Fascin domain protein

Overview
NameFascin domain protein
Smed IDSMED30023574
Length (bp)2050
Neoblast Clusters

Zeng et. al., 2018




 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023574

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
reproductive organSMED30023574h1SMcG0019476 Contig53952uc_Smed_v2PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
reproductive organSMED30023574h1SMcG0019476 Contig53952newmark_estsPMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite RNA-sequencing evidence
testisSMED30023574h1SMcG0019476 PL06022A1E04smed_ncbi_20240424PMID:28434803
Rouhana et al., 2017
whole organism adult hermaphrodite colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Fascin domain protein vs. Ensembl Mouse
Match: Cfap100 (cilia and flagella associated protein 100 [Source:MGI Symbol;Acc:MGI:2141635])

HSP 1 Score: 53.5286 bits (127), Expect = 8.535e-7
Identity = 130/564 (23.05%), Postives = 240/564 (42.55%), Query Frame = 3
Query:  363 KQLQYAIALKENSIKNNSDESLHSFRLPRMKFIQTF-DFIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKL--KHAKFKRDK------LNAHCIHLESEYSRF-------KAFKEFLRNCYRQNEYESMTHRRSKLDEYKMEA--VLMEMEKQHKFSNESRDSFDVDFLKLPEIV-GNSENASNAYFRRIKNKNKFIRNS--GIKDVYIKERLIKCKTILSNSDLDTLKSNIILGLSNVNNNIELTSFRSDEEDTTLEFLLSSSFEIMTERSKDSASSGD--FVYFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTL 1985
            +QL  A A + N  + N+D  L   R  R +  +T  D++  RR + LL+  + +K  E+ +L  +   EE  +++  + LE+D    DE L+               EN++ ++ A ++  K  K K +K      L A    ++SE S+F       K +KEFL                     YK+     L E +++H     +++S ++       I+ G+  + S       K+K  F+     G+K V    RL+K    LS+S         I  L  V    +L+        + L+  LSS+   M     D+ S G+   +YF++P +L++V ++LE  NL LI+N QE EE  + L       + +++K +N ++  I S              + +I+        +     +F+  + +    D ++  L +KV ++Y   +       +  ++M+T +E  +DEL   L       I +A+KA + ++ +  R +   M    +  ++++    A    + + GRK++ RS P  P + V      TL
Sbjct:  117 QQLLNAEAKEMNCFRENNDWKLAMTR-ERKREPETLNDYMEKRRSMFLLQYALAMKRNEIQRLEMLATREENRLERAEKFLEKDASLFDEFLR---------------ENDRNSVQAMRMAEKETKIKTEKIVEIRELTAQITSIKSEISKFEDTLKHYKIYKEFL---------------------YKLSPKEWLDEQQEKHLAFKRAKESSELTRNNSTAILFGDKGSGS-------KSKTAFLWKEVPGLKKVTKTGRLVKA---LSSS---------IQSLPQVGQLTQLSPH------SELDSRLSST---MFPSQDDTDSDGEELALYFTEPQQLLDVFTKLEEENLSLIQNTQEMEETLDELNVTLKNTQIRMDKEVNLLKQWIAS-------------MMISISKEEESAAELELKARVFHFGEYQGDQQDTMLESLNHKVLEVYRKCVGMQQEANLGTVQMLTVVERQLDELLENLERVPQVKIEQAEKAKERERRMRLREEKAMMQKQLQEERLQRARARAQAKIKKKRGRKLISRSHP--PVIKVKEVREQTL 600          
BLAST of Fascin domain protein vs. UniProt/SwissProt
Match: sp|Q80VN0|CP100_MOUSE (Cilia- and flagella-associated protein 100 OS=Mus musculus OX=10090 GN=Cfap100 PE=2 SV=2)

HSP 1 Score: 53.5286 bits (127), Expect = 5.970e-6
Identity = 130/564 (23.05%), Postives = 240/564 (42.55%), Query Frame = 3
Query:  363 KQLQYAIALKENSIKNNSDESLHSFRLPRMKFIQTF-DFIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKL--KHAKFKRDK------LNAHCIHLESEYSRF-------KAFKEFLRNCYRQNEYESMTHRRSKLDEYKMEA--VLMEMEKQHKFSNESRDSFDVDFLKLPEIV-GNSENASNAYFRRIKNKNKFIRNS--GIKDVYIKERLIKCKTILSNSDLDTLKSNIILGLSNVNNNIELTSFRSDEEDTTLEFLLSSSFEIMTERSKDSASSGD--FVYFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTL 1985
            +QL  A A + N  + N+D  L   R  R +  +T  D++  RR + LL+  + +K  E+ +L  +   EE  +++  + LE+D    DE L+               EN++ ++ A ++  K  K K +K      L A    ++SE S+F       K +KEFL                     YK+     L E +++H     +++S ++       I+ G+  + S       K+K  F+     G+K V    RL+K    LS+S         I  L  V    +L+        + L+  LSS+   M     D+ S G+   +YF++P +L++V ++LE  NL LI+N QE EE  + L       + +++K +N ++  I S              + +I+        +     +F+  + +    D ++  L +KV ++Y   +       +  ++M+T +E  +DEL   L       I +A+KA + ++ +  R +   M    +  ++++    A    + + GRK++ RS P  P + V      TL
Sbjct:  117 QQLLNAEAKEMNCFRENNDWKLAMTR-ERKREPETLNDYMEKRRSMFLLQYALAMKRNEIQRLEMLATREENRLERAEKFLEKDASLFDEFLR---------------ENDRNSVQAMRMAEKETKIKTEKIVEIRELTAQITSIKSEISKFEDTLKHYKIYKEFL---------------------YKLSPKEWLDEQQEKHLAFKRAKESSELTRNNSTAILFGDKGSGS-------KSKTAFLWKEVPGLKKVTKTGRLVKA---LSSS---------IQSLPQVGQLTQLSPH------SELDSRLSST---MFPSQDDTDSDGEELALYFTEPQQLLDVFTKLEEENLSLIQNTQEMEETLDELNVTLKNTQIRMDKEVNLLKQWIAS-------------MMISISKEEESAAELELKARVFHFGEYQGDQQDTMLESLNHKVLEVYRKCVGMQQEANLGTVQMLTVVERQLDELLENLERVPQVKIEQAEKAKERERRMRLREEKAMMQKQLQEERLQRARARAQAKIKKKRGRKLISRSHP--PVIKVKEVREQTL 600          
BLAST of Fascin domain protein vs. TrEMBL
Match: A0A504Z2Q9 (Coiled-coil domain-containing protein 37 OS=Fasciola gigantica OX=46835 GN=FGIG_12002 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 7.996e-18
Identity = 87/300 (29.00%), Postives = 148/300 (49.33%), Query Frame = 3
Query: 1206 DTTLEFLLSSSFEIMTERSKDSASSGDFV-YFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDL--------------------------------KIT-----------TLDELIGYLFNKVSKLYSTVIQKVDTNE----IDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEPEKPNLIV 1961
            D+  +  L +S  I +  S +  + G  + +F+ P +L++++SELE NNL LIENVQEQEE+CE +  K  K+ + +      ++  I   RE++  I E +N I      L+    + RY ++FYL D+                                K+T           T+  L+  L  ++ K+YS V     TNE    +D + M+ ++E+ VDEL+  L  Y  + + KAK+ VDE+  + AR + K         ++++ +++A +PPR+R+GR+V+ RS P +   IV
Sbjct:  421 DSVSDIDLENSQLIESSGSGEQENGGSLIDFFTSPQDLVDILSELESNNLTLIENVQEQEEVCERVRAKAAKLYALLNVERKNVDDHIARERENITGIQENVNSISLARNALSDFVLLERYAKVFYLGDMNQFENLDPAGLLAATATPAPAKIPSLSARSPSKVTAGPTEQSEARPTISNLLSLLQIQIQKVYSAVY---GTNEGGARLDTLVMLRRLETTVDELSEMLNAYPRNLVIKAKRTVDERNRVNARRRQKVETQVAYERRLERAIKKAREPPRWRFGRRVLQRSRPPEIKKIV 717          

HSP 2 Score: 81.6481 bits (200), Expect = 3.415e-12
Identity = 44/128 (34.38%), Postives = 75/128 (58.59%), Query Frame = 3
Query:  429 HSFRLPRMKFIQTFDFIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFL 812
            H+ + P   +     F+  RR++CLLEL ++ K+ EM +L+ I++ E   + +E   L R   + D  LK  C+RT++ ++L + E  KRN   +K+K A+++   LNA C+ LE E+ R   +K+FL
Sbjct:  246 HASQKPTKTYEGVGQFVHDRRRVCLLELAVRTKKGEMKRLDTIMQAENEFLTREEHELLRRHEEHDRYLKSICQRTAEAIRLAEGEARKRNEICEKIKRARYRLAHLNAECVKLEEEFIRLSTYKDFL 373          
BLAST of Fascin domain protein vs. TrEMBL
Match: A0A2H1CM05 (Coiled-coil domain-containing protein 37 OS=Fasciola hepatica OX=6192 GN=D915_002630 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 8.136e-18
Identity = 87/300 (29.00%), Postives = 148/300 (49.33%), Query Frame = 3
Query: 1206 DTTLEFLLSSSFEIMTERSKDSASSGDFV-YFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDL--------------------------------KIT-----------TLDELIGYLFNKVSKLYSTVIQKVDTNE----IDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEPEKPNLIV 1961
            D+  +  L +S  I +  S +  + G  + +F+ P +L++++SELE NNL LIENVQEQEE+CE +  K  K+ + +      ++  I   RE++  I E +N I      L+    + RY ++FYL D+                                K+T           T+  L+  L  ++ K+YS V     TNE    +D + M+ ++E+ VDEL+  L  Y  + + KAK+ VDE+  + AR + K         ++++ +++A +PPR+R+GR+V+ RS P +   IV
Sbjct:  421 DSVSDIDLENSQLIESSGSGEQENGGSLIDFFTSPQDLVDILSELESNNLTLIENVQEQEEVCERVRAKAAKLYALLNVERKNVDDHIARERENITGIQENVNSISLARNALSDFVLLERYAKVFYLGDMNQFENLDPAGLLTATATPAPAKIPSLSARSPSKVTAGPTEQSEARPTISNLLSLLQIQIQKVYSAV---YGTNEGGARLDTLVMLRRLETTVDELSEMLNAYPRNLVIKAKRTVDERNRVNARRRQKVETQVAYERRLERAIKKAREPPRWRFGRRVLQRSRPPEIKKIV 717          

HSP 2 Score: 81.6481 bits (200), Expect = 3.215e-12
Identity = 44/128 (34.38%), Postives = 75/128 (58.59%), Query Frame = 3
Query:  429 HSFRLPRMKFIQTFDFIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFL 812
            H+ + P   +     F+  RR++CLLEL ++ K+ EM +L+ I++ E   + +E   L R   + D  LK  C+RT++ ++L + E  KRN   +K+K A+++   LNA C+ LE E+ R   +K+FL
Sbjct:  246 HASQKPTKTYEGVGQFVHDRRRVCLLELAVRTKKGEMKRLDTIMQAENEFLTREEHELLRRHEEHDRYLKSICQRTAEAIRLAEGEARKRNEICEKIKRARYRLAHLNAECVKLEEEFIRLSTYKDFL 373          
BLAST of Fascin domain protein vs. TrEMBL
Match: G7YM26 (Coiled-coil domain-containing protein 37 OS=Clonorchis sinensis OX=79923 GN=Ccdc37 PE=4 SV=1)

HSP 1 Score: 99.3673 bits (246), Expect = 8.477e-18
Identity = 107/375 (28.53%), Postives = 188/375 (50.13%), Query Frame = 3
Query: 1008 YFRRIKNKNKFIRNSGIKDVYIKERLIKCKTILSNSDLDTLKSNIILGLSNVNNNIELTSFRSDE--EDTTLEFLLSSSFEIMTERSKDSASSGDFVYFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDL-----------------KIT-------------------------TLDELIGYLFNKVSKLYSTVIQKVDTNE----IDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEPE--KPNLIVAATNTDT 1982
            Y R    KN F+RN  + D + +ER  + K I  ++  ++LKS          +++ + SF SD   +  +   + SS  + ++E S D+ S  +F  F++P +L++++SELE NNL LIENVQEQEE+CE +  K HK+ + +    + ++  I   R++++ I E +N I      L+    + RY ++F+L D+                 K+T                         T+  L+  L  +V ++YS+V     TNE    +D + M+ ++E+ VDEL+  L  Y  + + KAK+ VDE+  ++AR + K         +++K + +A + PR+ +GR+V+ RS P   K +L   A + +T
Sbjct:  350 YLRLSTYKN-FLRN--VFDTF-RERHTQTKVI--SAPPESLKSE-----ETGRHSVPMESFESDPTIKHHSTGDVTSSPTQRLSEASSDTVSLIEF--FTNPQDLVDILSELESNNLTLIENVQEQEEVCERVRAKAHKLYTMLNAERDMVDQHIERERQNISGIKENVNAITLARNTLSDFVLLERYAKVFHLGDMEQFESLDPGLLYTSQAPKVTVGTQAKQQQKQQGAYLNPDNIDAKPTIVNLLSVLQFQVQRVYSSVY---GTNEGGARLDTLVMLRRLETTVDELSEMLNAYPRAMVLKAKRTVDERNRVSARRRQKAEGRLAYERRLQKAIRKAREGPRWHFGRRVLERSRPPEIKRSLHTGAASVET 708          

HSP 2 Score: 81.2629 bits (199), Expect = 3.914e-12
Identity = 45/117 (38.46%), Postives = 71/117 (60.68%), Query Frame = 3
Query:  474 FIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFLRNCY 824
            F+  RR++CLLEL ++ K+ E+ +L+ I+  E   +KKE   L R     D  LK  C+RT++ ++L + E  KRN   +++K A+++   LNA C+ LE EY R   +K FLRN +
Sbjct:  248 FVQDRRRVCLLELAVRTKKGEVKRLDAILHAENEFLKKEEHELIRRHEDHDRYLKSICQRTAEAIRLAEGEARKRNEITERIKRARYRLAHLNAECVKLEEEYLRLSTYKNFLRNVF 364          
BLAST of Fascin domain protein vs. TrEMBL
Match: A0A0X3NQ98 (DUF4200 domain-containing protein OS=Schistocephalus solidus OX=70667 GN=SSLN_LOCUS9109 PE=4 SV=1)

HSP 1 Score: 98.9821 bits (245), Expect = 1.257e-17
Identity = 79/288 (27.43%), Postives = 143/288 (49.65%), Query Frame = 3
Query: 1149 GLSNVNNNIELTSFRSDEEDTTLEFLLSSSFEIMTERSKDSASSGDFVYFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDLKI------------------------TTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEP 1940
            GL+       +   R+D E  T    L    E  +E + DS +   F  F  P +L+++++ELE NNL LIENVQEQEE CE +  K  +++  +    N +++ I+  +E+++N+   +  I      +N+   + RY++IF+L  +                           T+ E++  L +++ K+Y+ V        +D + M+  +E  +D+L+  L  Y+ + + KAKK VDE     AR + K+        ++++ +E+A +PPR+  GR++V RS P
Sbjct:  416 GLTEPMGGKTVDDLRTDTETATPVSWLK---EANSEDATDSLTVNAF--FKSPQDLVDILAELESNNLTLIENVQEQEEACERVRVKAARLQKILNVERNTVDAHISREKEEIDNLKRDVGEIVVAKDAINEFNLLERYEKIFHLGGIDQFEMPWMREERNNRKNNATDKEEPKPTVGEMLEILHDQIHKVYTKVFSSEGGARLDTLMMLKVLEVTIDDLSRTLSGYSRARVIKAKKIVDEHNRFLARQRQKQQEALAHEARLRRAVEKAREPPRWHRGRRIVERSCP 698          

HSP 2 Score: 75.0998 bits (183), Expect = 3.912e-10
Identity = 46/132 (34.85%), Postives = 77/132 (58.33%), Query Frame = 3
Query:  444 PRMKFIQTFD----FIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFLRNCYR 827
            P     +TFD    FI  R+KIC++EL I+ KE E+++LN++++ E   + +E + L     + D  LK  C+RT++ + L + E  KR + ++++K  ++K   LNA CI LE E+ R   +K+FL    R
Sbjct:  244 PTDNSTETFDQINTFIDDRKKICMMELAIRTKEGEINRLNQMLKAESEFLSREEKDLLLRHDEHDRYLKSICQRTAEAIHLAETEAHKRLVISERIKRTRYKLAHLNAECIKLEEEFIRLSTYKDFLDTVAR 375          
BLAST of Fascin domain protein vs. TrEMBL
Match: A0A3P7NT10 (Uncharacterized protein OS=Dibothriocephalus latus OX=60516 GN=DILT_LOCUS19270 PE=4 SV=1)

HSP 1 Score: 95.5153 bits (236), Expect = 1.799e-17
Identity = 67/241 (27.80%), Postives = 126/241 (52.28%), Query Frame = 3
Query: 1290 VYFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDL------------------------KITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEP 1940
             +F  P +L+++++ELE NNL LIENVQEQEE CE +  K  +++  +    N +++ I+  +E+++N+   +  I      +N+   + RY++IF+L  +                           T+ E++  L +++ K+Y+ V        +D + M+  +E  +D+L+  L  Y+ + + KAKK VDE     AR + K+        ++++ +E+A +PPR+  GR++V RS P
Sbjct:   85 AFFKSPQDLVDILAELESNNLTLIENVQEQEEACERVRVKAARLQKILNMERNTVDAHISREKEEIDNLKRDVTDIVEAKDAINEFNLLERYEKIFHLGGIDQFEMPWMREERSNRKGGPNDKEEPKPTVGEMLEILHDQIHKVYNKVFASESGARLDTLMMLKVLEVTIDDLSRTLSGYSRARVIKAKKIVDEHNRFLARQRQKQQEALAHEARLRRAVEKAREPPRWHRGRRIVERSCP 325          
BLAST of Fascin domain protein vs. Planmine SMEST
Match: SMESG000070000.1 (SMESG000070000.1)

HSP 1 Score: 1171.38 bits (3029), Expect = 0.000e+0
Identity = 650/651 (99.85%), Postives = 650/651 (99.85%), Query Frame = 3
Query:   63 VTSAGLKYPTISRFEKLHLPGIRESSISTKIFIGFPKVPPHLKEIHCKGNPFTEINSLKTHQLKKLEKRRKNFEKKFHDLPVSEHVTRDIRMKYNAKNKLKQLQYAIALKENSIKNNSDESLHSFRLPRMKFIQTFDFIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFLRNCYRQNEYESMTHRRSKLDEYKMEAVLMEMEKQHKFSNESRDSFDVDFLKLPEIVGNSENASNAYFRRIKNKNKFIRNSGIKDVYIKERLIKCKTILSNSDLDTLKSNIILGLSNVNNNIELTSFRSDEEDTTLEFLLSSSFEIMTERSKDSASSGDFVYFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTLRHEEYNFFFT 2015
            VTSAGLKYPTISRFEKLHLPGIRESSISTKIFIGFPKVPPHLKEIHCKGNPFTEINSLKTHQLKKLEKRRKNFEKKFHDLPVSEHVTRDIRMKYNAKNKLKQLQYAIALKENSIKNNSDESLHSFRLPRMKFIQTFDFIVSRRKICLLELGIKIKEQEMSKLNRIVEEEERLIKKEYESLERDQRKEDESLKVTCERTSK LKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFLRNCYRQNEYESMTHRRSKLDEYKMEAVLMEMEKQHKFSNESRDSFDVDFLKLPEIVGNSENASNAYFRRIKNKNKFIRNSGIKDVYIKERLIKCKTILSNSDLDTLKSNIILGLSNVNNNIELTSFRSDEEDTTLEFLLSSSFEIMTERSKDSASSGDFVYFSDPLELINVISELEINNLCLIENVQEQEELCESLIKKTHKIKSKIEKHINFIESLINSGREDLNNINEKINFIENINVNLNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDKEIIKMKKTMEEANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTLRHEEYNFFFT
Sbjct:   10 VTSAGLKYPTISRFEKLHLPGIRESSISTKIFIGFPKVPPHLKEIHCKGNPFTEINSLKTHQLKKLEKRRKNFEKKFHDLPVSEHVTRDIRMKYNAKNKLKQLQYAIALKENSIKNNSDESLHSFRLPRMKFIQTFDFIVSRRKICLLELGIKIKEQEMSKLNRIVEEEERLIKKEYESLERDQRKEDESLKVTCERTSKTLKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFLRNCYRQNEYESMTHRRSKLDEYKMEAVLMEMEKQHKFSNESRDSFDVDFLKLPEIVGNSENASNAYFRRIKNKNKFIRNSGIKDVYIKERLIKCKTILSNSDLDTLKSNIILGLSNVNNNIELTSFRSDEEDTTLEFLLSSSFEIMTERSKDSASSGDFVYFSDPLELINVISELEINNLCLIENVQEQEELCESLIKKTHKIKSKIEKHINFIESLINSGREDLNNINEKINFIENINVNLNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDKEIIKMKKTMEEANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTLRHEEYNFFFT 660          
BLAST of Fascin domain protein vs. Planmine SMEST
Match: SMESG000023075.1 (SMESG000023075.1)

HSP 1 Score: 326.25 bits (835), Expect = 5.175e-102
Identity = 247/660 (37.42%), Postives = 386/660 (58.48%), Query Frame = 3
Query:   84 YPTISRFEKLHLPGIRESSISTKIFIGFPKVPPHLKEIHCKGNPFTEINSLKTHQLKKLEKRRKNFEKK-FHDLPVSEHVTRDIRMKYNAKNKLKQLQYAIALKENSIKNNSDE---SLHSFRLPRMKFIQTFDFIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFLRNCYRQNEYESMTHRRSKLDEYKMEAVLMEMEKQHKFSNESRDSF-DVDFLKLPEIVGNSENASNAYFRRIKNKNKFIRNS-------GIKDVYIKERLIKCKTILSN-SDLDTLKSNIILGLSNVNNN--IELTSFRS--DEEDTTLEFLLSSSFEIMTERSKDSASSGDFVYFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTLRHEEYNFFF 2012
            +PT   F+K+  P I    +  +I    P +P +LKE+  + NPF +I   +  +LK  E  RK +E   + D P+ EHV RD R  +NA  +LK+L++ I  KE  I    +E    +     PR  F+   DFIV++RKICLL+L I IKE++  +L+ IV++EE  IKKE + L+      ++ LK+  + TS  +KL + E  KRN   +K+K A++    LNA C+ LE EY + K +KEFL NC+RQ E +    R S ++E K++A+L E+E       ES DSF D   ++       +EN +N+     +N+N F +NS           V   ER    ++++ N + L+ LKS I++G S  N +   E+T   +  +E++   EF+     E+     ++  +S D +YF++P +L+NV+SELE NNL LIENVQEQEE+C+ + ++   IK  +   I+ I  LI++ R  +N++ + I  I+     L    ++ RYK++F+L+DLK+TT DE++ YL  ++S LY +V +KVD+ + + IEM+  +E L+D L VEL +++ S + KAKK VDE+K  AARL+ K+   D   +K++K M  A  PPRYRYGRKV++RSEP K  L VA  ++  +R+++   FF
Sbjct:   16 FPTSRGFQKIIDPIINTKKVEKRIGPDPPILPNYLKELPIEENPFLDIKMNRIKELKTAESNRKAYESSLYRDFPIIEHVKRDQRTIFNANYQLKKLKHDITWKE--IGEELEERTVKVKKLPTPREPFLSNTDFIVNKRKICLLDLAISIKEEQYMELDDIVKDEEDFIKKENKRLQEINEAHNQYLKIIFQNTSDAIKLAEKETFKRNKIVEKVKRAQYNMAHLNAECVKLEEEYLKLKTYKEFLWNCHRQRERKEAMERTSLMNELKIDAILNEVEMD--LRTESDDSFFDESDIRYHGRRYAAENKNNS----TENQNDFNQNSIETILSYNQTMVDNMERFEATRSLVFNKTQLEKLKSLILIGFSTSNADEFSEITDIIAITNEQNFETEFIKEEEREL----DENDLNSND-LYFNEPQDLVNVLSELEANNLSLIENVQEQEEMCDQMKQRIENIKKDMNHQISTINKLISAERSKINHLEDSIYCIKETEEFLETFNDLERYKKLFFLDDLKLTTPDEVMDYLHEQISVLYHSVFEKVDSTKSNTIEMLKNLEILIDSLYVELQSHDRSVVLKAKKLVDERKREAARLRQKQHCQDAHQLKIQKAMANALMPPRYRYGRKVIFRSEPFKHVLRVAKIDSGIIRNQQEQAFF 662          
BLAST of Fascin domain protein vs. Planmine SMEST
Match: SMESG000023182.1 (SMESG000023182.1)

HSP 1 Score: 300.827 bits (769), Expect = 1.857e-92
Identity = 223/645 (34.57%), Postives = 369/645 (57.21%), Query Frame = 3
Query:   84 YPTISRFEKLHLPGIRESSISTKIFIGFPKVPPHLKEIHCKGNPFTEINSLKTHQLKKLEKRRKNFEKKFHDL-PVSEHVTRDIRMKYNAKNKLKQLQYAIALKE-NSIKNNSDESLHSFRLPRMKFIQTFDFIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFLRNCYRQNEYESMTHRRSKLDEYKMEAVLMEMEKQHKFSNESRDSFDVDFLKLPEIVGNSENASNAYFRRIKNKNKFIRNSGIKDVYIKERLIKCKTILSNSDLDTLKSNIILGLSNVNNNIELTSFRSDEEDTTLEFLLSSSFEIMTERSKDSASSGDFVYFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTLRHEEYNFFF 2012
            +P+  +FEK+  P I    +  +I    P VP +LK ++C+ NPFT     +  +LKKLE  R+NFEK  ++  P+ E+V R IR K+NA  +LK++ Y   + E   + N+ + S    +  + KF     FIV +R++CLL+L I IKE ++ KL+ I+ +EE+ IK+E E L+      ++++K  C++TS  +KL + +  K+N   +K+K A++    LNA C+ LE EY R K +KEFLR C+ Q E + +  R S +DE K++ ++         S  S+DS     L++   + NS + +N+ F   K  N+   N+ + +              + + LD +KS I+ G +NVNN  ++      E  +  +F    S E + + +  + ++   ++   P +L++++S LE NNL LIENVQEQEE+CE L  K  KIK  +E     I   +      L ++ + I  I+ I+  +     + +Y++IF   +L+ TT+D++I YL  K+S LY +V +KVD+ + + +EM+ +IESL++ L +EL +Y+ S I K+K+ VDE+K  AAR++ +++  + E +K++K M +A  PPRY++GRKVVYRS P KP   V   + D +R EE + FF
Sbjct:   17 FPSPCKFEKIIYPIIHTKKVEKRIGPPPPMVPNYLKVMNCEDNPFTITKKKRIDELKKLESERRNFEKNIYETYPMQENVGRSIRNKFNASYELKKVIYTQDMVEIMEVLNSPETSKPITKHLKEKFQSNIHFIVDKRRVCLLDLAINIKEAQLQKLDEIIIQEEKTIKEENEELQNQLEIHNQNMKSICQKTSDAIKLAEKQTAKKNEVIEKVKRARYNMAHLNADCVKLEEEYLRLKTYKEFLRQCHVQREKKHILERTSFMDELKIDVLIKTALSDDLQSFNSQDSKSDIELRVFNKMRNSISNTNSNFGTGKEFNQ--NNNSLPEK-------------TQNRLDKIKSLILSGFANVNNYSDVEELIVPEYSSFQQFESVESIEKVFDENDLNETN---LFLESPQDLVDLLSHLESNNLSLIENVQEQEEMCEHLRGKIRKIKQDMESQNFIINGHVKKEETKLGDLLDNIACIDEIDRFILNFDELEKYRKIFNFGNLEFTTIDQMIDYLHEKISNLYHSVFEKVDSTKSNTVEMLRRIESLINSLYIELQSYDRSTIQKSKRLVDERKREAARIRQRQLSKEAEALKIEKAMIKARMPPRYKFGRKVVYRSNPPKPICHVKEIDWDAVREEEEHLFF 643          
BLAST of Fascin domain protein vs. Planmine SMEST
Match: SMESG000023179.1 (SMESG000023179.1)

HSP 1 Score: 253.447 bits (646), Expect = 1.792e-74
Identity = 224/668 (33.53%), Postives = 364/668 (54.49%), Query Frame = 3
Query:   78 LKYPTISRFEKLHLPGIRESSISTKIFIGFPKVPPHLKEIHCKGNPFTEINSLKTHQLKKLEKRRKNFEK-KFHDLPVSEHVTRDIRMKYNAKNKLKQLQYAI-------ALKENSIKNNSDESLHSFRL-PRMKFIQTFDFIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFLRNCYRQNEYESMTHRRSKLDEYKMEAVLMEMEKQHKFS-NESRDSFDVDFLKLPEIVGNSENASNAYFRRIKNKNKFIRNSGIKDVYIKERLIKCKTILSNSDLDTLKSNIILGLSNVNNNIELTSFRSDEEDTTLEFLLSSSFEIMTERSKDS---------ASSGDFVYFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLI---NSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTLRH-EEYNFFF 2012
            LK+PT S+F+K     +    I  K+    P +P +L E +  GNPF  I    T  L   +K+RK F+K K    P  E+V R++R  +NA   +K+LQY          L+   I   +  +   F+  PR      +DF+V +R++CLL+L  ++K+Q +S L+  V+ +E  IK E + LE+++ + D+ LK  C  TS  +K++D+ + K++   +KLK A+F +DKLNA CI LE E++  K+++ FL +CY +        R S L + +M  V+ EME++ K S  ES  S + + +K    +  +EN    Y R          N+   +V+    +      LSN    +      + + N +N+++ + F+S      L  +L +   I+T  SKD+          S+ D + F DP +L+NV + LE+NNL LIENVQEQEE+C++L+ +  KIK ++   +  I+ LI   N   + L      I   E+   +LNK   + RY+ IFYLEDL +TT+DEL+GYL  +V  LY     + ++   ++IE++ +IES VD+L V++  Y+ + I  AKK+VD++K  A+RLK KE+  +  + +    +E++  PP++R+GRK+VYRS P    +     N +++R  EE  FFF
Sbjct:   16 LKFPTKSKFDKSVEETLHGKKIIEKVGPIRPIIPKYLSEYNEGGNPFRAIKYENTETLIASDKQRKLFDKEKNLKFPFFENVNRNVRNLFNANFAVKELQYKFDREEFLELLEHPEISRANTTATVRFQYEPRK---SDYDFVVDKRRVCLLDLAKRLKQQHISNLDVSVKIQENSIKHELQLLEKEKTENDKLLKSVCVNTSDAVKVLDEASLKKHKIIQKLKRARFIKDKLNAECIKLEDEFNILKSYRWFLYSCYNRQLKSLSLARTSFLSDVQMSTVIKEMEREVKLSIEESEASLNTEIVK---ALATNENGV-IYMR----PESLTENNTNNEVFKGFEINSHSNELSNRRRGSSIEREKMTMDNFSNSVQSSLFKS----VKLIPILLNEPNIITIDSKDTFKDNETLELDSNDDDILFEDPQDLVNVFNNLEMNNLNLIENVQEQEEICDNLVNRLKKIKFEMAIKVKEIDDLIKRENHNVDGLEESIVFIMKTEDFTRSLNK---LERYRSIFYLEDLDLTTVDELLGYLLQQVLDLYFIFFDRGNSIVKNIIEILCRIESYVDKLYVKMQMYSKNQIIMAKKSVDDRKFKASRLKQKELEKEMRLKRFHDVIEKSKLPPKHRFGRKLVYRSPPFDKKMSKEKGNLESIRKLEENQFFF 665          
BLAST of Fascin domain protein vs. Planmine SMEST
Match: SMESG000023181.1 (SMESG000023181.1)

HSP 1 Score: 240.736 bits (613), Expect = 3.966e-70
Identity = 219/653 (33.54%), Postives = 343/653 (52.53%), Query Frame = 3
Query:   84 YPTISRFEKLHLPGIRESSISTKIFIGFPKVPPHLKEIHCKGNPFTEINSLKTHQLKKLEKRRKNFEK-KFHDLPVSEHVTRDIRMKYNAKNKLKQLQYAIALKENSIKNNSDESLHSFRLP--RMKFIQTFDFIVSRRKICLLELGIKIKEQEMSKLNXXXXXXXXXXXXXXXSLERDQRKEDESLKVTCERTSKILKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYSRFKAFKEFLRNCYRQNEYESMTHRRSKLDEYKMEAVLMEMEKQHKFSNESRDSFDVDFLKLPEIVGNSENASNAYFRRIKNKNKFIRNS-----GIKDVYIKERLIKCKTILSNSDLDTLKSNIILGLSNVNNNIELTSFRSDEEDTTLEFLLSSSFEIMTERSKDSASSGDFVYFSDPLELINVISELEINNLCLIENVQEQEELCESLXXXXXXXXXXXXXXXNFIESLINSGREDLXXXXXXXXXXXXXXXXLNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNEIDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKEMMLDXXXXXXXXXXXXANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTLR-HEEYNFFFT 2015
            +PT+S+FE   L   R   +        P VP +L E+ C  NPF       T++LK LEK+RK+F + K  +  V+E+V RD R+K+NAK  LK  QY +   E S    +   + S   P   +K +  +DFI S+R++CLL+L  KI ++ ++KL+ IVE+EE+ IKKE + L++++++ +E LK  C+RT KI++  D +  ++    KKLK AKF   KLN  CI LE E    K  K FL+  +   E + +    S LDE  +   L E+ +Q                         E+ S      I N+  F++N+       K +    +  +  +  S   L+ LKS +IL     N+  E++S +       +   LS SF    E S+DS SS       DP++L+ +++ LEI NL LIENVQEQEE+C+ + KK   IK +++K    I+  I    + +  I   I  ++    +L+K + I RYK  F L+  K + LD+L+ Y+  +++ L  ++    D++E   +EM+ +IESLVD L ++L  Y+   +   KK +DE K  A R +  + + +    K+KK ME  N PPRY  GRKV+YRS+P + ++     N D +R  EE ++FFT
Sbjct:   17 FPTLSKFENDILDFTRTRPVDRLSIYEKPVVPGYLSELFCNENPFMATQYRHTNELKDLEKQRKDFNREKIRNYSVTENVNRDTRIKFNAKYSLKNFQYILNRNEMS---EAKAPIPSALKPVHNLKTVSNYDFIFSKREVCLLDLAGKITQKNIAKLDEIVEKEEKFIKKENQLLQKEKKENEEYLKSVCQRTYKIVRRADKQVLRKEKVIKKLKRAKFVSSKLNTECIQLEEELENLKNLKLFLKKSFHNKEIDEICPNLSFLDEIPLSEQLRELGRQD---------------------SAPEDNSAEGLEEIGNEGFFVKNNYYSVENPKSLNFSNKFPQLYS-FSKEKLEDLKS-LILSDFGGNSKREVSSTKP------IFTELSKSFSDDLEFSEDSFSSHQKEMLRDPMDLVAIVTNLEIKNLSLIENVQEQEEMCDLMKKKILDIKMEMDKQTKDIDESIQEENKKIEKIVASIENLQEKCSSLDKFYTIERYKAFFCLKGFKKSHLDDLLEYIVKQINVLDFSIFDNQDSDERGPLEMLRQIESLVDSLYIDLQRYDKKTLILTKKRLDECKRQANRARLNKQIKETRAEKLKKVMESFNLPPRYVGGRKVMYRSQPLQRSVHCEEVNLDDIRQQEEIDYFFT 637          
The following BLAST results are available for this feature:
BLAST of Fascin domain protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fascin domain protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fascin domain protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fascin domain protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fascin domain protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fascin domain protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Cfap1008.535e-723.05cilia and flagella associated protein 100 [Source:... [more]
back to top
BLAST of Fascin domain protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q80VN0|CP100_MOUSE5.970e-623.05Cilia- and flagella-associated protein 100 OS=Mus ... [more]
back to top
BLAST of Fascin domain protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A504Z2Q97.996e-1829.00Coiled-coil domain-containing protein 37 OS=Fascio... [more]
A0A2H1CM058.136e-1829.00Coiled-coil domain-containing protein 37 OS=Fascio... [more]
G7YM268.477e-1828.53Coiled-coil domain-containing protein 37 OS=Clonor... [more]
A0A0X3NQ981.257e-1727.43DUF4200 domain-containing protein OS=Schistocephal... [more]
A0A3P7NT101.799e-1727.80Uncharacterized protein OS=Dibothriocephalus latus... [more]
back to top
BLAST of Fascin domain protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fascin domain protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fascin domain protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fascin domain protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fascin domain protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Fascin domain protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000070000.10.000e+099.85SMESG000070000.1[more]
SMESG000023075.15.175e-10237.42SMESG000023075.1[more]
SMESG000023182.11.857e-9234.57SMESG000023182.1[more]
SMESG000023179.11.792e-7433.53SMESG000023179.1[more]
SMESG000023181.13.966e-7033.54SMESG000023181.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023574 ID=SMED30023574|Name=Fascin domain protein|organism=Schmidtea mediterranea sexual|type=transcript|length=2050bp
TTTGAATTTTAATTTAAGCAAAACTAAGTAGAAAAATGAAGAAATCAAGT
AAAAGACGGTCGGTAACAAGTGCCGGGCTAAAATATCCAACAATCTCCAG
ATTCGAAAAGCTACATCTTCCTGGGATAAGAGAAAGCTCGATTAGCACTA
AAATATTTATTGGGTTTCCAAAAGTTCCACCACATTTAAAAGAAATTCAT
TGCAAAGGAAACCCTTTCACCGAAATAAATTCTCTCAAAACCCATCAACT
GAAAAAGTTAGAAAAGAGAAGAAAGAATTTCGAAAAAAAGTTCCATGACC
TTCCAGTCTCTGAACATGTCACTCGAGACATTCGGATGAAGTATAACGCC
AAAAATAAATTAAAGCAGCTTCAGTATGCAATTGCACTAAAAGAGAATTC
TATAAAAAATAATTCAGATGAATCGTTGCACAGTTTCAGGCTGCCAAGGA
TGAAATTCATTCAGACATTTGACTTTATTGTTAGTAGAAGAAAGATATGC
CTATTGGAGTTGGGAATAAAAATTAAAGAACAAGAAATGTCAAAGTTGAA
TAGAATCGTCGAAGAGGAGGAAAGGTTAATTAAAAAAGAATATGAAAGTC
TAGAAAGAGATCAGAGAAAGGAAGATGAGAGTTTGAAAGTGACTTGTGAG
AGAACCTCAAAAATTTTGAAACTTGTTGACGACGAAAATGAAAAACGAAA
TCTTTCAGCTAAGAAACTTAAACATGCCAAATTCAAAAGAGATAAGCTTA
ATGCTCATTGCATTCATTTGGAGAGTGAATATTCCAGATTTAAAGCATTC
AAGGAGTTCCTAAGAAACTGTTACAGACAGAATGAATACGAAAGTATGAC
TCATAGACGAAGTAAATTGGATGAATACAAAATGGAGGCAGTTCTGATGG
AAATGGAGAAGCAACATAAATTTTCAAATGAATCGAGAGATTCATTTGAC
GTTGATTTTCTTAAGTTACCGGAAATAGTTGGCAATTCGGAGAATGCTAG
CAATGCCTATTTTCGTCGCATTAAAAATAAAAATAAATTTATTAGAAACT
CAGGAATAAAAGATGTATATATTAAAGAGAGGTTAATCAAATGTAAAACT
ATATTAAGCAACAGTGACTTGGACACTTTGAAATCCAACATCATCCTAGG
ACTTTCCAATGTTAACAATAACATTGAATTAACAAGCTTTAGAAGTGACG
AAGAAGACACTACCCTCGAATTCCTGTTAAGTTCTTCTTTTGAGATTATG
ACTGAAAGATCCAAAGATTCAGCATCGTCAGGAGATTTTGTTTATTTTTC
TGACCCCCTCGAACTGATTAATGTCATCAGTGAGTTGGAAATAAATAACT
TGTGTTTGATTGAAAATGTACAAGAGCAAGAAGAATTATGTGAATCGTTG
ATCAAGAAAACCCACAAGATCAAATCAAAAATCGAAAAACATATTAATTT
CATAGAGTCACTAATCAATTCCGGAAGGGAGGACCTTAACAATATAAACG
AAAAAATAAATTTTATAGAAAACATCAATGTCAATTTAAACAAACATTTC
AACATTAATCGCTACAAAGAAATATTCTACCTCGAAGATCTCAAGATTAC
GACATTGGACGAGTTGATCGGTTATCTTTTCAACAAAGTCAGCAAGTTGT
ATTCAACAGTAATCCAAAAGGTTGATACGAATGAAATAGACCTAATCGAA
ATGATGACGAAAATTGAAAGTCTCGTTGACGAGTTGACTGTTGAATTGTT
GACATATAATGACTCGGCAATAAGTAAAGCTAAGAAAGCTGTCGATGAGA
AGAAAATACTTGCAGCCCGTTTGAAACACAAAGAAATGATGCTGGACAAA
GAAATCATAAAAATGAAGAAAACAATGGAAGAAGCAAACAAGCCACCGAG
ATATAGGTATGGCAGGAAAGTGGTATACCGATCTGAACCCGAGAAACCAA
ACCTCATCGTAGCCGCTACGAATACGGACACCCTCCGACATGAAGAATAT
AACTTCTTTTTTACGTAATTCTTAGTTGTAAGAATTATTCATGACTTTCC
back to top

protein sequence of SMED30023574-orf-1

>SMED30023574-orf-1 ID=SMED30023574-orf-1|Name=SMED30023574-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=661bp
MKKSSKRRSVTSAGLKYPTISRFEKLHLPGIRESSISTKIFIGFPKVPPH
LKEIHCKGNPFTEINSLKTHQLKKLEKRRKNFEKKFHDLPVSEHVTRDIR
MKYNAKNKLKQLQYAIALKENSIKNNSDESLHSFRLPRMKFIQTFDFIVS
RRKICLLELGIKIKEQEMSKLNRIVEEEERLIKKEYESLERDQRKEDESL
KVTCERTSKILKLVDDENEKRNLSAKKLKHAKFKRDKLNAHCIHLESEYS
RFKAFKEFLRNCYRQNEYESMTHRRSKLDEYKMEAVLMEMEKQHKFSNES
RDSFDVDFLKLPEIVGNSENASNAYFRRIKNKNKFIRNSGIKDVYIKERL
IKCKTILSNSDLDTLKSNIILGLSNVNNNIELTSFRSDEEDTTLEFLLSS
SFEIMTERSKDSASSGDFVYFSDPLELINVISELEINNLCLIENVQEQEE
LCESLIKKTHKIKSKIEKHINFIESLINSGREDLNNINEKINFIENINVN
LNKHFNINRYKEIFYLEDLKITTLDELIGYLFNKVSKLYSTVIQKVDTNE
IDLIEMMTKIESLVDELTVELLTYNDSAISKAKKAVDEKKILAARLKHKE
MMLDKEIIKMKKTMEEANKPPRYRYGRKVVYRSEPEKPNLIVAATNTDTL
RHEEYNFFFT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: biological process
TermDefinition
GO:0007015actin filament organization
GO:0016477cell migration
GO:0030036actin cytoskeleton organization
GO:0008150biological_process
Vocabulary: molecular function
TermDefinition
GO:0030674protein binding, bridging
GO:0051015actin filament binding
GO:0003674molecular_function
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000208testis
PLANA:0002089reproductive organ
Vocabulary: cellular component
TermDefinition
GO:0005737cytoplasm
GO:0005813centrosome
GO:0005815microtubule organizing center
GO:0005856cytoskeleton
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 431..451
NoneNo IPR availableCOILSCoilCoilcoord: 65..85
NoneNo IPR availableCOILSCoilCoilcoord: 161..195
NoneNo IPR availablePANTHERPTHR21683:SF3CILIA AND FLAGELLA ASSOCIATED PROTEIN 100coord: 56..658
NoneNo IPR availablePANTHERPTHR21683UNCHARACTERIZEDcoord: 56..658