFIFSMKEISQGAGV--IDCWADFRY----PWGAKAYITWITVSIFFVPVGILLLCYSLICCEI-------------------------------------CKNLKGK---MQTSGVGQRESNGQVVPSRVSSIRTISRAKIRTVKMTFVIVLSYILCWTPFFSV 282          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Match: AVPR1A (arginine vasopressin receptor 1A [Source:NCBI gene;Acc:100488869])

HSP 1 Score: 73.1738 bits (178), Expect = 1.322e-13
Identity = 91/407 (22.36%), Postives = 162/407 (39.80%), Query Frame = 2
Query:    2 MNLSGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKM-AKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKV-VFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRD-----------------PGIYSFFFGH-LNAIINPIICGVFQLIQKARRV*KYKKEQLKRNCQNQQKRNR 1162
            ++ +  P +RN  +      K++  +L  +FV ++  N  VL   Y+ ++  S +++ I HL  AD+      +  +  W +T ++     LC+  K    F +  S  ++ VM+ DR + I +PL  L+   KR  ++I   ++ S L++I Q  +F  + +P      +    H      +Q W  +  + WM     + +P+ I+  CY  I   +     W  +                            CK  +E N            S+   S ++ S  T+  RAK +++K+T  IV  +++CW P++IV     +       D  D                 P IY FF GH L   I+   C  FQ I++      + KE    + + Q    R
Sbjct:   36 IDPTADPYVRNEALA-----KIEIAILAIIFVAAVLGNCSVLIGLYKSKKKTSRMHLFIKHLSLADLAVAFFQVLPQLCWEVTYRFRGPDILCRIVKHLQVFGMFASAYMLVVMTADRYIAICHPLKTLQQPTKRSYVMIISAWIISFLLSIPQYFIF--SFSPVNGSEVYDCWAHF-----IQPWGARAYITWMTASI-FVVPVAILTTCYGFICYNI-----WRNIQ---------------------------CKTKREEN--------EGRKSHGLLSTSVSSVKTI-SRAKIRTVKMTLVIVTAYILCWAPFFIVQMRSVWDKNFEWTDSEDIATTVTALLGSLNSCCNPWIYMFFSGHLLQDFIHSFPC--FQKIKQT-----FSKEDSDSSTRRQTSFTR 381          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Gnrhr (gonadotropin releasing hormone receptor [Source:MGI Symbol;Acc:MGI:95790])

HSP 1 Score: 80.1073 bits (196), Expect = 2.574e-16
Identity = 93/371 (25.07%), Postives = 161/371 (43.40%), Query Frame = 2
Query:   20 PILRNYTIELGWYHKMKFCVLLTMFVMSLGTNV-FVLAFAYRIRRIK-----STLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQ-APAPYPLPFIQCV-HISLFMKVQQWRLKVVFWMHYVFN--YALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPR------DPGIYSFF-FGHLNAIINPIICGVFQL 1081
            P+++     L    K++  V   +F++S   N  F+L      ++ K     S + +L+ HL  A++L  ++ M  + +W +T+QW A  +LCK   +   FS+     ++ V+S+DR+L I  PL     +K  + +I + ++ S +    Q+ +F     A    P  F QCV H S      QW  +  F+  + F   + +PL+I+++C + I+  L            HQ       P  + ++Q                                      SKN +  RA+ +++K+T +   +FVVCWTPYY++       G  + FDP       +P  + FF F  LN   +P+I G F L
Sbjct:   22 PLIQGKLPTLTVSGKIRVTVTFFLFLLSTAFNASFLLKLQKWTQKRKKGKKLSRMKVLLKHLTLANLLETLIVMPLDGMWNITVQWYAGEFLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITQPLAVQSNSKLEQSMISLAWILSIVFAGPQLYIFRMIYLADGSGPTVFSQCVTHCSF----PQWWHQ-AFYNFFTFGCLFIIPLLIMLICNAKIIFALTRV--------LHQD------PRKLQLNQ--------------------------------------SKNNI-PRARLRTLKMTVAFATSFVVCWTPYYVL-------GIWYWFDPEMLNRVSEPVNHFFFLFAFLNPCFDPLIYGYFSL 327          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Avpr1a (arginine vasopressin receptor 1A [Source:MGI Symbol;Acc:MGI:1859216])

HSP 1 Score: 77.7962 bits (190), Expect = 3.248e-15
Identity = 86/359 (23.96%), Postives = 148/359 (41.23%), Query Frame = 2
Query:   11 SGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKM-AKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLIL------TRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIY-SFFFGHLNAIINPII 1063
            S P  +RN  +      K++  VL  +FV+++  N  VL   +R  R  S +++ I HL  AD+      +  +  W +T ++    WLC+  K    F++  S+ ++ VM+ DR + + +PL  L+  A+R +++I   +  S +++I Q  +F   +           C   + F+     R  V +    VF   +P+II+  CY  I        R K ASR +K          + P     +   C SS+ S                                     RAK +++K+TF IV  +++CWTP++IV     +       D  +P    +     LN+  NP I
Sbjct:   40 SPPGDVRNEELA-----KLEVTVLAVIFVVAVLGNSSVLLALHRTPRKTSRMHLFIRHLSLADLAVAFFQVLPQLCWDITYRFRGPDWLCRVVKHLQVFAMFASSYMLVVMTADRYIAVCHPLKTLQQPARRSRLMIAASWGLSFVLSIPQYFIFSVIEFEVNNGTKAQDC--WATFIPPWGTRAYVTWMTSGVF--VVPVIILGTCYGFICYHIWRNVRGKTASRQSKGGKGSGEA--AGPFHKGLLVTPCVSSVKS-----------------------------------ISRAKIRTVKMTFVIVSAYILCWTPFFIVQMWSVWDTNFVWTDSENPSTTITALLASLNSCCNPWI 352          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:MGI Symbol;Acc:MGI:96274])

HSP 1 Score: 71.2478 bits (173), Expect = 3.591e-13
Identity = 83/325 (25.54%), Postives = 139/325 (42.77%), Query Frame = 2
Query:  110 TNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDR----TLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMF-DTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFF--FGHLNAIINPII 1063
            +N FV+A  YR R++ +  N LI  L   D+L  IL M    ++ +T +W     +C F+  S     + S   +CV+++DR    T  + Y   R    KR  I+I ++++ S  I+IS    F   A+A       F+   H+          L  V+    V  + LP +++I  Y  I    +        N   +R   ++   +I+ S   +SS+ S      +      S ++        S  L  K  L    ++K+ K    I+  F+VCW P++I+  +         F      I+ FF   G+LN++INPII
Sbjct:   62 SNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKR--TPKRAAIMIVLVWVFS--ISISLPPFFWRQAKAEEEMLDCFVNTDHV----------LYTVY--STVGAFYLPTLLLIALYGRIYVEARSRILKQTPNKTGKRLTRAQ---LITDSPGSTSSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWF---HMAIFDFFNWLGYLNSLINPII 364          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Htr1b (5-hydroxytryptamine (serotonin) receptor 1B [Source:MGI Symbol;Acc:MGI:96274])

HSP 1 Score: 71.2478 bits (173), Expect = 3.591e-13
Identity = 83/325 (25.54%), Postives = 139/325 (42.77%), Query Frame = 2
Query:  110 TNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDR----TLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMF-DTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFF--FGHLNAIINPII 1063
            +N FV+A  YR R++ +  N LI  L   D+L  IL M    ++ +T +W     +C F+  S     + S   +CV+++DR    T  + Y   R    KR  I+I ++++ S  I+IS    F   A+A       F+   H+          L  V+    V  + LP +++I  Y  I    +        N   +R   ++   +I+ S   +SS+ S      +      S ++        S  L  K  L    ++K+ K    I+  F+VCW P++I+  +         F      I+ FF   G+LN++INPII
Sbjct:   62 SNAFVIATVYRTRKLHTPANYLIASLAVTDLLVSILVMPISTMYTVTGRWTLGQVVCDFWLSSDITCCTASIMHLCVIALDRYWAITDAVEYSAKR--TPKRAAIMIVLVWVFS--ISISLPPFFWRQAKAEEEMLDCFVNTDHV----------LYTVY--STVGAFYLPTLLLIALYGRIYVEARSRILKQTPNKTGKRLTRAQ---LITDSPGSTSSVTSINSRAPDVPSESGSPVYVNQVKVRVSDALLEKKKLMAARERKATKTLGIILGAFIVCWLPFFIISLVMPICKDACWF---HMAIFDFFNWLGYLNSLINPII 364          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Match: Oxtr (oxytocin receptor [Source:MGI Symbol;Acc:MGI:109147])

HSP 1 Score: 69.3218 bits (168), Expect = 1.915e-12
Identity = 83/370 (22.43%), Postives = 148/370 (40.00%), Query Frame = 2
Query:    5 NLSGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRL-KMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKV-VFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF------QLIQK 1090
            NL+  P  RN  +      +++  VL  +  ++L  N  VL      R   S L   + HL  AD++  +  +  + LW +T ++     LC+  K+     +  ST ++ +MS+DR L I  PL  L +   R+ +L    ++G  + ++ QV +F   +            V     + +Q W  K  V W+     Y +P+I++  CY LI  ++     W  L                              ++K   +        +       +    S   L  +AK +++K+TF IVL F+VCWTP++ V     +   ++        I +     LN+  NP I  +F      +L+Q+
Sbjct:   26 NLTAGPPRRNEALA-----RVEVAVLCLILFLALSGNACVLLALRTTRHKHSRLFFFMKHLSIADLVVAVFQVLPQLLWDITFRFYGPDLLCRLVKYLQVVGMFASTYLLLLMSLDRCLAICQPLRSLRRRTDRLAVL--ATWLGCLVASVPQVHIFSLREVA--------DGVFDCWAVFIQPWGPKAYVTWITLAV-YIVPVIVLAACYGLISFKI-----WQNL------------------------------RLKTAAAAAAAEGSDAAGGAGRAALARVSSVKLISKAKIRTVKMTFIIVLAFIVCWTPFFFVQMWSVWD--VNAPKEASAFIIAMLLASLNSCCNPWIYMLFTGHLFHELVQR 342          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q2V2K5|GNRHR_OCTVU (Gonadotropin-releasing hormone receptor OS=Octopus vulgaris OX=6645 GN=GNRHR PE=2 SV=1)

HSP 1 Score: 117.857 bits (294), Expect = 3.059e-28
Identity = 97/343 (28.28%), Postives = 164/343 (47.81%), Query Frame = 2
Query:   68 KFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQLIQKAR 1096
            K CVL T+FV+S   N  V+   +RIR  +ST+  LI++L  AD++     +  + +W  T++W A + +CK  K+   F + LST I   +++DR   I+ P++R K   R++I+I + ++ S + +I Q  +F   +      + F QC      +    W+ ++      +  + +PLII++  Y LIL  +   SR      FH       P S  SM         SC  +                 NH      + +  LF RA+K+S +++  IV  F++CWTPYYI++   ++     ++D     IY F  G  N ++NP+I G F + +  R
Sbjct:   34 KLCVLGTVFVISFFGNTLVIIQIFRIRGSRSTIQSLILNLAIADLMVSFFNILMDIIWSATVEWLAGNTMCKIMKYLTVFGLHLSTYITVSIALDRCFAILSPMSRSKAPLRVRIMITMAWVLSAIFSIPQAVIFQEQRKMFRQGM-FHQCRDSYNAL----WQKQLYSASSLILLFVIPLIIMVTSYLLILKTIVKTSR-----QFHD-----TPISPTSM---------SCYSV-----------------NHG-----QIRTHLFERARKRSSRMSAVIVAAFILCWTPYYIIFLGFAF----FQWDNSRTVIYFFTLGTSNCMLNPLIYGAFTIYKVHR 326          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|O42329|GNRR2_CLAGA (Gonadotropin-releasing hormone II receptor OS=Clarias gariepinus OX=13013 PE=2 SV=2)

HSP 1 Score: 103.219 bits (256), Expect = 3.428e-23
Identity = 90/361 (24.93%), Postives = 156/361 (43.21%), Query Frame = 2
Query:    2 MNLS-GPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVL--AFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF 1075
            +N+S  PP+L+  T       + +    L +FV +  +N+ VL      R RR+ S L  LI  L  AD++   + M  + +W +T+QW A   +CK   F   F++  +  I+ V+S+DR   I++PL+ L   +R + ++   ++ S L+   Q+ +F   +A     + F+QC     F   Q W+       H+V  Y  PL+++ +CY+ IL  +                                      +Q+  +       K   P    S          +  +A+ K++K+T  IV +FV+CWTPYY++     +   +    P       F FG+LN   +P+I G F
Sbjct:   22 LNVSVSPPVLKWETPTFTTAARFRVAATLVLFVFAAASNLSVLLSVTRGRGRRLASHLRPLIASLASADLVMTFVVMPLDAVWNVTVQWYAGDAMCKLMCFLKLFAMHSAAFILVVVSLDRHHAILHPLDTLDAGRRNRRMLLTAWILSLLLASPQLFIFRAIKAKG---VDFVQCATHGSFQ--QHWQETAYNMFHFVTLYVFPLLVMSLCYTRILVEIN-------------------------------------RQMHRSK-----DKAGEPCLRRS-------GTDMIPKARMKTLKMTIIIVASFVICWTPYYLLGIWYWFQPQMLHVIPDYVHHVFFVFGNLNTCCDPVIYGFF 328          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q19PY9|GNRHR_BOSMU (Gonadotropin-releasing hormone receptor OS=Bos mutus grunniens OX=30521 GN=GNRHR PE=3 SV=1)

HSP 1 Score: 82.4185 bits (202), Expect = 3.039e-16
Identity = 86/329 (26.14%), Postives = 143/329 (43.47%), Query Frame = 2
Query:  146 RRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMF-------DTAQAPAPYPLPFIQCV-HISLFMKVQQWRLKVVFWMHYVFN--YALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPR------DPGIYSFF-FGHLNAIINPIICGVFQL 1081
            R+  S + +L+ HL  A++L  ++ M  + +W +T+QW A   LCK   +   FS+     ++ V+S+DR+L I  PL     +K  + +IG+ ++ S +    Q+ +F       D+ Q        F QCV H S      QW  +  F+  + F+  + +PL+I+++C + I+  L            HQ       P  + ++Q                                      SKN +  RA+ +++K+T +   +F VCWTPYY++       G  + FDP       DP  + FF F  LN   NP+I G F L
Sbjct:   70 RKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITKPLAVKSNSKLGQFMIGLAWLLSSIFAGPQLYIFGMIHLADDSGQTEG-----FSQCVTHCSF----PQWWHQ-AFYNFFTFSCLFIIPLLIMVICNAKIIFTLTRV--------LHQD------PHKLQLNQ--------------------------------------SKNNI-PRARLRTLKMTVAFATSFTVCWTPYYVL-------GIWYWFDPDMVNRVSDPVNHFFFLFAFLNPCFNPLIYGYFSL 328          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|P32236|GNRHR_BOVIN (Gonadotropin-releasing hormone receptor OS=Bos taurus OX=9913 GN=GNRHR PE=2 SV=1)

HSP 1 Score: 80.8777 bits (198), Expect = 1.092e-15
Identity = 85/329 (25.84%), Postives = 143/329 (43.47%), Query Frame = 2
Query:  146 RRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMF-------DTAQAPAPYPLPFIQCV-HISLFMKVQQWRLKVVFWMHYVFN--YALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPR------DPGIYSFF-FGHLNAIINPIICGVFQL 1081
            R+  S + +L+ HL  A++L  ++ M  + +W +T+QW A   LCK   +   FS+     ++ V+S+DR+L I  PL     +K  + +IG+ ++ S +    Q+ +F       D+ Q        F QCV H S      QW  +  F+  + F+  + +PL+I+++C + I+  L            HQ       P  + ++Q                                      SKN +  RA+ +++K+T +   +F VCWTPYY++       G  + FDP       DP  + FF F  LN   +P+I G F L
Sbjct:   70 RKKLSRMKLLLKHLTLANLLETLIVMPLDGMWNITVQWYAGELLCKVLSYLKLFSMYAPAFMMVVISLDRSLAITKPLAVKSNSKLGQFMIGLAWLLSSIFAGPQLYIFGMIHLADDSGQTEG-----FSQCVTHCSF----PQWWHQ-AFYNFFTFSCLFIIPLLIMVICNAKIIFTLTRV--------LHQD------PHKLQLNQ--------------------------------------SKNNI-PRARLRTLKMTVAFATSFTVCWTPYYVL-------GIWYWFDPDMVNRVSDPVNHFFFLFAFLNPCFDPLIYGYFSL 328          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Match: sp|Q868T3|CCAPR_DROME (Cardioacceleratory peptide receptor OS=Drosophila melanogaster OX=7227 GN=CCAP-R PE=2 SV=4)

HSP 1 Score: 82.0333 bits (201), Expect = 1.168e-15
Identity = 85/341 (24.93%), Postives = 145/341 (42.52%), Query Frame = 2
Query:   53 WYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNF--HQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFF--FGHLNAIINPII 1063
            +Y   +F VL  +F + +  N  VL   +  +  KS +N  I  L  AD+  G+L +  + +W +TI W A +  CK  +FS       ST ++  MSIDR   I +P+N  K  KR + L+   ++ S L ++  + +++       +P    QC  I L   +  W++ +      +F  A+P +II  CY++I+  +     W K + F   +R  F   P+                                            S   +  RAK K++K+T +IV  F++CW+PY I   ++ +    H     +  I +F      LN+  NP+I
Sbjct:  121 FYETEQFAVLWILFTVIVLGNSAVLFVMFINKNRKSRMNYFIKQLALADLCVGLLNVLTDIIWRITISWRAGNLACKAIRFSQVCVTYSSTYVLVAMSIDRYDAITHPMNFSKSWKRARHLVAGAWLISALFSLPILVLYEEKLIQG-HP----QC-WIELGSPI-AWQVYMSLVSATLF--AIPALIISACYAIIVKTI-----WAKGSIFVPTERAGFGAAPA-----------------------------------------RRASSRGIIPRAKVKTVKMTLTIVFVFIICWSPYIIFDLLQVFGQIPH--SQTNIAIATFIQSLAPLNSAANPLI 404          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A291FE86 (Gonadotropin-releasing hormone receptor 1 OS=Platynereis dumerilii OX=6359 PE=2 SV=1)

HSP 1 Score: 155.992 bits (393), Expect = 1.163e-39
Identity = 107/368 (29.08%), Postives = 188/368 (51.09%), Query Frame = 2
Query:    5 NLSG---PPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQLIQKARR 1099
            NL+G   PP   N          +K  VL T+FV+SL  N   L   +R+RR +ST+N LI+HL  AD++    C   + +W+ T+QW A + +CK  K+   F + LST I+ +++IDR   I+ P++R K  +R++++I   ++ S + +  Q  +F   +   PY  P+ QCV    +    +W+ ++   +  +  + +PLII+I  Y LI T +   SR  K     +  C       IS +++ ++ +LS                 +P            +  LF++AK KS+K+T  IVL F++CW+PYY+++   +++    +   +   ++ F FG  N+++NP+I   F +  K+RR
Sbjct:   65 NLTGTLPPPPTANR------MSTIKTSVLSTLFVISLVGNTATLVQMFRMRRRRSTINTLIMHLATADLIVTFFCFLADSIWVTTVQWLAGNIMCKLVKWLQVFGLYLSTYIVVIIAIDRAYAILDPMSRNKAPRRVRLMIITAWVLSAIFSAPQAYIFSVQR--GPYSAPYYQCVTFGAYNA--RWQEQMYSIISALLMFIIPLIIMITAYMLIFTTIAKKSRDLKKGILIRSSC------CISETEQAAADMLS----------------QAPV-----------RGELFQKAKVKSLKMTTLIVLAFIICWSPYYVIFLAYTFTDMTPQL--KYASMWIFCFGTGNSLLNPLIYSAFHVCNKSRR 387          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: R7TQD2 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 GN=CAPTEDRAFT_126901 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.209e-39
Identity = 103/345 (29.86%), Postives = 177/345 (51.30%), Query Frame = 2
Query:   65 MKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQLIQKARR 1099
            +K  VL  MFV++   N   L   YR+RR KST+N+L++HL  AD+L    C+  E +W  TIQW A +++CK  KF   F + LST II ++++DR L I+ P++R +  +R++ +I + ++ +   +  Q+ +F   +   P+P  F QCV    +   Q W+ ++   +   F + +PL+ ++  Y LI   +   SR     +F                Q  +S +LS                  P            +  LFR+AK KS+++T  IV+ F+VCWTPY+++  + ++S   ++ D +   ++ FFFG  N++INP+I   FQ+ +  +R
Sbjct:   73 IKTVVLSCMFVVAFIGNTATLVQMYRMRRRKSTINLLLLHLAIADLLVTFFCIVSEAVWASTIQWFAGNFMCKLVKFLQVFGLYLSTYIIVIIALDRCLAILDPMSRNRAPRRVRTMITVAWIMAGFFSTPQIIIFKVER--GPFPEDFFQCVTYGTY--SQPWQEQLYSCLSVGFMFIIPLVAMVSAYMLIFHTIAKKSR-----DF----------------QRAASDMLS----------------RGPV-----------RGQLFRKAKVKSLRMTAVIVVAFIVCWTPYFVILILHTFSS--NKLDEKS-SLWIFFFGMANSMINPLIYRAFQISKNRKR 362          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: X1YZA9 (G_PROTEIN_RECEP_F1_2 domain-containing protein OS=Capitella teleta OX=283909 PE=3 SV=1)

HSP 1 Score: 153.68 bits (387), Expect = 2.303e-39
Identity = 104/345 (30.14%), Postives = 177/345 (51.30%), Query Frame = 2
Query:   65 MKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQLIQKARR 1099
            +K  VL  MFV++   N   L   YR+RR KST+N+L++HL  AD+L    C+  E +W  TIQW A +++CK  KF   F + LST II ++++DR L I+ P++R +  +R++ +I + ++ +   +  QV +F   +   P+P  F QCV    +   Q W+ ++   +   F + +PL+ ++  Y LI   +   SR     +F                Q  +S +LS                  P            +  LFR+AK KS+++T  IV+ F+VCWTPY+++  + ++S   ++ D +   ++ FFFG  N++INP+I   FQ+ +  +R
Sbjct:   73 IKTVVLSCMFVVAFIGNTATLVQMYRMRRRKSTINLLLLHLAIADLLVTFFCIVSEAVWASTIQWFAGNFMCKLVKFLQVFGLYLSTYIIVIIALDRCLAILDPMSRNRAPRRVRTMITVAWIMAGFFSTPQVIIFKVER--GPFPEDFFQCVTYGTY--SQPWQEQLYSCLSVGFMFIIPLVAMVSAYMLIFHTIAKKSR-----DF----------------QRGASDMLS----------------RGPV-----------RGQLFRKAKVKSLRMTAVIVVAFIVCWTPYFVILILHTFSS--NKLDEKS-SLWIFFFGMANSMINPLIYRAFQISKNRKR 362          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A3S6BUP0 (Putative gonadotropin releasing-hormone receptor OS=Aplysia californica OX=6500 PE=2 SV=1)

HSP 1 Score: 151.754 bits (382), Expect = 9.381e-38
Identity = 108/343 (31.49%), Postives = 179/343 (52.19%), Query Frame = 2
Query:   65 MKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKS--KNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSF--FFGHLNAIINPIICGVFQL 1081
            +K  V   MF +S   N+  +    R+RR KST+N LI++L  AD+L    C+ GE  W +T+QW A S +CKF K+   F++ LST I   +S+DR + I+ P+ R   A+R++ +I   ++ S L +I Q  +F+  +   P+   F QCV    +     W+L++      +  + LPL ++   Y LI T +   S+ + + +  Q        +     + C       K I   +SI+         SN+S  H  +   ++ L R+AK+KS+ ++F IVL F+VCWTPYYI++   ++   +      DP I+++  F G  N+++NP+I G FQL
Sbjct:  111 IKTIVFGIMFGISFVGNMATIVQMRRLRRRKSTINTLIVNLALADLLVTFFCIAGEAAWTVTVQWLAGSVMCKFVKYMQVFALYLSTYITVAISLDRCVAILDPMRRKSAAQRVRTMIVFAWIFSALFSIPQPIVFNVLR--GPFKEVFYQCVTFGSYDSA--WQLQMYAIASLMLMFVLPLAVMGTAYGLIFTTISRKSKEHSVMDSIQMPARKTWVTRWVNYKRCLCMAFCSKPISRRSSIM---------SNYSEDHAARGPVRSYLLRKAKRKSLIMSFVIVLAFMVCWTPYYIIFICITFLDKVI-----DPVIFNYFSFIGLSNSMLNPMIYGAFQL 435          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Match: A0A1C6ZYI2 (Corazonin receptor OS=Crassostrea gigas OX=29159 PE=2 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 7.241e-36
Identity = 104/341 (30.50%), Postives = 170/341 (49.85%), Query Frame = 2
Query:   65 MKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYS--FFFGHLNAIINPIICGVFQL 1081
            +K  VL+ +F +S   N   L   YR+R+ +ST+N LI++L  AD++    CM  E +W LT+QW A   +CK  +F     + +ST I  V+S+DR  VI+ P++R K  +R++I+I + +  S L +I Q  +F   +   P+   F QCV I  +      +L  +F M  +  + LPL ++I+ Y LI   +   S+            F +P +V + S +                             HS   +++S   L R+AK+K+++++  IV+ F VCW PYY+V+   ++      +   DP + S   F G  N+I+NPII G FQL
Sbjct:   64 VKTVVLILLFTISFIGNTATLIQMYRVRKRRSTINTLIVNLAVADLIVTFFCMAAEAVWALTVQWVAGVAMCKMLRFIQGTGLLVSTYITVVISLDRCCVIIDPISRNKAPQRVRIMIIMSWFLSALFSIPQALLFSVHR--GPFKEDFYQCVDILGYPSPAYKKLYNIFCM--IIQFFLPLTLMIIAYGLIFFTISRKSKE-----------FGEPENVSNSSDQ---------------------------REHSGRSHVRSG--LLRKAKRKALRMSLFIVIAFFVCWLPYYVVFTGFAFG----HWTSLDPSLMSGLTFVGLTNSILNPIIYGAFQL 356          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000039545.1 (gonadotropin-releasing hormone II receptor-like [Source:NCBI gene;Acc:103037789])

HSP 1 Score: 105.916 bits (263), Expect = 3.852e-25
Identity = 88/355 (24.79%), Postives = 156/355 (43.94%), Query Frame = 2
Query:   17 PPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVL--AFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF 1075
            PP+            + +    L +F+ +  +N+ +L      R RR+ S L  LII L  AD++   + M  + +W +T+QW     LCK   F   F++  S  I+ V+S+DR   I++PL+ L   +R + ++ + +  S L+   Q+ +F T +A     + F QCV    F   ++W+  V    H+V  Y +PL+++  CY+ IL  +      NK                            SC +                          +S+  +  +A+ K++K+T  IV++F+VCWTPYY++     +   + +  P       F FG+LN   +P+I G++
Sbjct:   28 PPLAEWEAPAFTRAAQFRVAATLVLFLFAAVSNLALLISVSRGRGRRLASHLRPLIISLVVADLMMTFIVMPLDMVWNVTVQWYGGDGLCKLLSFLKLFAMQASAFILVVISLDRHHAILHPLDSLNAHRRNRRMLILAWSLSLLLGSPQLFIFRTIKAER---VDFTQCVTHGSFR--ERWQETVYNMFHFVTLYVIPLLVMSCCYTHILIEINRQEHKNKAGE-------------------------SCLR--------------------------RSRTDMIPKARMKTLKMTIIIVMSFIVCWTPYYLLGIWYWFQPEMLKVTPEYVHHLLFVFGNLNTCCDPVIYGLY 326          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: gnrhr4 (gonadotropin-releasing hormone II receptor-like [Source:NCBI gene;Acc:103034933])

HSP 1 Score: 106.301 bits (264), Expect = 4.684e-25
Identity = 95/369 (25.75%), Postives = 161/369 (43.63%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRD-PGIYS-------FFFGHLNAIINPIICGVFQLIQKARRV*KYKKEQLKRNCQN 1144
            K +  +  T+  +S   N+ VL  A    R KS + ILII+L  AD+L   + M  +  W +T+QW A  + C+   F    ++     +  V+S+DR   I+ PL   +  K+ KI++   +  S ++++ Q+ +F T     P    F QC     F+K   W+  +     +V  + LPL+I+I CY+ IL                           + +SQ  S   +S K++                       +L+  N    +A+ +++K++  IV +F+VCWTPYY++       G  + F P D     S       F FG  NAI++PI  G+F +         + ++ LKR C+ 
Sbjct:   55 KARVIITFTLCAVSAACNLAVLWAASTSTRRKSHVRILIINLTVADLLVTFIVMPVDAAWNITVQWLAGDFACRLLMFLKLVAMYSCAFVTVVISLDRHSAILNPLAISEAKKKSKIMLSAAWAMSIVLSVPQMFIFHTVTITVPA--NFTQCTTRGSFVK--HWQETLYNMFTFVCLFLLPLVIMIFCYTRIL---------------------------LEISQRLSKGNISSKEV-----------------------HLRRSNNYIPKARMRTLKMSIVIVTSFIVCWTPYYLL-------GLWYWFLPDDLEETVSHSLTHMLFIFGLFNAILDPITYGLFTI---------HFRKGLKRYCRG 353          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: gnrhr4 (gonadotropin-releasing hormone II receptor-like [Source:NCBI gene;Acc:103034933])

HSP 1 Score: 106.301 bits (264), Expect = 4.812e-25
Identity = 95/369 (25.75%), Postives = 161/369 (43.63%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRD-PGIYS-------FFFGHLNAIINPIICGVFQLIQKARRV*KYKKEQLKRNCQN 1144
            K +  +  T+  +S   N+ VL  A    R KS + ILII+L  AD+L   + M  +  W +T+QW A  + C+   F    ++     +  V+S+DR   I+ PL   +  K+ KI++   +  S ++++ Q+ +F T     P    F QC     F+K   W+  +     +V  + LPL+I+I CY+ IL                           + +SQ  S   +S K++                       +L+  N    +A+ +++K++  IV +F+VCWTPYY++       G  + F P D     S       F FG  NAI++PI  G+F +         + ++ LKR C+ 
Sbjct:   48 KARVIITFTLCAVSAACNLAVLWAASTSTRRKSHVRILIINLTVADLLVTFIVMPVDAAWNITVQWLAGDFACRLLMFLKLVAMYSCAFVTVVISLDRHSAILNPLAISEAKKKSKIMLSAAWAMSIVLSVPQMFIFHTVTITVPA--NFTQCTTRGSFVK--HWQETLYNMFTFVCLFLLPLVIMIFCYTRIL---------------------------LEISQRLSKGNISSKEV-----------------------HLRRSNNYIPKARMRTLKMSIVIVTSFIVCWTPYYLL-------GLWYWFLPDDLEETVSHSLTHMLFIFGLFNAILDPITYGLFTI---------HFRKGLKRYCRG 346          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: gnrhr1 (gonadotropin releasing hormone receptor 1 [Source:ZFIN;Acc:ZDB-GENE-090128-2])

HSP 1 Score: 88.9669 bits (219), Expect = 2.992e-19
Identity = 87/361 (24.10%), Postives = 157/361 (43.49%), Query Frame = 2
Query:    2 MNLSGPPILRNY-TIELGWYHKMKFCVLLTMFVMSLGTNVFVL--AFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF 1075
            +N S PP   ++ T       + +    L +FV +  +N+ VL      R RR+ S L  LI  L  AD++   + M  + +W +T+QW A   +CK   F   F++  +  I+ V+S+DR   I++PL+ L   +R + ++   +  S ++   Q+ +F   +A     + F+QC     F K   W+        +V  Y  PL+++  CY    TR+                       ++ ++++ + S       K+     L                 +S   +  +A+ K++K+T  IV +FV+CWTPYY++     +   + +  P       F FG+LN   +P+I G F
Sbjct:   17 LNTSLPPFPLDWETPTFTTAARFRVVATLVLFVFAAISNLSVLLSVTRGRGRRLASHLRPLIGSLALADLVMTFVVMPLDAVWNVTVQWYAGDAMCKLLCFLKLFAMHSAAFILVVVSLDRHHAILHPLDALDAGRRNRKMLMTAWTLSVVLASPQLFIFRAIKAEG---VDFVQCATHGRFQK--HWQETAYNMFQFVTLYVFPLLVMSFCY----TRI-----------------------LVEINRQMNRS-------KDKGEPCL----------------RRSGMDMIPKARMKTLKMTIIIVASFVICWTPYYLLGIWYWFQPQMLQVIPEYVHHIFFVFGNLNTCCDPVIYGFF 322          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Match: avpr1aa (arginine vasopressin receptor 1A [Source:NCBI gene;Acc:103030785])

HSP 1 Score: 80.1073 bits (196), Expect = 3.619e-16
Identity = 75/346 (21.68%), Postives = 140/346 (40.46%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKM-AKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMK-----VQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGI-YSFFFGHLNAIINPIICGVFQ 1078
            K++  VL   F +++  NV VLA  Y  ++  S +++ I HL  AD++     +  +  W +T ++     LC+  K      +  ST ++ +M++DR + I +PL  L+   +R   +IG  + GS +++           AP P+     +  H S         ++ W ++       V  + +P++++++CY  I       S W  +       C +K   ++  S     S +S                                     RAK +++K+T  IVL ++VCW P++IV     +       D  +  +  S     LN+  NP I  +F 
Sbjct:   36 KLEITVLSVTFAVAVIGNVSVLAAVYNTKKKTSRMHLFIKHLSLADLVVAFFQVLPQLCWEVTFRFTGPDLLCRLVKHLQVLGMFASTYMMVMMTVDRYIAICHPLKTLQQPTRRAYAMIGATWAGSLVLS-----------APQPFIFSLSEIQHGSGVYDCWGHFIEPWGIRAYITWITVGIFLVPVLVLMLCYGFIC-----HSIWRNIK------CKTKKHGLVGKSSVSGVSTIS-------------------------------------RAKLRTVKMTLVIVLAYIVCWAPFFIVQMWSVWDANFSWDDSENTAVTLSALLASLNSCCNPWIYMIFS 322          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010165.1 (pep scaffold:Pmarinus_7.0:GL493405:1402:3508:1 gene:ENSPMAG00000009199.1 transcript:ENSPMAT00000010165.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 80.4925 bits (197), Expect = 1.424e-17
Identity = 57/195 (29.23%), Postives = 98/195 (50.26%), Query Frame = 2
Query:   86 TMFVMSLGTNVFVL-AFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASR 667
             +F+ +  +N+ VL   ++  R+ KS + ILI++L  AD+L   + M  + +W +T QW A  + C+   F    ++  S  I  V+S+DR   I+ PL   K   + K ++ + ++ S L+ + Q+ +F            F+QCV    F  V+QW   + +   +VF + LPL I+I CY  IL  +    R
Sbjct:   60 ALFIFAAISNLTVLCTISHNHRKTKSHVRILIVNLTTADLLITFIVMPLDAVWHITTQWYAGEFACRLLMFLRLLAMYSSAFITVVISLDRHSAILNPLGIGKAKAKNKTMLSVAWVLSVLLAVPQLFLFHVKSPKGNK--NFVQCVTHGNF--VEQWHHNLYYMFTFVFLFILPLFIMIFCYCRILLEISKRMR 250          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000001380.1 (pep scaffold:Pmarinus_7.0:GL477135:197258:202768:-1 gene:ENSPMAG00000001242.1 transcript:ENSPMAT00000001380.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 68.5514 bits (166), Expect = 5.164e-13
Identity = 79/349 (22.64%), Postives = 151/349 (43.27%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKM-AKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKV-VFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIV--YFIRSYSGPIHRFDPR-------------------DPGIYSFFFGHL 1039
            K++  +L  +  +++  NV VL      R+  S +++ I+HL  AD++     +  + +W +T ++N S +LC+  K+     +  ST ++ +M +DR + I +PL  L+  +K+   +I + +  S L ++ Q  +F  ++         I C   + F+K   W  K  + WM     + +P+II+I CY +I                     F+   ++ + +QE  S                    H+P    S + +  S      +AK ++ K+TF I++ +++CWTP++ V  + +   S P    +                     +P IY FF GHL
Sbjct:   51 KVEIALLSIILFVAIVGNVCVLLALINTRKKTSRMHLFIMHLSIADLVVAFFQVLPQLIWKITYRFNGSDFLCRAIKYLQILGMFASTYVLIMMGLDRYIAICHPLRTLRQSSKQSYQMIFVSWFLSMLFSLPQAFIFSMSEVENS---GIIDC--WAEFIK--PWGTKAYITWMTGSV-FIIPVIILIWCYGMI--------------------TFAIWKNIKAKTQEGDSR-------------------HNPA--KSSAPSRVSSVRSISKAKIRTAKMTFVIIMVYIICWTPFFFVQMWSVWDSSAPFEVIENNNKSIPFAIVMLLASLNSCTNPWIYMFFSGHL 350          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkey-178o16.4 (si:dkey-178o16.4 [Source:ZFIN;Acc:ZDB-GENE-131127-163])

HSP 1 Score: 66.2402 bits (160), Expect = 2.145e-12
Identity = 72/351 (20.51%), Postives = 140/351 (39.89%), Query Frame = 2
Query:   17 PPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAK-RIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKV-VFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPII 1063
            PP+ R    +     + +  VL  +FV++   N  +L   +R R+  S ++  ++HL  AD++     +  +  W +T  + AS+ +CK  K+     +  S  +I  M++DR   + YP+   K  + R   L+   +  S  ++  Q+ +F  ++    Y      C   + F     W  K  V W+     + LP + +++C + I        R  +LN + + +        I   +            +     ++ S+  S T                 RA   ++++T  IVL +V CW P++ V    ++     +  P    +     G+LN+  NP I
Sbjct:   36 PPLARRPERDEA-LARAEVTVLGLIFVLATSGNATLLVSLWRRRKHASRMHAFLVHLSVADLVVAFFQVLPQLAWDVTDAFQASNGVCKVVKYLQVVGMFASAYMIVAMTVDRFQAVCYPMVTFKKKRSRWNGLVCAAWATSLALSTPQIFIFSLSE----YEKGIFDCT--ATF--AAHWGAKAYVTWVTLAV-FVLPTLAVVICQAQIC-------RIIRLNLYVKTHQGPDEEETIGGDE------------RRAGGQLMPSRASSVTG--------------ISRAMINTVRMTLVIVLVYVACWAPWFTVQLWSAWDSKAPKEGPTF--VIIMLLGNLNSCTNPWI 341          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008459.1 (pep scaffold:Pmarinus_7.0:GL478345:24256:33787:1 gene:ENSPMAG00000007650.1 transcript:ENSPMAT00000008459.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.5362 bits (140), Expect = 8.020e-10
Identity = 72/329 (21.88%), Postives = 122/329 (37.08%), Query Frame = 2
Query:  107 GTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKV-VFWMHYVFNYALPLIIIIVCYSLILT------RLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSS-SILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYS--FFFGHLNAIINPII 1063
            G    +LA + R RR  S +N+ + HL  AD+      +  +  W +T ++     LC+  K+              V+ +  +  ++    R +  K+   ++   +  S L++  QV +F   +          + V        Q W ++  V W+  V  Y  P++I+  CY  IL       RLK   R+ K            P    S S  CS  S + C                                    RAK ++IK+T  I++ +VVCWTP++++    ++       D  DP  Y+       LN+  NP I
Sbjct:   62 GNGSVLLALS-RTRRKASRMNLFVKHLSVADLAVAAFQVLPQLSWDVTFRFRGPDALCRLVKYLQ------------VVGMFASTYVLTLRRRGEPRKQAHAMVACAWALSALLSTPQVVIFSLREVE--------EGVFDCWADFGQPWGMRAYVTWI-TVSVYVAPVLILAACYGAILLEICRNLRLKTRGRYPK-----------DPRGSQSQSPVCSRVSSVRC----------------------------------ISRAKVRTIKMTLVIIVVYVVCWTPFFVIQMWAAWDETAPDDDSSDP-TYTIVMLLSSLNSCTNPWI 322          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Match: si:dkey-178o16.4 (si:dkey-178o16.4 [Source:ZFIN;Acc:ZDB-GENE-131127-163])

HSP 1 Score: 50.0618 bits (118), Expect = 4.494e-7
Identity = 35/144 (24.31%), Postives = 71/144 (49.31%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKIL---IGIMYMGSCLINISQVTMFDTAQ 484
            + +  VL  MF  +   N  +L   YR R+  S +++ ++HLC AD++     +  +  W +T  + AS + C+F K+     +  ST +I   ++DR   + +P+   K  KR+      +  +++ S L+++ Q  +F   +
Sbjct:   24 RAEVAVLFAMFACTTLGNSVLLTALYRRRKHASRMHVFMVHLCLADLVVAFFQVLPQLAWDITDVFLASDFACRFIKYMQIVGMFASTYMIVGTTVDRYQAVCFPMVTFK--KRMAYWNAPVCAVWVVSLLLSVPQAVIFAKGE 165          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO49911 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RF82])

HSP 1 Score: 65.4698 bits (158), Expect = 5.164e-12
Identity = 85/350 (24.29%), Postives = 136/350 (38.86%), Query Frame = 2
Query:   83 LTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWIL------TIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPF------IQCVHI--SLFMKVQQWRLKVVFWMH-YVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYI---VYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQ 1078
            L + V+SL  N  V+       R+++  N  I ++ +AD+L  +  M     WI+      ++       LCK  +F    S++ S   +  +S+DR   I  PL R+   K  K +I +++  SCLI+           +P  Y L        + CV +   LF     +   +V+ +  +V  YALPL II   Y++I+ RL     W                                +Q    NS          TSN S             R  KK +K+  ++V  F +CW P Y+   + F++  + P     P      + F GH N+ INP +  VF 
Sbjct:    7 LLVVVLSLIGNALVVWVIRSAYRMRTVTNYFITNVAFADLLTTVFNMMPTLFWIIERKDPWSVGGTLGEILCKTLQFFQCVSVACSVFSMAAISMDRFFAIFRPLKRIITFKLAKFIIALIWASSCLIS-----------SPLIYALKLEGDGEDVNCVEVWAPLF---DDYTSPMVYTIALFVLFYALPLTIIAALYAVIMFRL-----WR-------------------------------RQTPGQNS----------TSNQSNKE----------RTNKKVLKMLITVVAVFALCWLPLYVRMFLVFLQPSNFPCGL--PYHLDFITLFLGHANSSINPYLYVVFN 284          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO31430 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SXX9])

HSP 1 Score: 59.3066 bits (142), Expect = 5.734e-10
Identity = 72/306 (23.53%), Postives = 128/306 (41.83%), Query Frame = 2
Query:  155 KSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNY-ALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSY--SGPIHRFDPRDPGIYSFFFGHLNAIINPII 1063
            ++T N+LII L  +DIL  +L M   C  +LT +W    +LCK   F + F   +S   + + +++R   ++ P    ++ +R+      ++M  C + +  +      Q        F Q    + F+ + ++   +V+  + V  Y ALPL +I+VCY+ +   ++           H +        V   SQ+ ++S         NN           T+ H     ++S NTL            F+IVL F  CW P  +V  + S    G +    PR+  +   F   L+  INP++
Sbjct:   17 RNTTNVLIIGLAISDILQALLGMPLTCGVLLTGKWIFGEFLCKVQGFWLLFLGFVSLHSMALTALNRYFCVVRP----EVYRRVFTRKSTLFM-LCAVWVFALASVTLPQISEQVTFRF-QANRAACFITLTEFAENIVYTSYSVICYIALPLCVIVVCYAKVYAVIR-----------HHKKRLRSATEVPQASQQRNAS---------NN-----------TARHVSVEEIQSTNTL------------FAIVLGFGSCWIPSILVELVDSALPGGMV----PRELYVTYIFLAFLSCAINPVL 269          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO28603 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7T607])

HSP 1 Score: 59.6918 bits (143), Expect = 5.919e-10
Identity = 82/366 (22.40%), Postives = 146/366 (39.89%), Query Frame = 2
Query:   11 SGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQ-WNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLIL-TRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVL-TFVVCWTPYYIVYFIRS------YSGPIHRFDPRDPG-IYSFFFGHLNAIINPIICGVFQ 1078
            S  P   +YT    W    +   ++ +  + L  N+ V    YR RR++S  N LI  L  +D+L   L M       L +  W+    +CKF+ F  +     S   + +++IDR LV+  P +  +  ++ +  I I+ +      I+ +++ +   +P  +   F  C  +           K  +      ++ LPL+++I+ YS++     K A    + N+      +    SV+S  +E         Q +EN                S    LK+  TL             SIV+ TF+ CW P++I+ FI        Y+  + +      G ++ +    LN+  NPII   F 
Sbjct:    6 SSEPCGSHYT---PWSLIAQAGFVVVILFLDLFGNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIASLSLTE-PWSPDGFNASFPACAKMD----------KYYYAFAITMSFFLPLVVLIIAYSMVFKVARKQACLVRRANDSQGHLEYRTETSVVSSFRE--------TQTRENTRKKR-------RRRKSIVRELKATKTL-------------SIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQMTIGTVFVYVLPLLNSAANPIIYSKFN 329          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO40999 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S5M0])

HSP 1 Score: 59.3066 bits (142), Expect = 8.106e-10
Identity = 77/343 (22.45%), Postives = 139/343 (40.52%), Query Frame = 2
Query:   80 LLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQ-WNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLIL-TRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVL-TFVVCWTPYYIVYFIRS------YSGPIHRFDPRDPG-IYSFFFGHLNAIINPIICGVFQ 1078
            ++ +  + L  N+ V    YR RR++S  N LI  L  +D+L   L M       L +  W+    +CKF+ F  +     S   + +++IDR LV+  P +  +  ++ +  I I+ +      I+ +++ +   +P  +   F  C  +           K  +      ++ LPL+++I+ YS++     K A    + N+      +    SV+S  +E         Q +EN                S    LK+  TL             SIV+ TF+ CW P++I+ FI        Y+  + +      G ++ +    LN+  NPII   F 
Sbjct:   37 VVVILFLDLFGNLLVCVAIYRYRRLRSVTNYLIGSLAVSDLLVACLSMPFRIYHTLHLMCWDLGLSVCKFWIFVDALCSGASICNLSLIAIDRYLVLSCPFSYREKMRKPRGFIAILAVWLYAFVIASLSLTE-PWSPDGFNASFPACAKMD----------KYYYAFAITMSFFLPLVVLIIAYSMVFKVARKQACLVRRANDSQGHLEYRTETSVVSSFRE--------TQTRENTRKKR-------RRRKSIVRELKATKTL-------------SIVIGTFIACWAPFFIIMFIVQFCHDCVYNSWLTKEAQMTIGTVFVYVLPLLNSAANPIIYSKFN 340          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Match: EDO47359 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMJ9])

HSP 1 Score: 56.6102 bits (135), Expect = 6.533e-9
Identity = 74/352 (21.02%), Postives = 140/352 (39.77%), Query Frame = 2
Query:   74 CVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSW-------LCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLN-RLKM-AKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPG--------IYSFFFGHLNAIINPIICGVFQ 1078
            C ++ + ++++  N+ V    +  RR++S  N L++ L  +D+L G L +      +L    N  +W        C+F+ +        S   +  +S DR L I  PL  R KM +KR  ILI ++++ +          ++     A YP    QC            R +V   +  +  +  PL+I+I+CY ++L      +   +          S  P+  +  +   +S+ S   I+   S     +     +N    H   + +T     + K+ K    +V  F++CW P+++++    Y       + R P         I+ +     N+  NPII   F 
Sbjct:   28 CFIVIVMLLTIMGNLLVCYSVFYYRRLRSPTNYLVVSLAVSDLLVGTLSLPFRLAQLL----NEENWPSHLGREGCQFWIWVDMLCSGASMVNLAGISFDRLLAIKQPLRYREKMTSKRALILILVVWIYAASCAFLSFVEWEGESTIAAYP----QC----------GIRARVYITLMALAAFFCPLLIVIICYGMVLQVAIRHALQVQKEKEQIALNVSPEPNSNNHEESGETSLASPPVIRLKTSRSSSHRKDINFANGHAKHRNPASSTFHIMKQIKATKTLAVVVGVFILCWFPFFVIFVTFQYCDTECFGEERIPPAVKRVLLIIFVYVLPVSNSAANPIIYSCFN 361          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: gnrh-r3 (gonadotropin-releasing hormone receptor 3 [Source:NCBI gene;Acc:100125529])

HSP 1 Score: 100.523 bits (249), Expect = 3.359e-23
Identity = 90/371 (24.26%), Postives = 163/371 (43.94%), Query Frame = 2
Query:   62 KMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIV---YFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF--QLIQKARRV*KYKKEQLKRNCQNQQKRN 1159
            K++  +  T+  +S   N+ VL  A +  + KS + ILI++L  AD+L   + M  +  W +T+QW A    C+   F    ++     +  V+S+DR   I+ PL   +  ++ KI++ + +  S ++++ Q+ +F       P    F QC     F  VQ+W+  +     +V  + LPL+I+I CY+ IL  +                                       +I  NN  ++   IH           L+  +    +A+ +++K++  IV +F++CWTPYY++   Y++  +   +            F FG  NA ++PI  G+F   L Q ARR     + Q+  N Q + + N
Sbjct:   40 KVRVIITFTLCAVSAVCNLLVLWAAGKGGKRKSHVRILIMNLTVADLLVTFIVMPVDAAWNITVQWQAGDLACRLLMFMKLVAMYSCAFVTVVISLDRQSAILNPLGISEAKRKSKIMLTVAWTTSVILSLPQMFIFHNVTITVPE--NFTQCTTHGSF--VQRWQETLYNMFTFVCLFLLPLVIMIFCYTRILVEISS-------------------------------------RIARNN--MVSRDIH-----------LRRSHNNIPKARMRTLKMSIVIVTSFIICWTPYYLLGLWYWL--FPEKMEETVSHSLTHMLFIFGLFNACLDPITYGLFTIHLRQGARR-----RRQIS-NAQTELENN 348          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: GNRHR (gonadotropin-releasing hormone II receptor-like [Source:NCBI gene;Acc:101167607])

HSP 1 Score: 92.8189 bits (229), Expect = 2.256e-20
Identity = 86/339 (25.37%), Postives = 150/339 (44.25%), Query Frame = 2
Query:  113 NVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRD-PGIYS-------FFFGHLNAIINPIICGVFQL--IQKARR 1099
            N+ VL  A    + KS + +LII+L  AD+L   + M  + +W +T+QW A  + C+   F    ++     +  V+S+DR   I+ PL   K   R ++++   +  S ++++ Q+ +F        YP  F QC     F+  +      +F    +F   LPL+I+I CY+ I   +                                      K++K +N  +  S++H           L+       +A+ +++K++  IVL+F++CWTPYY++       G  + F P D  G  S       F FG LNA ++P+I G+F +   +K RR
Sbjct:   77 NLAVLWAAQSDGKRKSHVKVLIINLTVADLLVTFIVMPLDAVWNITVQWLAGDFACRLLMFLKLQAMYSCAFVTVVISLDRQSAILNPLAINKARMRNRVMLIAAWAMSVILSVPQIFLFH--NVTIIYPEEFTQCATRGSFVSHRHETAYNLFTFACLF--LLPLVIMITCYTRIFCEIS-------------------------------------KRLKRDN--LPSSELH-----------LRCSKNNIPKARMRTLKMSIVIVLSFIICWTPYYLL-------GLWYWFSPDDLEGKVSHSLTHILFIFGLLNACLDPVIYGLFTIHFRKKLRR 354          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: gnrh-r2 (gonadotropin-releasing hormone receptor 2 [Source:NCBI gene;Acc:100125528])

HSP 1 Score: 85.5001 bits (210), Expect = 3.661e-18
Identity = 82/332 (24.70%), Postives = 141/332 (42.47%), Query Frame = 2
Query:   80 LLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF 1075
            +L +F     T +    +  R RR+ S L  L++ L  AD++   + M  +  W +T+QW     LCK   F   F++  S  I+ V+++DR   I++PL+ L   +R + ++ + +  S L+   Q+ +F T +        F QCV    F    +W+  V    H++  Y +PL+++  CYS IL  +      +K    H R                                                   +S   +  +A+ K++K++  IVL+FVVCWTPYY++     +   + R  P       F FG+LN   +P+I G +
Sbjct:   45 ILFLFAACSNTALLTSVWCGRGRRLASHLRPLMLSLASADLMMTFVVMPLDAAWNVTVQWYGGDALCKLLCFLKLFAMHASAFILVVITLDRQHAILHPLDALSAHRRNRFMLLLAWTLSLLLASPQLFLFRTIKVDRAN---FTQCVSHGSF--SHRWQETVYNMFHFITLYVVPLLVMSCCYSRILLHIHQQHLRDKAGESHLR---------------------------------------------------RSGTDIIPKARMKTLKMSVVIVLSFVVCWTPYYLLGIWYWFQPDMLRVTPEYVHHILFVFGNLNTCCDPVIYGFY 320          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: gnrh-r1 (gonadotropin-releasing hormone receptor 1 [Source:NCBI gene;Acc:100125422])

HSP 1 Score: 85.8853 bits (211), Expect = 3.871e-18
Identity = 87/355 (24.51%), Postives = 151/355 (42.54%), Query Frame = 2
Query:   68 KFCVLLTMFVMSLGT--NVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRD-PGIYS-------FFFGHLNAIINPIICGVFQL-IQKARR 1099
            K  V++T  +  + T  N  VL  A   +R KS + +LII+L  AD+L   + M  +  W +T+QW A    C+F  F    ++     +  V+S+DR   I+ PL+     +R + ++ + +  S ++++ Q+ +F        +P  F QC     F  V  W+        +   + LPL I+I+CY+ I  ++                                S  ++ K +  +   +  SK + P                  +A+ +++K++  IV+ F+VCWTPYY++       G  + F P D  G  S       F FG  N  ++PII G+F     + RR
Sbjct:   52 KVRVIITFILCGVSTLCNSAVLWAAIGHKR-KSHVRVLIINLTAADLLVTFIVMPVDAAWNITVQWLAGDAACRFLMFLKLQAMYSCAFVTVVISLDRQSAILRPLSISAAPRRNRSMLTVAWTMSAVLSVPQMFIFH--NVTITHPANFTQCTTRGSF--VTHWQETAYNMFTFTCLFLLPLSIMIICYTRIFIQI--------------------------------SKQMTKKNVSSDEPHLRCSKNNIP------------------KARMRTLKMSVVIVVGFIVCWTPYYLL-------GLWYWFFPDDLEGKVSHSLTHILFIFGLFNTCLDPIIYGLFTTRFHRGRR 344          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Match: gnrh-r1 (gonadotropin-releasing hormone receptor 1 [Source:NCBI gene;Acc:100125422])

HSP 1 Score: 85.8853 bits (211), Expect = 3.871e-18
Identity = 87/355 (24.51%), Postives = 151/355 (42.54%), Query Frame = 2
Query:   68 KFCVLLTMFVMSLGT--NVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRD-PGIYS-------FFFGHLNAIINPIICGVFQL-IQKARR 1099
            K  V++T  +  + T  N  VL  A   +R KS + +LII+L  AD+L   + M  +  W +T+QW A    C+F  F    ++     +  V+S+DR   I+ PL+     +R + ++ + +  S ++++ Q+ +F        +P  F QC     F  V  W+        +   + LPL I+I+CY+ I  ++                                S  ++ K +  +   +  SK + P                  +A+ +++K++  IV+ F+VCWTPYY++       G  + F P D  G  S       F FG  N  ++PII G+F     + RR
Sbjct:   52 KVRVIITFILCGVSTLCNSAVLWAAIGHKR-KSHVRVLIINLTAADLLVTFIVMPVDAAWNITVQWLAGDAACRFLMFLKLQAMYSCAFVTVVISLDRQSAILRPLSISAAPRRNRSMLTVAWTMSAVLSVPQMFIFH--NVTITHPANFTQCTTRGSF--VTHWQETAYNMFTFTCLFLLPLSIMIICYTRIFIQI--------------------------------SKQMTKKNVSSDEPHLRCSKNNIP------------------KARMRTLKMSVVIVVGFIVCWTPYYLL-------GLWYWFFPDDLEGKVSHSLTHILFIFGLFNTCLDPIIYGLFTTRFHRGRR 344          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000049782.1 (SMESG000049782.1)

HSP 1 Score: 717.998 bits (1852), Expect = 0.000e+0
Identity = 366/367 (99.73%), Postives = 366/367 (99.73%), Query Frame = 2
Query:    2 MNLSGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQLIQKARRV 1102
            MNLSGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFSISFSISLSTGIICVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQ KENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQLIQKARRV
Sbjct:    1 MNLSGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFSISFSISLSTGIICVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQSKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAIINPIICGVFQLIQKARRV 367          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000002693.1 (SMESG000002693.1)

HSP 1 Score: 98.2117 bits (243), Expect = 2.285e-22
Identity = 110/384 (28.65%), Postives = 179/384 (46.61%), Query Frame = 2
Query:   26 LRNYTIE----LGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKST----LNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLIL-TRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQ-----IKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYS--GPIHRFDPRDPGIYSFFFGHLNAIINPIICGVF-QLIQKARRV*KYKKEQL 1126
            ++NY+ +       + K+K  +LLT F++S+  N+  L F  + RR  S      N LI+HLC AD+   IL +  E +W +T QW     LCK  KF  + S   ST +I  + IDR  VI+   +R    K + I +  ++  S + +I Q+ +        P+   F QC +I +   V+    +V  ++  +  + LPL +I+ CY  I+ T LK      KL+       F   P ++      ++  LS  +      KEN     F +   P     F    +SK     RAK KS+ ++ SI++T++   TPY++VYF++       I      +   + F+   LN+  NPII G F  L     R+ KY+K ++
Sbjct:    1 MKNYSTDPMPNFDLHSKIKVTILLTFFIVSVVGNIVTLIFLLKRRRQTSQSFKGFNKLILHLCIADLSVTILFLLTETIWNMTTQWYGGEVLCKLIKFGRNLSFLSSTYLIATIGIDRVQVIIR--SRRLSDKMVVICLITVWSLSTIFSIPQMKL--NKVLLGPWKKEFYQCRNIEMKSFVET---RVYPFVCIILAFLLPLAVILGCYGFIMITILKQYQMIGKLS-------FMLSPLLMQHHSHSTNKTLSTSEKAGLTEKENQ----FYQYLEPNKEFLF----QSKRAFLSRAKFKSLMISSSIIITYLTSRTPYWMVYFLQHLGVFDTIVNSKLDELSHWFFWLSILNSAFNPIIYGYFNNLWFLPPRIRKYQKPKI 362          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000074847.1 (SMESG000074847.1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.863e-12
Identity = 83/319 (26.02%), Postives = 154/319 (48.28%), Query Frame = 2
Query:   56 YHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRRIKS----TLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRLKMAKR-IKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLILTRLKDASRWNKLNN-----FHQ------RYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHS--FSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVY 958
            Y+  K    L +F +S+  N   + F  ++++       +L  +I+ L +ADIL  +  +  + +W + + W   S+LCK  K   +FSI LST I+ ++S+DR + I  P++ L    R IKI+I  +++ S L+ I QV +FD  + P    + F QC        +Q +   +V+    V    +P+ I++ CY++I+  +   S+  + +N     FH        +  ++ P         S++         +N  I+ ++I   ++N     SH    K  L  RAK K+ +++  I+  F++CW PY++ Y
Sbjct:   19 YNLFKSVFFLVVFFISILGNTHTIFFTLKLQKRSKLSYRSLYRMIMQLAFADILVCLFFVLTQAIWNIFVSWRGGSFLCKLMKMGQAFSIYLSTYIMSLVSLDRAIAICKPIHHLHSWNRNIKIIIICLWIYSFLLAIPQVLLFDAYRGPWK-TVTFYQCTTSDNLNILQMYVYPLVYC---VLILLIPIGILVTCYTVIIHTINVRSKEYEEHNSVTILFHHPKSDDCEHLTNQFPFYDDAKHSGSNN---------DNETIVINRISENSNNFQKLLSH---KKQQLMSRAKIKTYRMSAIIISCFLLCWLPYWVYY 321          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000051080.1 (SMESG000051080.1)

HSP 1 Score: 64.3142 bits (155), Expect = 5.384e-11
Identity = 80/363 (22.04%), Postives = 157/363 (43.25%), Query Frame = 2
Query:   56 YHKMKFCVLLTMF-VMSLGT----NVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRL--KMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLIL-------TRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFS--KIHSPTSNHSFSHNLKSK-NTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFF-----FGHLNAIINPIICGVFQ 1078
            YH +   VL  M  ++ LGT    ++ + AF + +RR+++  N+LII+L   D++ G L +    ++ +   W  + ++C  +        + S   +C +S+DR  +I  P      +  KR+ ++I I++  S LI++    +F  +   + Y   + + +          +++   F   Y     LPLI+++V Y  I         + K   +  K    +  +  +   +  + S    S        +E+N  +     KI+   S+    HN K+K ++  R  + K+IK    I+  F +CW P++I   +      +   + + P    FF      G+ N+ +NPII  +F 
Sbjct:   63 YHPVTLIVLYVMLSILFLGTVIGNSLMIFAF-FLVRRLRTPCNMLIINLAVTDLMVGTLVIPMASIYQIKGYWIFNDYICSGFILFDVLLCTSSILNLCAISVDRYFIITQPFRYATHRTTKRMLLMIFIVWAASALISVPP--LFGWSNPKSKYYCDYSENLG---------YQIYATFIAFY-----LPLIVMLVLYGRIFRLANYIYVQEKMGGKETKQPKRNSNFRNNFNDNNNNNSIIDKSKFEKKLNNEESNKHLNVPDIKINFAESDEELHHNSKTKFSSGKRNNEAKAIKTLGVIMGCFTICWLPFFIFQLLNPVFSALG-INSKTPVTEIFFQIFYWLGYTNSFLNPIIYAIFN 407          
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Match: SMESG000017113.1 (SMESG000017113.1)

HSP 1 Score: 62.3882 bits (150), Expect = 2.537e-10
Identity = 81/370 (21.89%), Postives = 153/370 (41.35%), Query Frame = 2
Query:   35 YTIELGWYHKMKFCVLLTMFVM-SLGTNVFVLAFAYRIRRIKSTLNILIIHLCYADILAGILCMFGECLWILT-IQWNASSWLCKFYKFXXXXXXXXXXXXXCVMSIDRTLVIMYPLNRL--KMAKRIKILIGIMYMGSCLINISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYALPLIIIIVCYSLIL----------TRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSSSILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKLTFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIY--------SFFFGHLNAIINPIICGVFQ 1078
            Y ++  +  +M   V+ T+FV+ + G N+ V+     ++++++  N LI++L  +D L  IL + G     +   +W  S  LC  +        + S   +C +SIDR LVI  PL     +   RI ++I I ++ S LI+I  +  +     P        QC +    +    +++   F   Y+     PL+++++ Y  I            ++K     N  +  HQ      P   I  S  CS+          + S++   K  + + +     N +S+  +    + K+I     I+  F +CW P++I+   +    PI +    +   Y          + G+ N+ +NPII   F 
Sbjct:   29 YCVKFSFDFEMFLIVIFTVFVVGTAGGNLLVIMSVAIVKKLQTPSNFLIVNLACSDFLVSILVLPGAIHQTINRSRWPFSEILCDVFISFDVILCTSSILNLCAISIDRYLVITRPLQYAVNRTPARISLMIAISWIASALISIPPLFGWKETFIPG-------QCSYSENLL----YQIYATFGAFYI-----PLLVMLILYGRIFKLARVLAQNDAKMKIGISPNSSDREHQ------PNLRIVDSHLCSTPNGQMNLSLYSGSLVSIIKSTNFSESSQNKLNNRSRAKIKSSTETKAITTLGVIMGCFTICWLPFFIIQIAK----PILKVASVNSVNYFPIWLIEICLWLGYFNSFLNPIIYAKFN 372          
The following BLAST results are available for this feature:
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GNRHR7.046e-1524.66gonadotropin releasing hormone receptor [Source:HG... [more]
AVPR1B2.012e-1421.87arginine vasopressin receptor 1B [Source:HGNC Symb... [more]
AVPR1A4.547e-1423.27arginine vasopressin receptor 1A [Source:HGNC Symb... [more]
HTR1B6.163e-1324.655-hydroxytryptamine receptor 1B [Source:HGNC Symbo... [more]
DRD37.233e-1120.45dopamine receptor D3 [Source:HGNC Symbol;Acc:HGNC:... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnrr-17.782e-1724.46GoNadotropin-Releasing hormone Receptor (GnRHR) re... [more]
gnrr-18.413e-1725.00GoNadotropin-Releasing hormone Receptor (GnRHR) re... [more]
daf-387.609e-1221.36G-protein coupled receptor daf-38 [Source:UniProt... [more]
octr-13.562e-820.75OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
octr-13.610e-821.66OCTopamine Receptor (GPCR) [Source:UniProtKB/TrEM... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CrzR7.883e-2927.00gene:FBgn0036278 transcript:FBtr0075989[more]
CrzR1.210e-2827.00gene:FBgn0036278 transcript:FBtr0330069[more]
AkhR4.982e-1725.07gene:FBgn0025595 transcript:FBtr0332331[more]
AkhR4.982e-1725.07gene:FBgn0025595 transcript:FBtr0079309[more]
AkhR4.982e-1725.07gene:FBgn0025595 transcript:FBtr0079308[more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnrhr25.764e-2125.66gonadotropin releasing hormone receptor 2 [Source:... [more]
gnrhr25.987e-2125.66gonadotropin releasing hormone receptor 2 [Source:... [more]
gnrhr15.061e-2024.41gonadotropin releasing hormone receptor 1 [Source:... [more]
gnrhr42.694e-1923.71gonadotropin releasing hormone receptor 4 [Source:... [more]
gnrhr42.694e-1923.71gonadotropin releasing hormone receptor 4 [Source:... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nrg31.192e-2425.74neuregulin 3 [Source:Xenbase;Acc:XB-GENE-984146][more]
ccbe12.025e-2426.16collagen and calcium binding EGF domains 1 [Source... [more]
gnrhr1.466e-2125.57gonadotropin releasing hormone receptor [Source:NC... [more]
AVPR1B2.061e-1623.08arginine vasopressin receptor 1B [Source:NCBI gene... [more]
AVPR1A1.322e-1322.36arginine vasopressin receptor 1A [Source:NCBI gene... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Gnrhr2.574e-1625.07gonadotropin releasing hormone receptor [Source:MG... [more]
Avpr1a3.248e-1523.96arginine vasopressin receptor 1A [Source:MGI Symbo... [more]
Htr1b3.591e-1325.545-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
Htr1b3.591e-1325.545-hydroxytryptamine (serotonin) receptor 1B [Sourc... [more]
Oxtr1.915e-1222.43oxytocin receptor [Source:MGI Symbol;Acc:MGI:10914... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q2V2K5|GNRHR_OCTVU3.059e-2828.28Gonadotropin-releasing hormone receptor OS=Octopus... [more]
sp|O42329|GNRR2_CLAGA3.428e-2324.93Gonadotropin-releasing hormone II receptor OS=Clar... [more]
sp|Q19PY9|GNRHR_BOSMU3.039e-1626.14Gonadotropin-releasing hormone receptor OS=Bos mut... [more]
sp|P32236|GNRHR_BOVIN1.092e-1525.84Gonadotropin-releasing hormone receptor OS=Bos tau... [more]
sp|Q868T3|CCAPR_DROME1.168e-1524.93Cardioacceleratory peptide receptor OS=Drosophila ... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A291FE861.163e-3929.08Gonadotropin-releasing hormone receptor 1 OS=Platy... [more]
R7TQD22.209e-3929.86G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
X1YZA92.303e-3930.14G_PROTEIN_RECEP_F1_2 domain-containing protein OS=... [more]
A0A3S6BUP09.381e-3831.49Putative gonadotropin releasing-hormone receptor O... [more]
A0A1C6ZYI27.241e-3630.50Corazonin receptor OS=Crassostrea gigas OX=29159 P... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSAMXT00000039545.13.852e-2524.79gonadotropin-releasing hormone II receptor-like [S... [more]
gnrhr44.684e-2525.75gonadotropin-releasing hormone II receptor-like [S... [more]
gnrhr44.812e-2525.75gonadotropin-releasing hormone II receptor-like [S... [more]
gnrhr12.992e-1924.10gonadotropin releasing hormone receptor 1 [Source:... [more]
avpr1aa3.619e-1621.68arginine vasopressin receptor 1A [Source:NCBI gene... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000010165.11.424e-1729.23pep scaffold:Pmarinus_7.0:GL493405:1402:3508:1 gen... [more]
ENSPMAT00000001380.15.164e-1322.64pep scaffold:Pmarinus_7.0:GL477135:197258:202768:-... [more]
si:dkey-178o16.42.145e-1220.51si:dkey-178o16.4 [Source:ZFIN;Acc:ZDB-GENE-131127-... [more]
ENSPMAT00000008459.18.020e-1021.88pep scaffold:Pmarinus_7.0:GL478345:24256:33787:1 g... [more]
si:dkey-178o16.44.494e-724.31si:dkey-178o16.4 [Source:ZFIN;Acc:ZDB-GENE-131127-... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO499115.164e-1224.29Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO314305.734e-1023.53Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO286035.919e-1022.40Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO409998.106e-1022.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO473596.533e-921.02Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
gnrh-r33.359e-2324.26gonadotropin-releasing hormone receptor 3 [Source:... [more]
GNRHR2.256e-2025.37gonadotropin-releasing hormone II receptor-like [S... [more]
gnrh-r23.661e-1824.70gonadotropin-releasing hormone receptor 2 [Source:... [more]
gnrh-r13.871e-1824.51gonadotropin-releasing hormone receptor 1 [Source:... [more]
gnrh-r13.871e-1824.51gonadotropin-releasing hormone receptor 1 [Source:... [more]
back to top
BLAST of G_PROTEIN_RECEP_F1_2 domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049782.10.000e+099.73SMESG000049782.1[more]
SMESG000002693.12.285e-2228.65SMESG000002693.1[more]
SMESG000074847.11.863e-1226.02SMESG000074847.1[more]
SMESG000051080.15.384e-1122.04SMESG000051080.1[more]
SMESG000017113.12.537e-1021.89SMESG000017113.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023585 ID=SMED30023585|Name=G_PROTEIN_RECEP_F1_2 domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=1164bp
AATGAACCTCAGTGGGCCGCCGATATTGAGGAATTACACCATAGAATTGG
GTTGGTACCACAAGATGAAATTTTGCGTTCTCCTGACGATGTTTGTCATG
TCTTTGGGGACAAATGTGTTCGTTTTAGCATTCGCATATAGAATCAGACG
AATAAAATCTACATTGAATATCTTGATTATCCATCTTTGCTATGCCGATA
TTCTCGCCGGAATCCTCTGCATGTTTGGCGAGTGTTTATGGATATTGACT
ATTCAGTGGAATGCGTCAAGCTGGCTGTGTAAGTTTTACAAATTCAGTAT
CAGTTTCTCGATTTCCTTGAGCACCGGAATCATTTGCGTAATGTCGATAG
ATCGGACCTTGGTGATCATGTACCCGTTAAACCGTTTGAAGATGGCTAAA
AGAATCAAGATTCTCATTGGAATAATGTACATGGGAAGTTGTCTCATTAA
CATATCACAGGTGACTATGTTTGACACTGCTCAGGCTCCTGCACCGTATC
CCTTGCCGTTCATCCAGTGCGTCCACATATCCCTGTTCATGAAGGTCCAA
CAATGGAGACTGAAAGTAGTATTCTGGATGCATTACGTATTCAATTATGC
TTTGCCTTTGATTATCATCATTGTTTGCTATTCCTTGATCCTAACTCGGT
TGAAGGATGCATCGAGGTGGAATAAATTGAACAATTTCCACCAGAGATAT
TGTTTTTCAAAGCCCCCTTCAGTCATATCCATGTCCCAGGAATGCTCCAG
CAGCATCCTAAGTTGTAAGCAAATCAAAGAGAACAATTCTATCATCTTAT
TCTCCAAGATCCATTCCCCCACCTCGAATCATTCCTTCTCTCACAACCTG
AAGTCAAAAAACACATTGTTTAGACGAGCGAAAAAGAAGTCAATCAAATT
AACTTTCTCAATAGTGCTTACTTTCGTCGTGTGTTGGACCCCCTATTATA
TTGTCTACTTCATTCGCAGCTACAGTGGACCCATTCATAGGTTTGATCCC
CGAGATCCCGGCATTTACAGTTTCTTTTTCGGCCACTTAAACGCTATCAT
TAATCCAATAATTTGTGGAGTGTTTCAACTTATTCAGAAAGCTCGAAGAG
TCTGAAAGTACAAGAAAGAACAATTGAAACGTAACTGTCAAAATCAACAA
AAAAGAAATCGCCG
back to top

protein sequence of SMED30023585-orf-1

>SMED30023585-orf-1 ID=SMED30023585-orf-1|Name=SMED30023585-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=368bp
MNLSGPPILRNYTIELGWYHKMKFCVLLTMFVMSLGTNVFVLAFAYRIRR
IKSTLNILIIHLCYADILAGILCMFGECLWILTIQWNASSWLCKFYKFSI
SFSISLSTGIICVMSIDRTLVIMYPLNRLKMAKRIKILIGIMYMGSCLIN
ISQVTMFDTAQAPAPYPLPFIQCVHISLFMKVQQWRLKVVFWMHYVFNYA
LPLIIIIVCYSLILTRLKDASRWNKLNNFHQRYCFSKPPSVISMSQECSS
SILSCKQIKENNSIILFSKIHSPTSNHSFSHNLKSKNTLFRRAKKKSIKL
TFSIVLTFVVCWTPYYIVYFIRSYSGPIHRFDPRDPGIYSFFFGHLNAII
NPIICGVFQLIQKARRV*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000276GPCR_Rhodpsn
IPR017452GPCR_Rhodpsn_7TM
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0005886plasma membrane
GO:0016020membrane
Vocabulary: biological process
TermDefinition
GO:0007186G-protein coupled receptor signaling pathway
GO:0007165signal transduction
Vocabulary: molecular function
TermDefinition
GO:0004930G-protein coupled receptor activity
GO:0004871signal transducer activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000276G protein-coupled receptor, rhodopsin-likePRINTSPR00237GPCRRHODOPSNcoord: 55..76
score: 26.07
coord: 22..46
score: 17.24
coord: 297..321
score: 28.41
coord: 100..122
score: 24.48
coord: 191..214
score: 25.81
coord: 337..363
score: 20.03
IPR000276G protein-coupled receptor, rhodopsin-likePFAMPF000017tm_1coord: 37..354
e-value: 1.4E-32
score: 113.1
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 261..366
e-value: 1.1E-13
score: 52.3
NoneNo IPR availableGENE3DG3DSA:1.20.1070.10coord: 5..239
e-value: 1.7E-32
score: 114.5
NoneNo IPR availablePANTHERPTHR24241:SF163ADIPOKINETIC HORMONE RECEPTOR, ISOFORM Ccoord: 20..363
NoneNo IPR availablePANTHERPTHR24241NEUROPEPTIDE RECEPTOR-RELATED G-PROTEIN COUPLED RECEPTORcoord: 20..363
NoneNo IPR availableCDDcd153847tmA_GnRHR_invertebratecoord: 23..366
e-value: 8.43013E-47
score: 159.14
NoneNo IPR availableSUPERFAMILYSSF81321Family A G protein-coupled receptor-likecoord: 9..358
NoneNo IPR availableTMHMMTMhelixcoord: 24..46
NoneNo IPR availableTMHMMTMhelixcoord: 135..157
NoneNo IPR availableTMHMMTMhelixcoord: 192..214
NoneNo IPR availableTMHMMTMhelixcoord: 337..359
NoneNo IPR availableTMHMMTMhelixcoord: 100..122
NoneNo IPR availableTMHMMTMhelixcoord: 58..80
NoneNo IPR availableTMHMMTMhelixcoord: 300..322
IPR017452GPCR, rhodopsin-like, 7TMPROSITEPS50262G_PROTEIN_RECEP_F1_2coord: 37..355
score: 30.943