Si:dkey-12j5.1

Overview
NameSi:dkey-12j5.1
Smed IDSMED30023538
Length (bp)3224
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Si:dkey-12j5.1 (SMED30023538) t-SNE clustered cells

Violin plots show distribution of expression levels for Si:dkey-12j5.1 (SMED30023538) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Si:dkey-12j5.1 (SMED30023538) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Si:dkey-12j5.1 (SMED30023538) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023538

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023538SMESG000041594.1 dd_Smed_v4_438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gutSMED30023538SMESG000041594.1 dd_Smed_v4_438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023538SMESG000041594.1 dd_Smed_v4_438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023538SMESG000041594.1 dd_Smed_v4_438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023538SMESG000041594.1 dd_Smed_v4_438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023538SMESG000041594.1 dd_Smed_v4_438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023538SMESG000041594.1 dd_Smed_v4_438_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023538SMESG000041594.1 Contig23445uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023538SMESG000041594.1 Contig23445newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Si:dkey-12j5.1 vs. Ensembl Zebrafish
Match: si:dkey-12j5.1 (si:dkey-12j5.1 [Source:ZFIN;Acc:ZDB-GENE-100922-71])

HSP 1 Score: 99.7525 bits (247), Expect = 1.383e-21
Identity = 62/199 (31.16%), Postives = 106/199 (53.27%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILFKP---------TKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLP 580
            ++  L+ K  E ++N D + A +  +  L  +  N   L++MG I  EL  +E+AK  + K++E    + H  ++YLGQ++ G E+ +YF   I++ML  +    ++   F           TK DVS A+ S+ E++ TDLC ++ A   C E + KA++ DE NP A Q  A+      + +  +E ++KS+  WLP
Sbjct:   49 TVGQLLQKTEESVDNFDFDMARLYCQRALDIEPTNLTILDMMGSICSELGDVEKAKQVYLKAVELSPEEGHSKYMYLGQIHTGMEAVQYFSKGIEIMLNTMDKHGNEAGAFGAAAIPSEGPVTKKDVSVAFCSIAEIFFTDLCMEEAAADRCKEAIDKALQYDENNPEALQLMASYLFSIEKTEEGREYLKKSVSSWLP 247          
BLAST of Si:dkey-12j5.1 vs. Ensembl Zebrafish
Match: si:dkey-12j5.1 (si:dkey-12j5.1 [Source:ZFIN;Acc:ZDB-GENE-100922-71])

HSP 1 Score: 57.7658 bits (138), Expect = 2.518e-8
Identity = 30/77 (38.96%), Postives = 46/77 (59.74%), Query Frame = 2
Query:  350 TKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLP 580
            TK DVS A+ S+ E++ TDLC ++ A   C E + KA++ DE NP A Q  A+      + +  +E ++KS+  WLP
Sbjct:   72 TKKDVSVAFCSIAEIFFTDLCMEEAAADRCKEAIDKALQYDENNPEALQLMASYLFSIEKTEEGREYLKKSVSSWLP 148          
BLAST of Si:dkey-12j5.1 vs. Ensembl Xenopus
Match: ENSXETT00000001831.1 (probable assembly chaperone of rpl4 [Source:NCBI gene;Acc:100488559])

HSP 1 Score: 107.457 bits (267), Expect = 3.430e-24
Identity = 85/268 (31.72%), Postives = 134/268 (50.00%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILFKP---------TKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALV 787
            ++  L+ K  E+++N +   A +  +  L  D  N   L++MG I +EL   E+AK  F K++E      H  ++ LGQ++  EE+  YF   I++ML   +A  S+  L K          T  D++ A+ S+ E+Y TDLC +++A   C E L+KA+E D  +  A Q  A+     ++ Q  KE + KS+  WLP   K  +     D T E   +     + R+  A++L E E    A  VL+ +L EDDE  Q  YL+  V
Sbjct:   52 TVHQLLEKTEEYLDNFNYEMAQLFCQRALDMDPTNLDILDMMGNICMELGHAEKAKQVFLKAVELCPDKGHAKYMCLGQIHCKEEALHYFNKGIEIML---SAYQSQPALAKAAGFPDEIEVTTKDIAAAFCSVAEIYFTDLCMEEEAGEKCKEILQKALEYDPNSSEALQLMASYLFSMDQPQEGKEYLMKSLASWLPSMQKKEAEMQG-DGTEEPTESALPPYESRITTAKLLTEAEEFELASEVLEALLEEDDEVVQVWYLLGWV 315          
BLAST of Si:dkey-12j5.1 vs. Ensembl Xenopus
Match: ENSXETT00000001893.1 (probable assembly chaperone of rpl4 [Source:NCBI gene;Acc:100488559])

HSP 1 Score: 107.071 bits (266), Expect = 5.362e-24
Identity = 85/268 (31.72%), Postives = 134/268 (50.00%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILFKP---------TKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALV 787
            ++  L+ K  E+++N +   A +  +  L  D  N   L++MG I +EL   E+AK  F K++E      H  ++ LGQ++  EE+  YF   I++ML   +A  S+  L K          T  D++ A+ S+ E+Y TDLC +++A   C E L+KA+E D  +  A Q  A+     ++ Q  KE + KS+  WLP   K  +     D T E   +     + R+  A++L E E    A  VL+ +L EDDE  Q  YL+  V
Sbjct:   52 TVHQLLEKTEEYLDNFNYEMAQLFCQRALDMDPTNLDILDMMGNICMELGHAEKAKQVFLKAVELCPDKGHAKYMCLGQIHCKEEALHYFNKGIEIML---SAYQSQPALAKAAGFPDEIEVTTKDIAAAFCSVAEIYFTDLCMEEEAGEKCKEILQKALEYDPNSSEALQLMASYLFSMDQPQEGKEYLMKSLASWLPSMQKKEAEMQG-DGTEEPTESALPPYESRITTAKLLTEAEEFELASEVLEALLEEDDEVVQVWYLLGWV 315          
BLAST of Si:dkey-12j5.1 vs. Ensembl Xenopus
Match: ENSXETT00000001963.1 (probable assembly chaperone of rpl4 [Source:NCBI gene;Acc:100488559])

HSP 1 Score: 99.7525 bits (247), Expect = 1.221e-21
Identity = 83/268 (30.97%), Postives = 132/268 (49.25%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILFKP---------TKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALV 787
            ++  L+ K  E+++N +   A +  +  L  D  N   L++MG I +EL   E+    F K++E      H  ++ LGQ++  EE+  YF   I++ML   +A  S+  L K          T  D++ A+ S+ E+Y TDLC +++A   C E L+KA+E D  +  A Q  A+     ++ Q  KE + KS+  WLP   K  +     D T E   +     + R+  A++L E E    A  VL+ +L EDDE  Q  YL+  V
Sbjct:   40 TVHQLLEKTEEYLDNFNYEMAQLFCQRALDMDPTNLDILDMMGNICMELGHAEKV---FLKAVELCPDKGHAKYMCLGQIHCKEEALHYFNKGIEIML---SAYQSQPALAKAAGFPDEIEVTTKDIAAAFCSVAEIYFTDLCMEEEAGEKCKEILQKALEYDPNSSEALQLMASYLFSMDQPQEGKEYLMKSLASWLPSMQKKEAEMQG-DGTEEPTESALPPYESRITTAKLLTEAEEFELASEVLEALLEEDDEVVQVWYLLGWV 300          
BLAST of Si:dkey-12j5.1 vs. Ensembl Xenopus
Match: ENSXETT00000001919.1 (probable assembly chaperone of rpl4 [Source:NCBI gene;Acc:100488559])

HSP 1 Score: 93.2041 bits (230), Expect = 1.965e-19
Identity = 81/268 (30.22%), Postives = 127/268 (47.39%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILFKP---------TKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALV 787
            ++  L+ K  E+++N +   A +  +  L  D  N   L++MG I +EL   E+AK  F K++E      H  ++ LGQ++  EE+  YF   I++ML   +A  S+  L K          T  D++ A+ S+ E+Y TDLC +++A   C E L+KA+E D  +  A Q  A+     ++ Q  KE + KS+  WLP   K                     A+++    E   EL     A  VL+ +L EDDE  Q  YL+  V
Sbjct:   52 TVHQLLEKTEEYLDNFNYEMAQLFCQRALDMDPTNLDILDMMGNICMELGHAEKAKQVFLKAVELCPDKGHAKYMCLGQIHCKEEALHYFNKGIEIML---SAYQSQPALAKAAGFPDEIEVTTKDIAAAFCSVAEIYFTDLCMEEEAGEKCKEILQKALEYDPNSSEALQLMASYLFSMDQPQEGKEYLMKSLASWLPSMQKK-------------------EAEMQGDGTEEPTEL-----ASEVLEALLEEDDEVVQVWYLLGWV 292          
BLAST of Si:dkey-12j5.1 vs. UniProt/SwissProt
Match: sp|Q1MTN8|ACL4_SCHPO (Probable assembly chaperone of rpl4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC16D10.01c PE=3 SV=2)

HSP 1 Score: 85.5001 bits (210), Expect = 2.437e-16
Identity = 74/261 (28.35%), Postives = 135/261 (51.72%), Query Frame = 2
Query:   26 IIKAHEHIENADLNEAMVIGKEILAKDC-DNKKGLEIMGYILLELNLMEEAKFCF------SKSIENDSGDSHVPHLYLGQLND-GEESEKYFLSAIDMMLKNLTADDSKKILFKPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDL-SADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMA 781
            +++  E +   + +EA+++ K+   K   ++ +  E++G +  EL  +++A+  F      SK++ ND G  +  +L+L Q+ND G ++ K +   +  +L+ L  D  +    K     +  AY S+ EL+MTDLC + DAE  C  Y K A+++D  N  A Q+ A++ + + +I+ AK+++ K         L+ IS A TED       + DL +  +R     +L E+E+  EA  +L  +  EDD+     YL+ 
Sbjct:    8 LLEIREKLVKDETSEALILAKKAADKSPKEDGRAFELLGEVYAELADVKKARSAFKEAVSRSKNLTNDQG--YEKYLWLAQINDNGSKALKLYQKGV-TILERLLIDKGEDADLKKK---IQGAYCSIAELFMTDLCMQPDAEENCELYTKLALQIDATNAEALQTLASMRISQQKIEEAKDALSK--------CLQSISRAATED-------SVDLPTYAVRTSIVRLLIEVEMHEEAHQLLVYLQKEDDQILDIWYLLG 247          
BLAST of Si:dkey-12j5.1 vs. TrEMBL
Match: V5I581 (TPR_REGION domain-containing protein OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 140.584 bits (353), Expect = 2.665e-32
Identity = 82/264 (31.06%), Postives = 147/264 (55.68%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILFKPT-----KLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALV 787
            S+Q+L+      ++    ++A  +G+  L  + DN K L+++  +LLE+  +  A     + IE +  D    +L +GQL DG+ES +++   ++++ + L           P        ++S+AY ++ E+YMTD C ++DAE  C+E ++K +  D  NP A Q  A+  L+K + + A++++R+S+DLWLP+  ++      ED   + +  C LS   RV CA++L ELE++ EA +VLD ++ EDDE     YL+  +
Sbjct:   30 SVQELLSMVESAMDELQFDQARQLGERALRLEPDNLKTLDVLSGLLLEMGDVAGASQLLQRMIELEPNDGFRKYLSMGQLCDGKESLRHYSKGVEILQRLLGERQGASAEADPEGSGHLSRELSSAYCAMAEIYMTDCCFEEDAETQCAELIEKGLAADPKNPEALQCQASYLLVKQDTEGAQQAMRRSLDLWLPQHERLCQGNQGEDDGQDPVEVCPLSYSCRVSCAKVLIELEMMDEANAVLDGLVEEDDEVVDVWYLLGWL 293          
BLAST of Si:dkey-12j5.1 vs. TrEMBL
Match: A0A131XBZ1 (Putative rna polymerase iii transcription factor tfiiic OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 4.562e-32
Identity = 83/264 (31.44%), Postives = 149/264 (56.44%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLT-----ADDSKKILFKPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALV 787
            S+ DL+ +    +     ++A  +G+  L  + +N K L+    +LLE+    +A     + ++ + G  +  +L LGQL D +ES  ++   ++++ K L      A  S++         +S+AY ++ E+YMTD CD++DAE  CSE+++K+++ D  NP A+Q  A   L+K E ++AKE++++S+DLWLP+  +++   D    +N+ +  C LS   RV  A++L ELE+  EA +VLD ++ EDD      YL+  +
Sbjct:   29 SVDDLLSQMESCVNELQYDQARELGESALRVEPNNLKVLDAFSSLLLEMGDSTKALELLQRMVQLEPGGGYRKYLSLGQLTDSKESLSHYAKGVEILCKLLQEQHDLAAGSEERSGADLNRALSSAYCAMAEIYMTDCCDEEDAEQQCSEFVQKSIQADPSNPEAFQVQANFLLVKQEHEAAKEAMQRSLDLWLPQHERLLLGEDA--GSNDPVEVCPLSYSSRVNGAKVLIELEMFDEANTVLDGLVEEDDGVVDVWYLLGWL 290          
BLAST of Si:dkey-12j5.1 vs. TrEMBL
Match: K1QAY6 (UPF0661 TPR repeat-containing protein C16D10.01c OS=Crassostrea gigas OX=29159 GN=CGI_10011517 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 4.681e-32
Identity = 83/230 (36.09%), Postives = 128/230 (55.65%), Query Frame = 2
Query:  110 DNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILF------KPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMA 781
            DN + LE  G +LLEL   E AK CF +++E +    H  ++YLGQL +G E+ ++F   I++M+K   A  ++++        K +  D+S AY SL E+YMTD CD+ +AE  C   + KA+E D  NP A+Q  A+ +L K   Q A   I+KS  LWLP   + +      D  ++ +    LS D RV  A+IL E+E    A +VL+ +L E+++  Q  Y++ 
Sbjct:   65 DNIRALETAGSLLLELGDTEAAKQCFGRAVEVNPDTGHSKYMYLGQLFEGAEAIQFFQKGIELMVKEREAQSAQELAAACGGEEKISGRDISTAYCSLAEIYMTDCCDEPNAESECETAINKAIEADGENPEAYQLKASFYLSKENKQEALSMIKKSASLWLPH-YQAVDQDKITDEESDPVEVVPLSYDARVTTAKILIEVEEFETAVTVLEGLLDENEDDPQIWYMIG 293          
BLAST of Si:dkey-12j5.1 vs. TrEMBL
Match: A0A224Z167 (TPR_REGION domain-containing protein OS=Rhipicephalus zambeziensis OX=60191 PE=4 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 6.291e-32
Identity = 85/267 (31.84%), Postives = 149/267 (55.81%), Query Frame = 2
Query:    2 SDLSIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLT-----ADDSKKILFKPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALV 787
            ++ S+ DL+ +    +     ++A   G+  L  + +N K L+ +  +LLE+     A     + ++ D    +  +L LGQL DG+ES  ++   + ++ K L      A  S++         +S+AY ++ E+YMTD CD++DAE  CSE+++K+++ D  NP A+Q  A   L+K E ++AKE++++S+DLWLP+  +++   D     N+ +  C LS   RV  A++L ELE+L EA +VLD ++ EDD      YL+  +
Sbjct:   27 AECSVDDLLSQMESCVNELQYDQAREFGESALRMEPNNLKVLDALSSLLLEMADPASALELLQRMVQLDPDGGYRKYLSLGQLTDGKESLAHYAKGVQILCKLLQEHQGLAAASEESSGADLNRALSSAYCAMAEIYMTDCCDEEDAEQQCSEFVQKSIQADPRNPEAFQVQANFLLVKQEHEAAKEAMQRSLDLWLPQHERLLLGEDA--GNNDPVEVCPLSYSSRVNGAKVLIELEMLDEANTVLDGLIEEDDGVVDVWYLLGWL 291          
BLAST of Si:dkey-12j5.1 vs. TrEMBL
Match: A0A131XXB3 (TPR_REGION domain-containing protein OS=Ixodes ricinus OX=34613 PE=2 SV=1)

HSP 1 Score: 139.428 bits (350), Expect = 6.367e-32
Identity = 82/264 (31.06%), Postives = 146/264 (55.30%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILFKPT-----KLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALV 787
            S+Q+L+      ++    ++A  +G+  L  + DN K L+++  +LLE+  +  A     + IE +  D    +L +GQL DG+ES +++   ++++ + L           P        ++S AY ++ E+YMTD C ++DAE  C+E ++K +  D  NP A Q  A+  L+K + + A++++R+S+DLWLP+  ++      ED   + +  C LS   RV CA++L ELE++ EA +VLD ++ EDDE     YL+  +
Sbjct:   31 SVQELLSMVESAMDELQFDQARQLGERALRLEPDNLKTLDVLSGLLLEMGDVAGASQLLQRMIELEPNDGFRKYLSMGQLCDGKESLRHYSKGVEILQRLLGERQGASAEADPEGGGHLSRELSCAYCAMAEIYMTDCCFEEDAETQCAELIEKGLAADPKNPEALQCQASYLLVKQDTEGAQQAMRRSLDLWLPQHERLCQGNQGEDDGQDPVEVCPLSYSCRVSCAKVLIELEMMDEANAVLDGLVEEDDEVVDVWYLLGWL 294          
BLAST of Si:dkey-12j5.1 vs. Ensembl Cavefish
Match: si:dkey-12j5.1 (probable assembly chaperone of rpl4 [Source:NCBI gene;Acc:103030569])

HSP 1 Score: 102.834 bits (255), Expect = 9.978e-23
Identity = 79/275 (28.73%), Postives = 136/275 (49.45%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNL-----TADD--SKKILFKPT--KLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLP------EALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALVI 790
            ++  L+ K  E ++N D   A +  +  L  +  N   L ++G I  EL  +++AK  F K++E    + H  ++YLGQ++ G E+ +YF   I +ML  +      A D  +  +  +P+    DVS A+ S+ E++ TDLC ++ A   C E ++KA+  D+ NP A Q  A+     +  +  ++ + KS+  WLP      E+   +   + E+  N I        + R+  A++L E E    A  VL+ +L EDDE  Q  YL+  + 
Sbjct:   49 TVDQLLEKTEESMDNFDFPMAKMFCQRALDMEPTNLSVLNMLGNICAELGDVDKAKQVFLKAVELSPEEGHSKYMYLGQIHAGMEAVQYFSKGIKVMLNAIDKQAQEAGDMGAAAMPSEPSISAKDVSVAFCSIAEIFFTDLCMEEGAAEKCKEAIEKALHYDQHNPEALQLMASYLFSIDNTEEGRDYLIKSVSSWLPSLQKEEESSACVEQPEDEEPQNSIPPY-----ESRITTAKLLIEAEEFEMATEVLEGLLEEDDEVVQVWYLLGWLF 318          
BLAST of Si:dkey-12j5.1 vs. Ensembl Cavefish
Match: si:dkey-12j5.1 (probable assembly chaperone of rpl4 [Source:NCBI gene;Acc:103030569])

HSP 1 Score: 85.5001 bits (210), Expect = 4.692e-17
Identity = 59/199 (29.65%), Postives = 104/199 (52.26%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNL-----TADD--SKKILFKPT--KLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLP 580
            ++  L+ K  E ++N D   A +  +  L  +  N   L ++G I  EL  +++AK  F K++E    + H  ++YLGQ++ G E+ +YF   I +ML  +      A D  +  +  +P+    DVS A+ S+ E++ TDLC ++ A   C E ++KA+  D+ NP A Q  A+     +  +  ++ + KS+  WLP
Sbjct:   49 TVDQLLEKTEESMDNFDFPMAKMFCQRALDMEPTNLSVLNMLGNICAELGDVDKAKQVFLKAVELSPEEGHSKYMYLGQIHAGMEAVQYFSKGIKVMLNAIDKQAQEAGDMGAAAMPSEPSISAKDVSVAFCSIAEIFFTDLCMEEGAAEKCKEAIEKALHYDQHNPEALQLMASYLFSIDNTEEGRDYLIKSVSSWLP 247          
BLAST of Si:dkey-12j5.1 vs. Ensembl Cavefish
Match: si:dkey-12j5.1 (probable assembly chaperone of rpl4 [Source:NCBI gene;Acc:103030569])

HSP 1 Score: 69.707 bits (169), Expect = 3.198e-12
Identity = 46/150 (30.67%), Postives = 75/150 (50.00%), Query Frame = 2
Query:  359 DVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLP------EALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALVI 790
            DVS A+ S+ E++ TDLC ++ A   C E ++KA+  D+ NP A Q  A+     +  +  ++ + KS+  WLP      E+   +   + E+  N I        + R+  A++L E E    A  VL+ +L EDDE  Q  YL+  + 
Sbjct:   73 DVSVAFCSIAEIFFTDLCMEEGAAEKCKEAIEKALHYDQHNPEALQLMASYLFSIDNTEEGRDYLIKSVSSWLPSLQKEEESSACVEQPEDEEPQNSIPPY-----ESRITTAKLLIEAEEFEMATEVLEGLLEEDDEVVQVWYLLGWLF 217          
BLAST of Si:dkey-12j5.1 vs. Ensembl Sea Lamprey
Match: si:dkey-12j5.1 (si:dkey-12j5.1 [Source:ZFIN;Acc:ZDB-GENE-100922-71])

HSP 1 Score: 113.62 bits (283), Expect = 1.881e-27
Identity = 75/265 (28.30%), Postives = 140/265 (52.83%), Query Frame = 2
Query:    2 SDLSIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILFKPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLP---EALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALV 787
            S  +++ L+ KA E  ++ ++  A +  +  L  + D+ +GL++ G +  EL  +++A+   S+++E    + H  ++YLGQL+ G ++  +F   +++M + L A  ++  +      DVS AY S+ E+Y+TDLC ++ +   C + L +A+E D  NP A Q  A+      + Q  K  + +S+  WLP   +  +  +  +  D   E++A      + R+  A++L E+E    A  VL+ +L EDDE  Q  YL+  V
Sbjct:   35 SKYTVEQLLEKAGECADSCNVELAAMFCQRALEMEPDHLQGLDMAGSLQAELGNVDKAQRISSRAVELSPDEGHAKYMYLGQLSTGADAVGFFSKGVEIMARTLQAQPAQAAV-----RDVSAAYCSIAEIYLTDLCMEEGSSERCKQTLGQALEADSSNPEALQLMASYLFSTEQPQEGKVYLLQSLSAWLPSRQQGQEAENRTEAPDDATEMLAQLP-PYESRISTAKLLSEVEEYELASDVLEGLLEEDDEVVQVWYLLGWV 293          
BLAST of Si:dkey-12j5.1 vs. Ensembl Nematostella
Match: EDO43571 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RY37])

HSP 1 Score: 109.383 bits (272), Expect = 9.764e-26
Identity = 80/259 (30.89%), Postives = 134/259 (51.74%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILFKPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALV 787
            +++DL++K  E +   +   A    +  L  D D+ + +E+ G + LE    E+A  CF ++I+    + +  ++ +GQ+  G+E+ + F   I +M    +      +   P   D+S AY SL E+Y+TD C  D+AEI CSEY +KA+E D  NP A+Q  A   L + +I+  K+ + K +DLWL            +D   E+        + R+  A++L ELE   +A  VL T+L E+DE  +  YL+ L+
Sbjct:   50 TMKDLLVKVEECMGAMNYELAEKFCERALEIDPDHVEAIEMAGSVFLETGQPEKAVNCFRRAIQLSPDEGYSKYMSIGQMLQGKEAAEVFTKGIQLMT---SPQGGASLSVSPK--DISAAYCSLAEIYLTDECFDDEAEIKCSEYCQKAIEADPTNPEAYQVMANCLLSRQKIEEGKKVLSKGLDLWL----------GKDDDLQEVPMP---HFEARITTAKLLLELEDFEKAAQVLQTLLEENDEELEVWYLLGLM 290          
BLAST of Si:dkey-12j5.1 vs. Ensembl Medaka
Match: si:dkey-12j5.1 (probable assembly chaperone of rpl4 [Source:NCBI gene;Acc:101165000])

HSP 1 Score: 108.997 bits (271), Expect = 9.164e-25
Identity = 82/282 (29.08%), Postives = 141/282 (50.00%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILF----------KPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLP-EALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALVIEKIVETSEENK 823
            S++ L+ K  E++++ D   A +  +  L  D +N + L++ G+I  EL   ++AK  F +++E    + H  ++YLGQ++ G E+  Y+   I ++L  L   ++ +              P++ DVS AY S+ E+Y+TDLC ++ A   C E ++ A++    NP A Q  A+        Q  KE + KS+  WLP +     S++  ED   +I        + R+  A++L E E    A  VL+ +L EDDE  Q  YL   V    +E ++E +
Sbjct:   37 SVEQLLEKTEEYMDSFDFEMAGLFCQRALDVDPNNLQALDMQGHICSELGDTQKAKGVFLRAVELSPDEGHSKYMYLGQIHTGLEAVGYYTKGIQVLLSTLEKQETAQAGAAAAATVEDKEPPSEKDVSVAYCSIAEIYLTDLCMEEGAADKCRESIEMALKYQHDNPEALQLMASYLFSTERNQEGKEYLLKSVGTWLPAQKQSTSSSSTEEDVQKDIPPY-----ESRITTAKLLMECEEYEMAVDVLEGLLEEDDEVVQVWYLSGWVCYLQLEKAKEQQ 313          
BLAST of Si:dkey-12j5.1 vs. Ensembl Medaka
Match: si:dkey-12j5.1 (probable assembly chaperone of rpl4 [Source:NCBI gene;Acc:101165000])

HSP 1 Score: 108.997 bits (271), Expect = 1.145e-24
Identity = 82/282 (29.08%), Postives = 141/282 (50.00%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILF----------KPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLP-EALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALVIEKIVETSEENK 823
            S++ L+ K  E++++ D   A +  +  L  D +N + L++ G+I  EL   ++AK  F +++E    + H  ++YLGQ++ G E+  Y+   I ++L  L   ++ +              P++ DVS AY S+ E+Y+TDLC ++ A   C E ++ A++    NP A Q  A+        Q  KE + KS+  WLP +     S++  ED   +I        + R+  A++L E E    A  VL+ +L EDDE  Q  YL   V    +E ++E +
Sbjct:   55 SVEQLLEKTEEYMDSFDFEMAGLFCQRALDVDPNNLQALDMQGHICSELGDTQKAKGVFLRAVELSPDEGHSKYMYLGQIHTGLEAVGYYTKGIQVLLSTLEKQETAQAGAAAAATVEDKEPPSEKDVSVAYCSIAEIYLTDLCMEEGAADKCRESIEMALKYQHDNPEALQLMASYLFSTERNQEGKEYLLKSVGTWLPAQKQSTSSSSTEEDVQKDIPPY-----ESRITTAKLLMECEEYEMAVDVLEGLLEEDDEVVQVWYLSGWVCYLQLEKAKEQQ 331          
BLAST of Si:dkey-12j5.1 vs. Ensembl Medaka
Match: si:dkey-12j5.1 (probable assembly chaperone of rpl4 [Source:NCBI gene;Acc:101165000])

HSP 1 Score: 91.2781 bits (225), Expect = 8.692e-19
Identity = 59/206 (28.64%), Postives = 104/206 (50.49%), Query Frame = 2
Query:   11 SIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAK------FCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILF----------KPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLP 580
            S++ L+ K  E++++ D   A +  +  L  D +N + L++ G+I  EL   ++AK        F +++E    + H  ++YLGQ++ G E+  Y+   I ++L  L   ++ +              P++ DVS AY S+ E+Y+TDLC ++ A   C E ++ A++    NP A Q  A+        Q  KE + KS+  WLP
Sbjct:   51 SVEQLLEKTEEYMDSFDFEMAGLFCQRALDVDPNNLQALDMQGHICSELGDTQKAKGISYHFLFFLRAVELSPDEGHSKYMYLGQIHTGLEAVGYYTKGIQVLLSTLEKQETAQAGAAAAATVEDKEPPSEKDVSVAYCSIAEIYLTDLCMEEGAADKCRESIEMALKYQHDNPEALQLMASYLFSTERNQEGKEYLLKSVGTWLP 256          
BLAST of Si:dkey-12j5.1 vs. Planmine SMEST
Match: SMESG000041594.1 (SMESG000041594.1)

HSP 1 Score: 628.632 bits (1620), Expect = 0.000e+0
Identity = 337/341 (98.83%), Postives = 338/341 (99.12%), Query Frame = 2
Query:    2 SDLSIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMMLKNLTADDSKKILFKPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIISNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALVIEKIVETSEENKQELIGMIEDHAEMAIGLANPVVESAAVAEMTNLLEKIGAEHRXXXXXXXXXXXXXXXXXXMVVDKEE 1024
            SDLSIQDLIIKAHEHIENADLNEAMVIGKEILAKD DNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQL DGEESEKYFLSAIDMMLKNLTADDSKKILFKPTKLDVSNAYVSLCELYMTDLCDKDDAEI CSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKI+SNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALVIEKIVETSEENKQELIGMIEDHAEMAIGLANPVVESAAVAEMTNLLEKIGAEHRSCDEDCSSNDEESSTDDEMVVDKEE
Sbjct:    2 SDLSIQDLIIKAHEHIENADLNEAMVIGKEILAKDSDNKKGLEIMGYILLELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLTDGEESEKYFLSAIDMMLKNLTADDSKKILFKPTKLDVSNAYVSLCELYMTDLCDKDDAEIKCSEYLKKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIMSNADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDDEHFQAHYLMALVIEKIVETSEENKQELIGMIEDHAEMAIGLANPVVESAAVAEMTNLLEKIGAEHRSCDEDCSSNDEESSTDDEMVVDKEE 342          
BLAST of Si:dkey-12j5.1 vs. Planmine SMEST
Match: SMESG000041593.1 (SMESG000041593.1)

HSP 1 Score: 513.842 bits (1322), Expect = 1.426e-175
Identity = 252/255 (98.82%), Postives = 255/255 (100.00%), Query Frame = 1
Query: 2383 MLLENLVFHFFNFFPLIAGTVYNMNKYNSVVAVKVRNGLICTGFIFSNIRILVSNSCLSHRKRKLPHSIHILTGITDPDFNDNDIEEWPKDYTYEVHHVGHFNRRLTIKRDRNSIGYDFRVLFLKGKILFGKHVDLGFLSADSKDLQSRQIFSKVKIILINENWKKLLKLIIETISVSFENCFSVSMKLAKRRAIICNIPETRENLYRKARFGSLLISSQGLFGPDVIYGIYSSYKINVTSIQIFTVTSLSNFLK 3147
            MLLENLVFHFFNFFPLIAGTVYNMNKYNSVVAVKVRNGLICTGFIFSNIRILVSNSCLSHRKRKLPHSIHILTGITDPDFNDNDIEEWPKDYTYEVHHVG+FNRRLTIKRDRNSIGYDFR+LFLKGKILFGKHVDLGFLSADSKDLQSRQIFSKVKIILINENWKK+LKLIIETISVSFENCFSVSMKLAKRRAIICNIPETRENLYRKARFGSLLISSQGLFGPDVIYGIYSSYKINVTSIQIFTVTSLSNFLK
Sbjct:    1 MLLENLVFHFFNFFPLIAGTVYNMNKYNSVVAVKVRNGLICTGFIFSNIRILVSNSCLSHRKRKLPHSIHILTGITDPDFNDNDIEEWPKDYTYEVHHVGYFNRRLTIKRDRNSIGYDFRILFLKGKILFGKHVDLGFLSADSKDLQSRQIFSKVKIILINENWKKILKLIIETISVSFENCFSVSMKLAKRRAIICNIPETRENLYRKARFGSLLISSQGLFGPDVIYGIYSSYKINVTSIQIFTVTSLSNFLK 255          
BLAST of Si:dkey-12j5.1 vs. Planmine SMEST
Match: SMESG000041593.1 (SMESG000041593.1)

HSP 1 Score: 466.463 bits (1199), Expect = 1.007e-157
Identity = 229/232 (98.71%), Postives = 232/232 (100.00%), Query Frame = 1
Query: 2452 MNKYNSVVAVKVRNGLICTGFIFSNIRILVSNSCLSHRKRKLPHSIHILTGITDPDFNDNDIEEWPKDYTYEVHHVGHFNRRLTIKRDRNSIGYDFRVLFLKGKILFGKHVDLGFLSADSKDLQSRQIFSKVKIILINENWKKLLKLIIETISVSFENCFSVSMKLAKRRAIICNIPETRENLYRKARFGSLLISSQGLFGPDVIYGIYSSYKINVTSIQIFTVTSLSNFLK 3147
            MNKYNSVVAVKVRNGLICTGFIFSNIRILVSNSCLSHRKRKLPHSIHILTGITDPDFNDNDIEEWPKDYTYEVHHVG+FNRRLTIKRDRNSIGYDFR+LFLKGKILFGKHVDLGFLSADSKDLQSRQIFSKVKIILINENWKK+LKLIIETISVSFENCFSVSMKLAKRRAIICNIPETRENLYRKARFGSLLISSQGLFGPDVIYGIYSSYKINVTSIQIFTVTSLSNFLK
Sbjct:    1 MNKYNSVVAVKVRNGLICTGFIFSNIRILVSNSCLSHRKRKLPHSIHILTGITDPDFNDNDIEEWPKDYTYEVHHVGYFNRRLTIKRDRNSIGYDFRILFLKGKILFGKHVDLGFLSADSKDLQSRQIFSKVKIILINENWKKILKLIIETISVSFENCFSVSMKLAKRRAIICNIPETRENLYRKARFGSLLISSQGLFGPDVIYGIYSSYKINVTSIQIFTVTSLSNFLK 232          
The following BLAST results are available for this feature:
BLAST of Si:dkey-12j5.1 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-12j5.1 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-12j5.1 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-12j5.1 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
si:dkey-12j5.11.383e-2131.16si:dkey-12j5.1 [Source:ZFIN;Acc:ZDB-GENE-100922-71... [more]
si:dkey-12j5.12.518e-838.96si:dkey-12j5.1 [Source:ZFIN;Acc:ZDB-GENE-100922-71... [more]
back to top
BLAST of Si:dkey-12j5.1 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSXETT00000001831.13.430e-2431.72probable assembly chaperone of rpl4 [Source:NCBI g... [more]
ENSXETT00000001893.15.362e-2431.72probable assembly chaperone of rpl4 [Source:NCBI g... [more]
ENSXETT00000001963.11.221e-2130.97probable assembly chaperone of rpl4 [Source:NCBI g... [more]
ENSXETT00000001919.11.965e-1930.22probable assembly chaperone of rpl4 [Source:NCBI g... [more]
back to top
BLAST of Si:dkey-12j5.1 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-12j5.1 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 1
Match NameE-valueIdentityDescription
sp|Q1MTN8|ACL4_SCHPO2.437e-1628.35Probable assembly chaperone of rpl4 OS=Schizosacch... [more]
back to top
BLAST of Si:dkey-12j5.1 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
V5I5812.665e-3231.06TPR_REGION domain-containing protein OS=Ixodes ric... [more]
A0A131XBZ14.562e-3231.44Putative rna polymerase iii transcription factor t... [more]
K1QAY64.681e-3236.09UPF0661 TPR repeat-containing protein C16D10.01c O... [more]
A0A224Z1676.291e-3231.84TPR_REGION domain-containing protein OS=Rhipicepha... [more]
A0A131XXB36.367e-3231.06TPR_REGION domain-containing protein OS=Ixodes ric... [more]
back to top
BLAST of Si:dkey-12j5.1 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-12j5.19.978e-2328.73probable assembly chaperone of rpl4 [Source:NCBI g... [more]
si:dkey-12j5.14.692e-1729.65probable assembly chaperone of rpl4 [Source:NCBI g... [more]
si:dkey-12j5.13.198e-1230.67probable assembly chaperone of rpl4 [Source:NCBI g... [more]
back to top
BLAST of Si:dkey-12j5.1 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
si:dkey-12j5.11.881e-2728.30si:dkey-12j5.1 [Source:ZFIN;Acc:ZDB-GENE-100922-71... [more]
back to top
BLAST of Si:dkey-12j5.1 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Si:dkey-12j5.1 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO435719.764e-2630.89Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Si:dkey-12j5.1 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 3
Match NameE-valueIdentityDescription
si:dkey-12j5.19.164e-2529.08probable assembly chaperone of rpl4 [Source:NCBI g... [more]
si:dkey-12j5.11.145e-2429.08probable assembly chaperone of rpl4 [Source:NCBI g... [more]
si:dkey-12j5.18.692e-1928.64probable assembly chaperone of rpl4 [Source:NCBI g... [more]
back to top
BLAST of Si:dkey-12j5.1 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000041594.10.000e+098.83SMESG000041594.1[more]
SMESG000041593.11.426e-17598.82SMESG000041593.1[more]
SMESG000041593.11.007e-15798.71SMESG000041593.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023538 ID=SMED30023538|Name=Si:dkey-12j5.1|organism=Schmidtea mediterranea sexual|type=transcript|length=3224bp
GTCAGATTTAAGCATTCAGGATTTAATTATTAAGGCACATGAGCACATAG
AAAATGCTGACCTTAATGAAGCTATGGTAATTGGGAAAGAAATTCTCGCT
AAAGATTGTGATAACAAAAAAGGTCTTGAAATAATGGGTTATATTTTATT
AGAATTGAATCTAATGGAAGAAGCAAAATTTTGTTTTTCAAAATCTATTG
AAAATGATTCAGGTGATAGTCATGTACCTCATTTGTATTTGGGACAGTTG
AATGATGGTGAAGAATCTGAGAAGTATTTTCTCAGTGCTATAGACATGAT
GTTGAAAAATTTGACTGCAGATGACTCCAAGAAAATTTTATTTAAACCGA
CCAAGCTTGATGTATCTAATGCATATGTTAGTTTATGTGAGTTATATATG
ACTGATTTATGTGATAAAGATGATGCAGAAATTATATGCAGTGAATACCT
AAAGAAAGCTGTTGAAATGGACGAGTTTAACCCTGCTGCTTGGCAATCAT
CAGCTGCACTGCATTTAATTAAGAATGAAATACAGTCAGCCAAAGAGAGC
ATCAGAAAATCTATCGATTTATGGCTCCCGGAAGCCCTTAAAATTATTTC
GAATGCCGATACTGAAGATTGCACAAATGAAATCATTGCAACTTGTGATT
TATCAGCAGATTTACGGGTGAAATGTGCGGAAATTCTTTTTGAATTGGAA
TTACTGGTGGAGGCCAGATCCGTATTGGACACGATTCTTGTTGAGGACGA
TGAGCATTTCCAGGCACATTACTTGATGGCCTTGGTCATTGAGAAGATTG
TGGAGACCAGCGAGGAAAACAAACAAGAGCTGATTGGAATGATTGAGGAT
CACGCAGAAATGGCAATCGGGTTGGCCAATCCGGTAGTGGAGAGCGCTGC
TGTTGCTGAAATGACAAATCTGCTCGAGAAAATCGGGGCTGAGCATCGAT
CATGTGATGAGGATTGCTCCAGCAATGACGAGGAGTCCTCGACAGATGAT
GAAATGGTTGTCGACAAAGAGGAATAAACTTTGGAATTTATGATTTCTAC
TTTTGAGTTTTTCTTTTATTTGGGGGCGCGCGCTAATTTAAGTGACCTAT
TAGGAGGCCGGCTTTCTACAAGTTTTATTTGATTGATGAACCAATCAGAA
TGTTATTTGAATTAATTGAGATTTTATGCCATAACTTAACCAGCTACCGT
GGGATGATTAGTTGTTGTCATAGCAACCTAGTCTAGTGGCTAGAATCCGT
ACCTGCACATATTAGTGTTGTCTATGCATTTGAAAGTTTTATAGAAAGCA
ACGAAATCAATCGTGGAAAATATAATTAACTCCTTCAGTACTGACTTTTT
ACTACTGGGAAACAGCAAATATATTTGTTTTTTACACTTCATATATTTAT
ATTAAAAGTATTATTAATACCGCTCATTAAATGCCCCTCTCTAGCTGCAC
GCTTTCCTTTCAAAAAATTCCAGATTAATTGTCTGAATGTTCCTGGGGCT
TTGCCATTTTTTTTACGAATCTAGGAAATTGTTTTTAAAGTATAATTTTG
CGCTGGGATAGGTGCTCCAATGGCTGAAGTCTTCTGATAGGGTAAGAGTA
TTAATGTGTTCAATCTAAGTCTACTTCATCCTGGTTCTAACCGTTAAAAT
TAGCGTTGTCTTCATTCAAACTGGCAATCTGACAAAATAGTCTCCATTTA
TACATTATTGTAATTAGATTCTCTACTTTTAAAACTGATTTATTGACAGA
ACTCTTGAATTGATTAACCTGTCTTACTAATTTGTCGTGGCGTGCTTTCA
CAAAATATCACTGCATCGAGTAATTTTATTAGTTTCCAACCAACGTCGGG
TCCTCTTATAACCTGGCTTTGCTCATTTATCAATTTCCACAGGTAAAATT
GTTGGCAACTCAGATTTCCAACATTTGGGTTTTACATTAGCTTGAAATTT
TCATTAGCTAATTAATTTTAATTTCTATAAATATATTCTGGAGACCGCAT
TTTTATTATCTTTGAACTTTGAGATATGCCTATAGCAGTTTCCACGTAAA
ATATTTATTTTTAATTAATTTTAAACTTTAATCATTTTAATTATTTAATT
ATCTTTTCATGTTTTTTATATAATGTAAAAACATTGTCAATAAATATAAA
AAAGCGGTAAAAATAATTCATTAACTTTTTAAAATTAATAAAAAACTTAT
TAATTAAAAACAATGACATGGAAGAAAAGACATTTGTTGTTATATATTGC
AAAACAGAATTGAGTTGGTGGGTAGAAAACGCAATATAATGAAGAATTGG
TCACTTGAGTACAACCTTCTGTGTACCTTATGATCATGAACATTTAATAT
TAATTAATATTAATTATCGATAAATTCAGTAAATGCTGCTAGAGAATTTG
GTTTTTCATTTTTTCAATTTCTTTCCTTTAATTGCTGGTACGGTGTACAA
TATGAACAAGTACAACTCGGTGGTGGCTGTTAAAGTACGTAATGGGCTCA
TCTGTACTGGATTTATATTTTCAAATATTAGAATTTTGGTGTCTAATTCC
TGTCTCAGCCATCGAAAACGAAAGCTGCCTCATTCAATTCATATATTAAC
AGGTATAACTGATCCAGATTTCAATGACAACGACATTGAGGAATGGCCAA
AAGATTACACCTACGAAGTTCACCATGTCGGACATTTCAATAGGAGGCTT
ACGATTAAAAGAGACCGAAACTCGATAGGATATGATTTTCGTGTTTTATT
TTTGAAAGGAAAAATATTATTTGGAAAACATGTGGATTTGGGATTTCTAA
GCGCCGATTCAAAAGATTTACAGAGTCGGCAGATTTTTTCAAAAGTGAAA
ATAATTTTAATAAATGAAAATTGGAAAAAATTACTAAAATTAATAATAGA
GACGATTAGTGTTTCTTTTGAAAATTGCTTTTCCGTATCTATGAAACTAG
CGAAACGTCGAGCCATAATTTGTAATATACCGGAAACCAGAGAAAACCTT
TATAGAAAGGCAAGGTTTGGATCTCTTCTCATAAGTTCTCAAGGTTTATT
TGGGCCCGATGTCATATACGGCATTTATTCTTCCTATAAAATTAATGTTA
CAAGCATACAAATATTTACAGTAACTTCATTGTCAAATTTCTTGAAATAA
ATTTCTATCTAATTAAATTTTTTAATTTTGTATCACTTAAACTTGAAATT
CGTGACATCTCGGGGCAATTGGGG
back to top

protein sequence of SMED30023538-orf-1

>SMED30023538-orf-1 ID=SMED30023538-orf-1|Name=SMED30023538-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=256bp
MLLENLVFHFFNFFPLIAGTVYNMNKYNSVVAVKVRNGLICTGFIFSNIR
ILVSNSCLSHRKRKLPHSIHILTGITDPDFNDNDIEEWPKDYTYEVHHVG
HFNRRLTIKRDRNSIGYDFRVLFLKGKILFGKHVDLGFLSADSKDLQSRQ
IFSKVKIILINENWKKLLKLIIETISVSFENCFSVSMKLAKRRAIICNIP
ETRENLYRKARFGSLLISSQGLFGPDVIYGIYSSYKINVTSIQIFTVTSL
SNFLK*
back to top

protein sequence of SMED30023538-orf-2

>SMED30023538-orf-2 ID=SMED30023538-orf-2|Name=SMED30023538-orf-2|organism=Schmidtea mediterranea sexual|type=polypeptide|length=342bp
SDLSIQDLIIKAHEHIENADLNEAMVIGKEILAKDCDNKKGLEIMGYILL
ELNLMEEAKFCFSKSIENDSGDSHVPHLYLGQLNDGEESEKYFLSAIDMM
LKNLTADDSKKILFKPTKLDVSNAYVSLCELYMTDLCDKDDAEIICSEYL
KKAVEMDEFNPAAWQSSAALHLIKNEIQSAKESIRKSIDLWLPEALKIIS
NADTEDCTNEIIATCDLSADLRVKCAEILFELELLVEARSVLDTILVEDD
EHFQAHYLMALVIEKIVETSEENKQELIGMIEDHAEMAIGLANPVVESAA
VAEMTNLLEKIGAEHRSCDEDCSSNDEESSTDDEMVVDKEE*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000429neoblast
PLANA:0002032epidermal cell
Vocabulary: INTERPRO
TermDefinition
IPR009003Peptidase_S1_PA
IPR011990TPR-like_helical_dom_sf
IPR019734TPR_repeat
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR009003Peptidase S1, PA clanSUPERFAMILYSSF50494Trypsin-like serine proteasescoord: 17..143