Serine/threonine-protein phosphatase 2B catalytic subunit

Overview
NameSerine/threonine-protein phosphatase 2B catalytic subunit
Smed IDSMED30023540
Length (bp)1745
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Serine/threonine-protein phosphatase 2B catalytic subunit (SMED30023540) t-SNE clustered cells

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase 2B catalytic subunit (SMED30023540) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Serine/threonine-protein phosphatase 2B catalytic subunit (SMED30023540) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Serine/threonine-protein phosphatase 2B catalytic subunit (SMED30023540) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023540

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30023540SMESG000064848.1 dd_Smed_v4_2045_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30023540SMESG000064848.1 dd_Smed_v6_2045_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
epidermisSMED30023540SMESG000064848.1 dd_Smed_v4_2045_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Human
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9314])

HSP 1 Score: 152.91 bits (385), Expect = 1.833e-41
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  154 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSN 281          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Human
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9314])

HSP 1 Score: 152.525 bits (384), Expect = 4.746e-40
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  288 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSN 415          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Human
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9314])

HSP 1 Score: 152.14 bits (383), Expect = 3.335e-39
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  386 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Human
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9314])

HSP 1 Score: 150.599 bits (379), Expect = 6.192e-39
Identity = 74/124 (59.68%), Postives = 92/124 (74.19%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +       + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  344 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSA------IKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSN 461          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Human
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:HGNC Symbol;Acc:HGNC:9314])

HSP 1 Score: 150.214 bits (378), Expect = 1.229e-38
Identity = 74/124 (59.68%), Postives = 92/124 (74.19%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +       + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  386 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSA------IKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSN 503          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Celegans
Match: tax-6 (Serine/threonine-protein phosphatase 2B catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:Q0G819])

HSP 1 Score: 123.25 bits (308), Expect = 1.219e-29
Identity = 66/116 (56.90%), Postives = 79/116 (68.10%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQT 1611
            GG  +ARKEVIR+KIRAIGKMAR F+VLREESESVL LKGLTP G LP+G L GG   +  VA +    SG    H+I+SFEEA+ +DK+NER+PP      A S   S    +QT
Sbjct:  412 GGVGSARKEVIRHKIRAIGKMARAFSVLREESESVLALKGLTPTGALPMGTLQGGSRGVREVAAE----SGCDSGHLIQSFEEARRLDKINERMPPTMATPPAQSPSQSPIPSRQT 523          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Celegans
Match: tax-6 (Serine/threonine-protein phosphatase 2B catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:Q0G819])

HSP 1 Score: 116.316 bits (290), Expect = 2.421e-27
Identity = 67/120 (55.83%), Postives = 81/120 (67.50%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLE----TLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQT 1611
            GG  +ARKEVIR+KIRAIGKMAR F+VLR ESESVLQLKGL   G LP GALS G+  L+  AY++E      SG    H+I+SFEEA+ +DK+NER+PP      A S   S    +QT
Sbjct:  412 GGVGSARKEVIRHKIRAIGKMARAFSVLRHESESVLQLKGLNAGGKLPQGALSEGRTGLN-AAYRIEQSVAAESGCDSGHLIQSFEEARRLDKINERMPPTMATPPAQSPSQSPIPSRQT 530          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Celegans
Match: tax-6 (Serine/threonine-protein phosphatase 2B catalytic subunit [Source:UniProtKB/Swiss-Prot;Acc:Q0G819])

HSP 1 Score: 116.316 bits (290), Expect = 2.757e-27
Identity = 67/120 (55.83%), Postives = 81/120 (67.50%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLE----TLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQT 1611
            GG  +ARKEVIR+KIRAIGKMAR F+VLR ESESVLQLKGL   G LP GALS G+  L+  AY++E      SG    H+I+SFEEA+ +DK+NER+PP      A S   S    +QT
Sbjct:  415 GGVGSARKEVIRHKIRAIGKMARAFSVLRHESESVLQLKGLNAGGKLPQGALSEGRTGLN-AAYRIEQSVAAESGCDSGHLIQSFEEARRLDKINERMPPTMATPPAQSPSQSPIPSRQT 533          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Fly
Match: Pp2B-14D (gene:FBgn0011826 transcript:FBtr0305593)

HSP 1 Score: 142.51 bits (358), Expect = 7.443e-36
Identity = 71/96 (73.96%), Postives = 76/96 (79.17%), Query Frame = 1
Query: 1273 VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1560
             A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL         + G SPNH I SF EAK +D VNER+PPRRD
Sbjct:  457 AALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNA------MQGFSPNHKITSFAEAKGLDAVNERMPPRRD 546          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Fly
Match: Pp2B-14D (gene:FBgn0011826 transcript:FBtr0309793)

HSP 1 Score: 142.51 bits (358), Expect = 7.443e-36
Identity = 71/96 (73.96%), Postives = 76/96 (79.17%), Query Frame = 1
Query: 1273 VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1560
             A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL         + G SPNH I SF EAK +D VNER+PPRRD
Sbjct:  457 AALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNA------MQGFSPNHKITSFAEAKGLDAVNERMPPRRD 546          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Fly
Match: Pp2B-14D (gene:FBgn0011826 transcript:FBtr0074294)

HSP 1 Score: 142.51 bits (358), Expect = 7.443e-36
Identity = 71/96 (73.96%), Postives = 76/96 (79.17%), Query Frame = 1
Query: 1273 VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1560
             A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL         + G SPNH I SF EAK +D VNER+PPRRD
Sbjct:  457 AALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNA------MQGFSPNHKITSFAEAKGLDAVNERMPPRRD 546          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Fly
Match: CanA-14F (gene:FBgn0267912 transcript:FBtr0305198)

HSP 1 Score: 142.51 bits (358), Expect = 8.035e-36
Identity = 72/103 (69.90%), Postives = 79/103 (76.70%), Query Frame = 1
Query: 1276 AARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNE 1584
            A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL         + G SPNH I SF EAK +D VNER+PPRRD   + + E
Sbjct:  466 ALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNA------MQGFSPNHKITSFAEAKGLDAVNERMPPRRDATPSPAEE 562          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Fly
Match: CanA-14F (gene:FBgn0267912 transcript:FBtr0074292)

HSP 1 Score: 142.51 bits (358), Expect = 8.035e-36
Identity = 72/103 (69.90%), Postives = 79/103 (76.70%), Query Frame = 1
Query: 1276 AARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNE 1584
            A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL         + G SPNH I SF EAK +D VNER+PPRRD   + + E
Sbjct:  466 ALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNA------MQGFSPNHKITSFAEAKGLDAVNERMPPRRDATPSPAEE 562          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Zebrafish
Match: ppp3ccb (protein phosphatase 3, catalytic subunit, gamma isozyme, b [Source:ZFIN;Acc:ZDB-GENE-070112-1102])

HSP 1 Score: 146.747 bits (369), Expect = 2.247e-37
Identity = 70/113 (61.95%), Postives = 88/113 (77.88%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLE---TLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSI 1593
            GG+ A RKEVIRNKIRAIGKMARVF+VLREE+ESVLQLKGLTP G+LPLG LSGG+++L +   + E    + G +P H I+SFEEA+ +D++NER+PPRRD    +   NSI
Sbjct:  390 GGTPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQLKGLTPTGMLPLGVLSGGRQTLQSATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERMPPRRDTKQPDGTANSI 502          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Zebrafish
Match: ppp3ccb (protein phosphatase 3, catalytic subunit, gamma isozyme, b [Source:ZFIN;Acc:ZDB-GENE-070112-1102])

HSP 1 Score: 141.354 bits (355), Expect = 1.071e-35
Identity = 67/111 (60.36%), Postives = 85/111 (76.58%), Query Frame = 1
Query: 1270 SVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLE---TLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSI 1593
            +   RKEVIRNKIRAIGKMARVF+VLREE+ESVLQLKGLTP G+LPLG LSGG+++L +   + E    + G +P H I+SFEEA+ +D++NER+PPRRD    +   NSI
Sbjct:  381 TCEVRKEVIRNKIRAIGKMARVFSVLREENESVLQLKGLTPTGMLPLGVLSGGRQTLQSATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERMPPRRDTKQPDGTANSI 491          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Zebrafish
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 137.502 bits (345), Expect = 2.278e-34
Identity = 71/134 (52.99%), Postives = 92/134 (68.66%), Query Frame = 1
Query: 1270 SVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----------ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDIN 1641
            + AARKEVIRNKIRAIGKMA++F+VLREESE+VL LKGLTP G+LP G LSGGK++L +   +           E + G SP H I SFEEAK +D++NER+PPRRD++  NS   S+ +     +N  D + N
Sbjct:  378 AAAARKEVIRNKIRAIGKMAKMFSVLREESENVLTLKGLTPTGMLPSGVLSGGKQTLQSATIEAIEAVEEVKDGEAIRGFSPQHKITSFEEAKGLDRINERMPPRRDVV--NSVGLSMGKMNMAESNGTDDNSN 509          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Zebrafish
Match: ppp3cca (protein phosphatase 3, catalytic subunit, gamma isozyme, a [Source:ZFIN;Acc:ZDB-GENE-030829-36])

HSP 1 Score: 137.117 bits (344), Expect = 3.182e-34
Identity = 66/102 (64.71%), Postives = 80/102 (78.43%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLE---TLSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1560
            GG+ A RKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G LPLG LSGGK++L     + +    + G SP   IR+FEEA+ +D++NER+PPR+D
Sbjct:  380 GGAPAVRKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGTLPLGVLSGGKQTLQNATIEAKEGRAIQGFSPTRKIRNFEEARGLDRINERMPPRKD 481          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Zebrafish
Match: ppp3cca (protein phosphatase 3, catalytic subunit, gamma isozyme, a [Source:ZFIN;Acc:ZDB-GENE-030829-36])

HSP 1 Score: 136.732 bits (343), Expect = 4.092e-34
Identity = 66/102 (64.71%), Postives = 80/102 (78.43%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLE---TLSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1560
            GG+ A RKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G LPLG LSGGK++L     + +    + G SP   IR+FEEA+ +D++NER+PPR+D
Sbjct:  385 GGAPAVRKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGTLPLGVLSGGKQTLQNATIEAKEGRAIQGFSPTRKIRNFEEARGLDRINERMPPRKD 486          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 151.754 bits (382), Expect = 4.397e-39
Identity = 75/125 (60.00%), Postives = 94/125 (75.20%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSV 1626
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N+V
Sbjct:  386 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATIEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKAISSETNAV 510          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 150.214 bits (378), Expect = 8.018e-39
Identity = 74/124 (59.68%), Postives = 92/124 (74.19%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +       + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  361 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQS------AIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKAISSETNGTDSN 478          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 150.214 bits (378), Expect = 8.092e-39
Identity = 74/124 (59.68%), Postives = 92/124 (74.19%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +       + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  354 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQS------AIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKAISSETNGTDSN 471          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 150.214 bits (378), Expect = 9.133e-39
Identity = 74/124 (59.68%), Postives = 92/124 (74.19%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +       + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  367 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQS------AIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKAISSETNGTDSN 484          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Xenopus
Match: rai1 (retinoic acid induced 1 [Source:Xenbase;Acc:XB-GENE-987626])

HSP 1 Score: 150.599 bits (379), Expect = 1.018e-38
Identity = 74/124 (59.68%), Postives = 92/124 (74.19%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +       + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  395 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQS------AIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKAISSETNGTDSN 512          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Mouse
Match: Ppp3ca (protein phosphatase 3, catalytic subunit, alpha isoform [Source:MGI Symbol;Acc:MGI:107164])

HSP 1 Score: 152.14 bits (383), Expect = 2.380e-39
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  386 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Mouse
Match: Ppp3ca (protein phosphatase 3, catalytic subunit, alpha isoform [Source:MGI Symbol;Acc:MGI:107164])

HSP 1 Score: 150.214 bits (378), Expect = 8.601e-39
Identity = 74/124 (59.68%), Postives = 92/124 (74.19%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +       + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  386 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQS------AIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 503          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Mouse
Match: Ppp3cb (protein phosphatase 3, catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:107163])

HSP 1 Score: 136.732 bits (343), Expect = 6.422e-34
Identity = 69/122 (56.56%), Postives = 88/122 (72.13%), Query Frame = 1
Query: 1261 IGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDII---------TANSNEN 1587
              GS AARKE+IRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G L+GG+++L +   +     + + G SP H I SFEEAK +D++NER+PPR+D +         TA++ EN
Sbjct:  394 FDGSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHTTEN 515          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Mouse
Match: Ppp3cb (protein phosphatase 3, catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:107163])

HSP 1 Score: 136.346 bits (342), Expect = 6.568e-34
Identity = 69/116 (59.48%), Postives = 86/116 (74.14%), Query Frame = 1
Query: 1267 GSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDII---------TANSNEN 1587
            GS AARKE+IRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G L+GG+++L +       + G SP H I SFEEAK +D++NER+PPR+D +         TA++ EN
Sbjct:  397 GSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQS------AIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHTTEN 506          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Mouse
Match: Ppp3cb (protein phosphatase 3, catalytic subunit, beta isoform [Source:MGI Symbol;Acc:MGI:107163])

HSP 1 Score: 136.346 bits (342), Expect = 7.855e-34
Identity = 69/120 (57.50%), Postives = 88/120 (73.33%), Query Frame = 1
Query: 1267 GSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDII---------TANSNEN 1587
            GS AARKE+IRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G L+GG+++L +   +     + + G SP H I SFEEAK +D++NER+PPR+D +         TA++ EN
Sbjct:  397 GSAAARKEIIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLAGGRQTLQSATVEAIEAEKAIRGFSPPHRICSFEEAKGLDRINERMPPRKDAVQQDGFNSLNTAHTTEN 516          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. UniProt/SwissProt
Match: sp|P48452|PP2BA_BOVIN (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Bos taurus OX=9913 GN=PPP3CA PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.586e-38
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  386 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. UniProt/SwissProt
Match: sp|Q08209|PP2BA_HUMAN (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Homo sapiens OX=9606 GN=PPP3CA PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.601e-38
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  386 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALTSETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. UniProt/SwissProt
Match: sp|P63329|PP2BA_RAT (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Rattus norvegicus OX=10116 GN=Ppp3ca PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.665e-38
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  386 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. UniProt/SwissProt
Match: sp|P63328|PP2BA_MOUSE (Serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform OS=Mus musculus OX=10090 GN=Ppp3ca PE=1 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 1.665e-38
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:  386 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 513          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. UniProt/SwissProt
Match: sp|Q27889|PP2B2_DROME (Serine/threonine-protein phosphatase 2B catalytic subunit 2 OS=Drosophila melanogaster OX=7227 GN=Pp2B-14D PE=1 SV=2)

HSP 1 Score: 142.51 bits (358), Expect = 7.461e-35
Identity = 71/96 (73.96%), Postives = 76/96 (79.17%), Query Frame = 1
Query: 1273 VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1560
             A RKEVIRNKIRAIGKMARVF+VLREESESVLQLKGLTP G LPLGALSGGK+SL         + G SPNH I SF EAK +D VNER+PPRRD
Sbjct:  457 AALRKEVIRNKIRAIGKMARVFSVLREESESVLQLKGLTPTGALPLGALSGGKQSLKNA------MQGFSPNHKITSFAEAKGLDAVNERMPPRRD 546          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. TrEMBL
Match: A0A5K3ERR8 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 5.155e-44
Identity = 88/139 (63.31%), Postives = 108/139 (77.70%), Query Frame = 1
Query: 1231 SLFYG*SLFLIGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNEN-SIYRHQQTNNNSVDQDINT 1644
            SLF   +LF++GG+VAARKEVIRNKIRAIGKMARVFTVLREESESVL+LKGLTPNG+LP GALSGG+E+L      L  L G++PNH I SFEEAKAID +NER+PPR D+ +A+S  N +  R + + +NS   +  T
Sbjct:   59 SLFILLALFVLGGTVAARKEVIRNKIRAIGKMARVFTVLREESESVLELKGLTPNGMLPFGALSGGRETL------LTALCGVAPNHKITSFEEAKAIDLINERMPPRHDMGSASSGSNWNSTRARSSYHNSASGNAAT 191          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. TrEMBL
Match: A0A212CLQ2 (PPP3CA OS=Cervus elaphus hippelaphus OX=46360 GN=Celaphus_00018583 PE=4 SV=1)

HSP 1 Score: 154.066 bits (388), Expect = 2.256e-40
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:   23 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 150          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. TrEMBL
Match: A0A5K3EQ99 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 160.614 bits (405), Expect = 3.072e-40
Identity = 79/108 (73.15%), Postives = 91/108 (84.26%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNEN 1587
            GG+VAARKEVIRNKIRAIGKMARVFTVLREESESVL+LKGLTPNG+LP GALSGG+E+L      L  L G++PNH I SFEEAKAID +NER+PPR D+ +A+S  N
Sbjct:  170 GGTVAARKEVIRNKIRAIGKMARVFTVLREESESVLELKGLTPNGMLPFGALSGGRETL------LTALCGVAPNHKITSFEEAKAIDLINERMPPRHDMGSASSGSN 271          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. TrEMBL
Match: A0A553MWZ7 (Uncharacterized protein OS=Danionella translucida OX=623744 GN=DNTS_025905 PE=4 SV=1)

HSP 1 Score: 152.14 bits (383), Expect = 4.705e-40
Identity = 72/129 (55.81%), Postives = 95/129 (73.64%), Query Frame = 1
Query: 1252 LFLIGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLE---TLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1629
            +F+ GG+ A RKEVIRNKIRAIGKMARVF+VLREE+ESVLQLKGLTP G+LPLG LSGG+++L +   + E    + G +P H I+SFEEA+ +D++NER+PPR+D I  +   NSI      + N  +
Sbjct:    1 MFVAGGAPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQLKGLTPTGMLPLGVLSGGRQTLQSATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERMPPRKDAIQPDGTANSINAANSPDKNGTN 129          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. TrEMBL
Match: A0A485NQE9 (Serine threonine-protein phosphatase 2b catalytic (Fragment) OS=Lynx pardinus OX=191816 GN=LYPA_23C018500 PE=4 SV=1)

HSP 1 Score: 152.91 bits (385), Expect = 2.124e-39
Identity = 75/128 (58.59%), Postives = 94/128 (73.44%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQD 1635
            G + AARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGK++L +   +     E + G SP H I SFEEAK +D++NER+PPRRD + +++N NSI +   +  N  D +
Sbjct:   67 GATAAARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKQTLQSATVEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDAMPSDANLNSINKALASETNGTDSN 194          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Cavefish
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:NCBI gene;Acc:103021658])

HSP 1 Score: 144.821 bits (364), Expect = 5.989e-37
Identity = 71/126 (56.35%), Postives = 90/126 (71.43%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1629
            G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGG+E L     +     E + G SP H I SFEEAK +D++NER+PPRRD +  +++ NS+ +   +  N  +
Sbjct:  386 GATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGREKLQNATIEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPCDASLNSLNKALSSETNGTE 511          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Cavefish
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:NCBI gene;Acc:103021658])

HSP 1 Score: 145.206 bits (365), Expect = 6.381e-37
Identity = 71/126 (56.35%), Postives = 90/126 (71.43%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1629
            G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGG+E L     +     E + G SP H I SFEEAK +D++NER+PPRRD +  +++ NS+ +   +  N  +
Sbjct:  395 GATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGREKLQNATIEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPCDASLNSLNKALSSETNGTE 520          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Cavefish
Match: ppp3ccb (serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like [Source:NCBI gene;Acc:103046193])

HSP 1 Score: 143.28 bits (360), Expect = 2.171e-36
Identity = 68/110 (61.82%), Postives = 85/110 (77.27%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSI 1593
            GG+ A RKEVIRNKIRAIGKMARVF+VLREE+ESVLQLKGLTP G LPLG LSGG+++L +   +     G +P H I+SFEEA+ +D++NER+PPR+D    +   NSI
Sbjct:  384 GGAPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQLKGLTPTGTLPLGVLSGGRQTLQSATVEAAEARGFNPQHKIQSFEEARGLDRINERMPPRKDGKQPDGLANSI 493          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Cavefish
Match: PPP3CA (protein phosphatase 3 catalytic subunit alpha [Source:NCBI gene;Acc:103021658])

HSP 1 Score: 143.28 bits (360), Expect = 2.394e-36
Identity = 70/122 (57.38%), Postives = 88/122 (72.13%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1629
            G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGG+E L         + G SP H I SFEEAK +D++NER+PPRRD +  +++ NS+ +   +  N  +
Sbjct:  395 GATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGREKLQNA------IKGFSPQHKITSFEEAKGLDRINERMPPRRDALPCDASLNSLNKALSSETNGTE 510          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Cavefish
Match: ppp3ccb (serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform-like [Source:NCBI gene;Acc:103046193])

HSP 1 Score: 140.198 bits (352), Expect = 1.846e-35
Identity = 68/110 (61.82%), Postives = 85/110 (77.27%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSI 1593
            GG+ A RKEVIRNKIRAIGKMARVF+VLREE+ESVLQLKGLTP G LPLG LSGG+++L +       + G +P H I+SFEEA+ +D++NER+PPR+D    +   NSI
Sbjct:  384 GGAPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQLKGLTPTGTLPLGVLSGGRQTLQS------AIQGFNPQHKIQSFEEARGLDRINERMPPRKDGKQPDGLANSI 487          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Sea Lamprey
Match: ppp3cb (protein phosphatase 3, catalytic subunit, beta isozyme [Source:ZFIN;Acc:ZDB-GENE-050417-406])

HSP 1 Score: 129.798 bits (325), Expect = 1.825e-32
Identity = 62/122 (50.82%), Postives = 89/122 (72.95%), Query Frame = 1
Query: 1270 SVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNS 1623
            + AARKEVIRNKIRAIGKMA++F+VLR ESESVL LKGLTP G+LP G L+GG+++L + A++     + + G +P   I SF EAK +D++NER+PPR+D ++ + + + +     T+ NS
Sbjct:  372 ATAARKEVIRNKIRAIGKMAKMFSVLRLESESVLTLKGLTPTGMLPSGVLAGGRQTLQSAAFEAVEAHKAIKGFTPQQKITSFAEAKGLDRINERMPPRKDGVSPDGSPSIVNNSSITDGNS 493          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Yeast
Match: CNA1 (Calcineurin A; one isoform (the other is Cmp2p) of the catalytic subunit of calcineurin, a Ca++/calmodulin-regulated protein phosphatase which regulates Crz1p (a stress-response transcription factor), the other calcineurin subunit is CNB1; regulates the function of Aly1p alpha-arrestin; CNA1 has a paralog, CMP2, that arose from the whole genome duplication [Source:SGD;Acc:S000004425])

HSP 1 Score: 68.1662 bits (165), Expect = 1.534e-12
Identity = 42/90 (46.67%), Postives = 58/90 (64.44%), Query Frame = 1
Query: 1282 RKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPP 1551
            R++ +RNKI AI K++R+F+VLREESE V  LK +   GVLP GAL+ G E L+      ETLS         +FE+A+  D +NE++PP
Sbjct:  454 RRKALRNKILAIAKVSRMFSVLREESEKVEYLKTMNA-GVLPRGALARGTEGLN------ETLS---------TFEKARKEDLINEKLPP 527          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Yeast
Match: CMP2 (Calcineurin A; one isoform (the other is Cna1p) of the catalytic subunit of calcineurin, a Ca++/calmodulin-regulated protein phosphatase which regulates Crz1p (a stress-response transcription factor), the other calcineurin subunit is CNB1; regulates the function of Aly1p alpha-arrestin; CMP2 has a paralog, CNA1, that arose from the whole genome duplication [Source:SGD;Acc:S000004521])

HSP 1 Score: 62.003 bits (149), Expect = 1.409e-10
Identity = 39/105 (37.14%), Postives = 59/105 (56.19%), Query Frame = 1
Query: 1282 RKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIY 1596
            R++ +RNKI A+ K++R+++VLREE+  V  LK    +GVLP GALS G + L               +  + +FE A+  D +NE++PP  D +    NEN  Y
Sbjct:  501 RRKALRNKILAVAKVSRMYSVLREETNKVQFLKDHN-SGVLPRGALSNGVKGL---------------DEALSTFERARKHDLINEKLPPSLDEL---KNENKKY 586          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Nematostella
Match: EDO36272 (Serine/threonine-protein phosphatase [Source:UniProtKB/TrEMBL;Acc:A7SJ38])

HSP 1 Score: 127.487 bits (319), Expect = 1.058e-31
Identity = 62/94 (65.96%), Postives = 73/94 (77.66%), Query Frame = 1
Query: 1282 RKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDI 1563
            RKE+IR+KIRAIGKMARVFTVLREESES+LQLKGLTP G LP+G LSGGK+ +         L G  P H I  FEEAK +D+VNER+PPR+D+
Sbjct:  370 RKEIIRSKIRAIGKMARVFTVLREESESILQLKGLTPTGHLPVGLLSGGKQEVQA------ALQGHDPTHKISGFEEAKGLDRVNERMPPRKDM 457          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000006588.3 (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101169815])

HSP 1 Score: 148.288 bits (373), Expect = 5.308e-38
Identity = 73/126 (57.94%), Postives = 91/126 (72.22%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQL----ETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1629
            G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGKE L     +     E + G SP H I SFEEAK +D++NER+PPRRD + ++++ NS+ +   +  N  D
Sbjct:  395 GATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKEKLQNATIEAIEADEAIKGFSPQHKITSFEEAKGLDRINERMPPRRDALPSDASLNSLNKALSSETNGTD 520          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000042449.1 (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101169815])

HSP 1 Score: 147.902 bits (372), Expect = 9.572e-38
Identity = 73/124 (58.87%), Postives = 90/124 (72.58%), Query Frame = 1
Query: 1258 LIGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1629
            L G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGKE L         + G SP H I SFEEAK +D++NER+PPRRD + ++++ NS+ +   +  N  D
Sbjct:  424 LDGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKEKLQNA------IKGFSPQHKITSFEEAKGLDRINERMPPRRDALPSDASLNSLNKALSSETNGTD 541          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Medaka
Match: ENSORLT00000036835.1 (serine/threonine-protein phosphatase 2B catalytic subunit alpha isoform [Source:NCBI gene;Acc:101169815])

HSP 1 Score: 147.902 bits (372), Expect = 1.103e-37
Identity = 73/124 (58.87%), Postives = 90/124 (72.58%), Query Frame = 1
Query: 1258 LIGGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVD 1629
            L G + +ARKEVIRNKIRAIGKMARVF+VLREESESVL LKGLTP G+LP G LSGGKE L         + G SP H I SFEEAK +D++NER+PPRRD + ++++ NS+ +   +  N  D
Sbjct:  443 LDGATASARKEVIRNKIRAIGKMARVFSVLREESESVLTLKGLTPTGMLPSGVLSGGKEKLQNA------IKGFSPQHKITSFEEAKGLDRINERMPPRRDALPSDASLNSLNKALSSETNGTD 560          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Medaka
Match: ppp3ccb (serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform [Source:NCBI gene;Acc:101156706])

HSP 1 Score: 140.584 bits (353), Expect = 1.900e-35
Identity = 67/102 (65.69%), Postives = 82/102 (80.39%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLE---TLSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1560
            GG+ A RKEVIRNKIRAIGKMARVF+VLREE+ESVLQLKGLTP G LPLG LSGG+++L     + E    + G +P H I+SFEEA+ +D++NER+PPRRD
Sbjct:  384 GGAPAVRKEVIRNKIRAIGKMARVFSVLREENESVLQLKGLTPTGTLPLGVLSGGRQTLKHATVEAEEARAIQGFNPQHKIQSFEEARGLDRINERMPPRRD 485          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Medaka
Match: ppp3ccb (serine/threonine-protein phosphatase 2B catalytic subunit gamma isoform [Source:NCBI gene;Acc:101156706])

HSP 1 Score: 137.117 bits (344), Expect = 2.343e-34
Identity = 65/99 (65.66%), Postives = 79/99 (79.80%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1560
            GG+ A RKEVIRNKIRAIGKMARVF+VLR E+ESVLQLKGLTP G LPLG LSGG+++L         + G +P H I+SFEEA+ +D++NER+PPRRD
Sbjct:  372 GGAPAVRKEVIRNKIRAIGKMARVFSVLRSENESVLQLKGLTPTGTLPLGVLSGGRQTLK------HAIQGFNPQHKIQSFEEARGLDRINERMPPRRD 464          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Planmine SMEST
Match: SMESG000064848.1 (SMESG000064848.1)

HSP 1 Score: 243.047 bits (619), Expect = 4.836e-73
Identity = 131/138 (94.93%), Postives = 131/138 (94.93%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFXXXXXXXXHA 1677
            GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT       LSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFRNNSSSSRHA
Sbjct:  383 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFRNNSSSSRHA 514          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Planmine SMEST
Match: SMESG000064848.1 (SMESG000064848.1)

HSP 1 Score: 242.662 bits (618), Expect = 7.666e-73
Identity = 131/138 (94.93%), Postives = 131/138 (94.93%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFXXXXXXXXHA 1677
            GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT       LSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFRNNSSSSRHA
Sbjct:  389 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHT------ALSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNSVDQDINTFRNNSSSSRHA 520          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Planmine SMEST
Match: SMESG000077398.1 (SMESG000077398.1)

HSP 1 Score: 163.31 bits (412), Expect = 1.801e-43
Identity = 82/99 (82.83%), Postives = 89/99 (89.90%), Query Frame = 1
Query: 1264 GGSVAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1560
            G +VAARKEVI+NKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLH+       LSG++PNH I SFEEAKAIDKVNERVPPR++
Sbjct:  383 GTNVAARKEVIKNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHS------ALSGVNPNHRITSFEEAKAIDKVNERVPPRKE 475          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Planmine SMEST
Match: SMESG000077398.1 (SMESG000077398.1)

HSP 1 Score: 161.77 bits (408), Expect = 6.652e-43
Identity = 81/96 (84.38%), Postives = 87/96 (90.62%), Query Frame = 1
Query: 1273 VAARKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRD 1560
            VAARKEVI+NKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLH+       LSG++PNH I SFEEAKAIDKVNERVPPR++
Sbjct:  393 VAARKEVIKNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHS------ALSGVNPNHRITSFEEAKAIDKVNERVPPRKE 482          
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Planmine SMEST
Match: SMESG000012014.1 (SMESG000012014.1)

HSP 1 Score: 138.658 bits (348), Expect = 6.988e-35
Identity = 65/99 (65.66%), Postives = 83/99 (83.84%), Query Frame = 1
Query: 1282 RKEVIRNKIRAIGKMARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLSGISPNHVIRSFEEAKAIDKVNERVPPRRDIITANS 1578
            R++VI+NKIRAIGKMARVFTVLREESES+L+LKGLTPNG+LP+G L+GGK+S+H        ++G+SP+H I+SFEEAK +D+VNER+PPRR     NS
Sbjct:  390 RRDVIKNKIRAIGKMARVFTVLREESESLLELKGLTPNGMLPMGLLTGGKDSIHG------AMTGVSPHHPIQSFEEAKVLDQVNERMPPRRPSYPINS 482          
The following BLAST results are available for this feature:
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP3CA1.833e-4158.59protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CA4.746e-4058.59protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CA3.335e-3958.59protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CA6.192e-3959.68protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CA1.229e-3859.68protein phosphatase 3 catalytic subunit alpha [Sou... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 3
Match NameE-valueIdentityDescription
tax-61.219e-2956.90Serine/threonine-protein phosphatase 2B catalytic ... [more]
tax-62.421e-2755.83Serine/threonine-protein phosphatase 2B catalytic ... [more]
tax-62.757e-2755.83Serine/threonine-protein phosphatase 2B catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Pp2B-14D7.443e-3673.96gene:FBgn0011826 transcript:FBtr0305593[more]
Pp2B-14D7.443e-3673.96gene:FBgn0011826 transcript:FBtr0309793[more]
Pp2B-14D7.443e-3673.96gene:FBgn0011826 transcript:FBtr0074294[more]
CanA-14F8.035e-3669.90gene:FBgn0267912 transcript:FBtr0305198[more]
CanA-14F8.035e-3669.90gene:FBgn0267912 transcript:FBtr0074292[more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ppp3ccb2.247e-3761.95protein phosphatase 3, catalytic subunit, gamma is... [more]
ppp3ccb1.071e-3560.36protein phosphatase 3, catalytic subunit, gamma is... [more]
ppp3cb2.278e-3452.99protein phosphatase 3, catalytic subunit, beta iso... [more]
ppp3cca3.182e-3464.71protein phosphatase 3, catalytic subunit, gamma is... [more]
ppp3cca4.092e-3464.71protein phosphatase 3, catalytic subunit, gamma is... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rai14.397e-3960.00retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
rai18.018e-3959.68retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
rai18.092e-3959.68retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
rai19.133e-3959.68retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
rai11.018e-3859.68retinoic acid induced 1 [Source:Xenbase;Acc:XB-GEN... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Ppp3ca2.380e-3958.59protein phosphatase 3, catalytic subunit, alpha is... [more]
Ppp3ca8.601e-3959.68protein phosphatase 3, catalytic subunit, alpha is... [more]
Ppp3cb6.422e-3456.56protein phosphatase 3, catalytic subunit, beta iso... [more]
Ppp3cb6.568e-3459.48protein phosphatase 3, catalytic subunit, beta iso... [more]
Ppp3cb7.855e-3457.50protein phosphatase 3, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P48452|PP2BA_BOVIN1.586e-3858.59Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|Q08209|PP2BA_HUMAN1.601e-3858.59Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|P63329|PP2BA_RAT1.665e-3858.59Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|P63328|PP2BA_MOUSE1.665e-3858.59Serine/threonine-protein phosphatase 2B catalytic ... [more]
sp|Q27889|PP2B2_DROME7.461e-3573.96Serine/threonine-protein phosphatase 2B catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5K3ERR85.155e-4463.31Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A212CLQ22.256e-4058.59PPP3CA OS=Cervus elaphus hippelaphus OX=46360 GN=C... [more]
A0A5K3EQ993.072e-4073.15Uncharacterized protein OS=Mesocestoides corti OX=... [more]
A0A553MWZ74.705e-4055.81Uncharacterized protein OS=Danionella translucida ... [more]
A0A485NQE92.124e-3958.59Serine threonine-protein phosphatase 2b catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PPP3CA5.989e-3756.35protein phosphatase 3 catalytic subunit alpha [Sou... [more]
PPP3CA6.381e-3756.35protein phosphatase 3 catalytic subunit alpha [Sou... [more]
ppp3ccb2.171e-3661.82serine/threonine-protein phosphatase 2B catalytic ... [more]
PPP3CA2.394e-3657.38protein phosphatase 3 catalytic subunit alpha [Sou... [more]
ppp3ccb1.846e-3561.82serine/threonine-protein phosphatase 2B catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ppp3cb1.825e-3250.82protein phosphatase 3, catalytic subunit, beta iso... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 2
Match NameE-valueIdentityDescription
CNA11.534e-1246.67Calcineurin A; one isoform (the other is Cmp2p) of... [more]
CMP21.409e-1037.14Calcineurin A; one isoform (the other is Cna1p) of... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO362721.058e-3165.96Serine/threonine-protein phosphatase [Source:UniP... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000006588.35.308e-3857.94serine/threonine-protein phosphatase 2B catalytic ... [more]
ENSORLT00000042449.19.572e-3858.87serine/threonine-protein phosphatase 2B catalytic ... [more]
ENSORLT00000036835.11.103e-3758.87serine/threonine-protein phosphatase 2B catalytic ... [more]
ppp3ccb1.900e-3565.69serine/threonine-protein phosphatase 2B catalytic ... [more]
ppp3ccb2.343e-3465.66serine/threonine-protein phosphatase 2B catalytic ... [more]
back to top
BLAST of Serine/threonine-protein phosphatase 2B catalytic subunit vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000064848.14.836e-7394.93SMESG000064848.1[more]
SMESG000064848.17.666e-7394.93SMESG000064848.1[more]
SMESG000077398.11.801e-4382.83SMESG000077398.1[more]
SMESG000077398.16.652e-4384.38SMESG000077398.1[more]
SMESG000012014.16.988e-3565.66SMESG000012014.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023540 ID=SMED30023540|Name=Serine/threonine-protein phosphatase 2B catalytic subunit|organism=Schmidtea mediterranea sexual|type=transcript|length=1745bp
ATTCAATTGAGTTTTTAATTTTTGTAAATTTTTGAAATTGTCTTTATGCG
CGAGTTTTCCTTTGAATTCGCATTTGATAGAACAAAATGTTATAAGTAGA
GCAGAAATGATGCTGCTGAAATTACTTTGATAAGCATACTTGAACGATTA
GTTTGAAAATGAAAAAGCAAACCCGGAATAATAACAAAATTGTTTGATAT
GCAAAAAATTACGTTGGAAAAAGTGAAAGAGATTGAGGAAAACCACGTAT
TTGAAGAGTTACTTGTACTTGGAGATTCAGAAGCACTAGAAAAAGTAAGT
AAGTGGTATGAATGATTATGGTTGTGACAAGGATTTATACTATAATGTTG
GTAAACTTGATGACTCAGTAAATTCACGACACTTGATCCAAAAACAGTTA
ATCCCATGGACATCTAGTTCTTAACACATTTAATATTCACCTCCGTGGGT
ATTCTGAGACTCCCTACGTTGTTAGTTTCGCTTTGAAATGGAATTTCACG
TTTATGTGTATATACATATGATCGTTCCATTTGCATTTTCACGAATCTTT
CAATTTTAGAAACATCTTTGAAGTGATATCTTATTTTCTTTAGTAGTTTC
TCTTAACGCCAAAGCTATATTTCTAATCGAATGAACTTTCACAACTAGTA
CTGGTATCCGGGATTAACTCGCTAGAATAAGTTTACGCGTACCAAAGTAA
GAACGCTTTTCTAGATTATGAAAAAGATTCCATAATGCAGATCTTTAAAA
CTTAATTAAACTTTTCAAAAAAAATTTTTCAATAAATCACCATTTTTGTT
GAATAATTCAATTAATAGAGATTTTATTATAATTGAGAAACCATGACATA
CATAAATAAATTTTTTTAATATTCTAATTAAATTATGAATTAAAATTATT
CAAACTTATCATTTACCAGGCAATTTATGAAATGGCGCCCCTCATACCCA
TGACATCTGGATATTATTTAAAATCCAAGTGTCGAATTTTCCAGCTATTA
TTAAGATATTTTCATTTTTATAGAAATTCTTAAAAATATTTTTTGCTTAA
AATTTGATTGGTTAGATAGTCAATTAGCATAACTCTGTGAATGATGCTTG
ATTGATAAAATCATTGTTATGCTATTCTGTATTTTAATAGATTTTGTAAA
CAAATTACCCCTAGAAATATTTACTAATAATCCTTTTTGAGATTTCGTTT
TTAAATGATTAAAATATTGTTTAAATTCTTTCTCTATTTTATGGTTAATC
TTTATTTCTAATAGGTGGCAGCGTCGCAGCCAGAAAGGAAGTAATCAGAA
ATAAAATCCGAGCAATTGGAAAGATGGCTCGGGTATTTACTGTGCTAAGA
GAAGAGAGCGAATCTGTTTTACAATTAAAAGGTTTAACTCCTAATGGAGT
ATTGCCTTTAGGTGCTTTATCAGGAGGAAAGGAATCTCTTCATACTGTGG
CATATCAACTGGAAACTCTTTCTGGAATATCACCAAATCACGTAATTCGA
TCATTTGAAGAAGCAAAGGCAATTGATAAAGTCAACGAAAGAGTGCCTCC
GAGGCGCGACATCATCACAGCGAATAGCAATGAGAACTCGATCTACCGCC
ATCAGCAAACCAATAACAATTCTGTGGATCAAGATATTAATACTTTCAGA
AATAACTCGTCTTCAAGTCGGCATGCATAATAATACTTGCAAAATCCAAA
ATTTATTATTATCATCTTCAATATCGATATTATTATTATTATTAT
back to top

protein sequence of SMED30023540-orf-1

>SMED30023540-orf-1 ID=SMED30023540-orf-1|Name=SMED30023540-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=119bp
MARVFTVLREESESVLQLKGLTPNGVLPLGALSGGKESLHTVAYQLETLS
GISPNHVIRSFEEAKAIDKVNERVPPRRDIITANSNENSIYRHQQTNNNS
VDQDINTFRNNSSSSRHA*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR029052Metallo-depent_PP-like
Vocabulary: molecular function
TermDefinition
GO:0004721phosphoprotein phosphatase activity
GO:0016787hydrolase activity
Vocabulary: biological process
TermDefinition
GO:0006470protein dephosphorylation
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 84..118
NoneNo IPR availablePANTHERPTHR45673FAMILY NOT NAMEDcoord: 1..106
NoneNo IPR availablePANTHERPTHR45673:SF5SERINE/THREONINE-PROTEIN PHOSPHATASE 2B CATALYTIC SUBUNIT ALPHA ISOFORMcoord: 1..106