Microsomal glutathione S-transferase 3

Overview
NameMicrosomal glutathione S-transferase 3
Smed IDSMED30023536
Length (bp)1085
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Microsomal glutathione S-transferase 3 (SMED30023536) t-SNE clustered cells

Violin plots show distribution of expression levels for Microsomal glutathione S-transferase 3 (SMED30023536) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Microsomal glutathione S-transferase 3 (SMED30023536) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Microsomal glutathione S-transferase 3 (SMED30023536) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023536

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 18

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30023536SMESG000078588.1 dd_Smed_v4_1661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023536SMESG000078588.1 dd_Smed_v4_1661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior muscle cellSMED30023536SMESG000078588.1 dd_Smed_v4_1661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
posterior sideSMED30023536SMESG000078588.1 dd_Smed_v4_1661_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023536SMESG000078588.1 Contig27224newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023536SMESG000078588.1 Contig27224uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023536SMESG000078588.1 Contig51996newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023536SMESG000078588.1 Contig51996uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023536SMESG000078588.1 Contig4114newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023536SMESG000078588.1 Contig4114uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023536SMESG000078588.1 Contig26848newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023536SMESG000078588.1 Contig26848uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023536SMESG000024278.1 Contig4114newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023536SMESG000024278.1 Contig4114uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
gutSMED30023536SMESG000078588.1 SMED30023536smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023536SMESG000078588.1 SMED30023536smed_20140614PMID:26457503
Tu et al., 2015
whole organism asexual adult colorimetric in situ hybridization evidence
Category 3 cellSMED30023536SMESG000078588.1 dd_Smed_v6_1661_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023536SMESG000078588.1 dd_Smed_v4_1661_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Human
Match: MGST3 (microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064])

HSP 1 Score: 88.5817 bits (218), Expect = 1.378e-20
Identity = 49/118 (41.53%), Postives = 70/118 (59.32%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSM 770
            + +  YG VLL    S+I+  +L I V +ARK+Y VE+P +YS    +   FNCIQR HQN LE    F+ FL + G+ +PR A   G  +++GR+ YA+GY     +KRS G   S+
Sbjct:    3 VLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI 120          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Human
Match: MGST3 (microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064])

HSP 1 Score: 88.5817 bits (218), Expect = 1.378e-20
Identity = 49/118 (41.53%), Postives = 70/118 (59.32%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSM 770
            + +  YG VLL    S+I+  +L I V +ARK+Y VE+P +YS    +   FNCIQR HQN LE    F+ FL + G+ +PR A   G  +++GR+ YA+GY     +KRS G   S+
Sbjct:    3 VLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI 120          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Human
Match: MGST3 (microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064])

HSP 1 Score: 88.5817 bits (218), Expect = 1.664e-20
Identity = 49/118 (41.53%), Postives = 70/118 (59.32%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSM 770
            + +  YG VLL    S+I+  +L I V +ARK+Y VE+P +YS    +   FNCIQR HQN LE    F+ FL + G+ +PR A   G  +++GR+ YA+GY     +KRS G   S+
Sbjct:   17 VLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI 134          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Human
Match: MGST3 (microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064])

HSP 1 Score: 88.5817 bits (218), Expect = 1.664e-20
Identity = 49/118 (41.53%), Postives = 70/118 (59.32%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSM 770
            + +  YG VLL    S+I+  +L I V +ARK+Y VE+P +YS    +   FNCIQR HQN LE    F+ FL + G+ +PR A   G  +++GR+ YA+GY     +KRS G   S+
Sbjct:   17 VLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI 134          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Human
Match: MGST3 (microsomal glutathione S-transferase 3 [Source:HGNC Symbol;Acc:HGNC:7064])

HSP 1 Score: 88.5817 bits (218), Expect = 1.664e-20
Identity = 49/118 (41.53%), Postives = 70/118 (59.32%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSM 770
            + +  YG VLL    S+I+  +L I V +ARK+Y VE+P +YS    +   FNCIQR HQN LE    F+ FL + G+ +PR A   G  +++GR+ YA+GY     +KRS G   S+
Sbjct:   17 VLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI 134          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Zebrafish
Match: mgst3b (microsomal glutathione S-transferase 3b [Source:ZFIN;Acc:ZDB-GENE-061215-48])

HSP 1 Score: 89.3521 bits (220), Expect = 3.785e-21
Identity = 44/113 (38.94%), Postives = 67/113 (59.29%), Query Frame = 3
Query:  420 RNIFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGM 758
             ++   N+G  +LV V S+++ MYL ++V  ARK++ V++P +YSD+   FNCIQR HQN LE    ++ F  I+ L YP  A + G  ++  R  YA GY   +  KR  G+
Sbjct:    4 ESVLPANFGYAILVYVYSFVMLMYLGMKVGAARKKFGVKYPTMYSDKDQIFNCIQRAHQNTLEVYPQWLLFQTIAALHYPSAASVLGAIWVTSRFSYAWGYYTGDPAKRMHGV 116          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Zebrafish
Match: mgst3a (microsomal glutathione S-transferase 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2767])

HSP 1 Score: 83.9593 bits (206), Expect = 4.025e-19
Identity = 43/113 (38.05%), Postives = 66/113 (58.41%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            + +  YG V L    S++L ++L   VV+ARK+Y+V +P +YSD       FNCIQR HQN +E    F+  L + G+++PR A + G  +++ R+ YA GY+     KR  G
Sbjct:    3 VLSKEYGYVALTGAASFLLMVHLAHGVVKARKKYNVPYPTMYSDDPETGRIFNCIQRSHQNTIEILSPFLFHLSVGGIQHPRLASVLGMIWIVSRVLYAQGYSTGKPQKRHRG 115          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Zebrafish
Match: mgst3a (microsomal glutathione S-transferase 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2767])

HSP 1 Score: 83.9593 bits (206), Expect = 4.025e-19
Identity = 43/113 (38.05%), Postives = 66/113 (58.41%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            + +  YG V L    S++L ++L   VV+ARK+Y+V +P +YSD       FNCIQR HQN +E    F+  L + G+++PR A + G  +++ R+ YA GY+     KR  G
Sbjct:    3 VLSKEYGYVALTGAASFLLMVHLAHGVVKARKKYNVPYPTMYSDDPETGRIFNCIQRSHQNTIEILSPFLFHLSVGGIQHPRLASVLGMIWIVSRVLYAQGYSTGKPQKRHRG 115          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Zebrafish
Match: mgst3a (microsomal glutathione S-transferase 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2767])

HSP 1 Score: 83.9593 bits (206), Expect = 4.025e-19
Identity = 43/113 (38.05%), Postives = 66/113 (58.41%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            + +  YG V L    S++L ++L   VV+ARK+Y+V +P +YSD       FNCIQR HQN +E    F+  L + G+++PR A + G  +++ R+ YA GY+     KR  G
Sbjct:    3 VLSKEYGYVALTGAASFLLMVHLAHGVVKARKKYNVPYPTMYSDDPETGRIFNCIQRSHQNTIEILSPFLFHLSVGGIQHPRLASVLGMIWIVSRVLYAQGYSTGKPQKRHRG 115          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Zebrafish
Match: mgst3a (microsomal glutathione S-transferase 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2767])

HSP 1 Score: 79.7221 bits (195), Expect = 6.534e-18
Identity = 40/104 (38.46%), Postives = 63/104 (60.58%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTA 728
            + +  YG V L    S++L ++L   VV+ARK+Y+V +P +YSD       FNCIQR HQN +E    F+  L + G+++PR A + G  +++ R+ YA GY+ 
Sbjct:    3 VLSKEYGYVALTGAASFLLMVHLAHGVVKARKKYNVPYPTMYSDDPETGRIFNCIQRSHQNTIEILSPFLFHLSVGGIQHPRLASVLGMIWIVSRVLYAQGYST 106          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Xenopus
Match: sigirr (single immunoglobulin and toll-interleukin 1 receptor (TIR) domain [Source:Xenbase;Acc:XB-GENE-492815])

HSP 1 Score: 98.2117 bits (243), Expect = 3.184e-24
Identity = 49/110 (44.55%), Postives = 68/110 (61.82%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKR 746
            + +  YG V+L    S+I+  +L I V +ARKQY VE+P +YSD   +   FNCIQR HQN LES   F+ FL + GL +PR     G  +++GR  YAHGY+  + +KR
Sbjct:    3 VLSKEYGYVVLTGAASFIMVTHLAINVGKARKQYKVEYPKMYSDDPENGNIFNCIQRAHQNTLESYPPFLFFLAVGGLTHPRATSALGVAWIVGRELYAHGYSTGDPSKR 112          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Xenopus
Match: post2 (posterior protein 2 [Source:Xenbase;Acc:XB-GENE-5867592])

HSP 1 Score: 72.7886 bits (177), Expect = 3.094e-15
Identity = 37/87 (42.53%), Postives = 54/87 (62.07%), Query Frame = 3
Query:  486 MYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKR 746
            MYL ++V+ ARK+Y V++P +YS   M FNC+QR HQN +E    ++ F LI+GL +P  A + G  ++  R  YA GY   +  KR
Sbjct:    3 MYLSMKVMGARKKYGVKYPEMYSKDQM-FNCVQRAHQNTMEVYPVWVIFQLIAGLAFPLAAAVLGAIWVTSRFSYAWGYYTGDPQKR 88          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Mouse
Match: Mgst3 (microsomal glutathione S-transferase 3 [Source:MGI Symbol;Acc:MGI:1913697])

HSP 1 Score: 87.0409 bits (214), Expect = 3.484e-20
Identity = 47/118 (39.83%), Postives = 71/118 (60.17%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSM 770
            + +  YG VLL    S+++ ++L I V +ARK+Y VE+P +YS    +   FNCIQR HQN LE    F+ FL + G+ +PR A   G  +++GR+ YA+GY   + +KR  G   S+
Sbjct:    3 VLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYRGAVGSL 120          
BLAST of Microsomal glutathione S-transferase 3 vs. UniProt/SwissProt
Match: sp|O14880|MGST3_HUMAN (Microsomal glutathione S-transferase 3 OS=Homo sapiens OX=9606 GN=MGST3 PE=1 SV=1)

HSP 1 Score: 88.5817 bits (218), Expect = 6.618e-20
Identity = 49/118 (41.53%), Postives = 70/118 (59.32%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSM 770
            + +  YG VLL    S+I+  +L I V +ARK+Y VE+P +YS    +   FNCIQR HQN LE    F+ FL + G+ +PR A   G  +++GR+ YA+GY     +KRS G   S+
Sbjct:    3 VLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPIMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRSRGALGSI 120          
BLAST of Microsomal glutathione S-transferase 3 vs. UniProt/SwissProt
Match: sp|Q9CPU4|MGST3_MOUSE (Microsomal glutathione S-transferase 3 OS=Mus musculus OX=10090 GN=Mgst3 PE=1 SV=1)

HSP 1 Score: 87.0409 bits (214), Expect = 2.437e-19
Identity = 47/118 (39.83%), Postives = 71/118 (60.17%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSM 770
            + +  YG VLL    S+++ ++L I V +ARK+Y VE+P +YS    +   FNCIQR HQN LE    F+ FL + G+ +PR A   G  +++GR+ YA+GY   + +KR  G   S+
Sbjct:    3 VLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPENGHMFNCIQRAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYRGAVGSL 120          
BLAST of Microsomal glutathione S-transferase 3 vs. UniProt/SwissProt
Match: sp|Q3T100|MGST3_BOVIN (Microsomal glutathione S-transferase 3 OS=Bos taurus OX=9913 GN=MGST3 PE=2 SV=1)

HSP 1 Score: 83.5741 bits (205), Expect = 4.685e-18
Identity = 44/113 (38.94%), Postives = 65/113 (57.52%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMD---FNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            + +  YG V+L    S+++  +L I V +ARK+Y VE+P +YS    +   FNCIQR HQN LE    F+ FL + G+ +PR     G  +++GR+ YA+GY      KR  G
Sbjct:    3 VLSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPENGHIFNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPRKRQRG 115          
BLAST of Microsomal glutathione S-transferase 3 vs. UniProt/SwissProt
Match: sp|P73795|Y1147_SYNY3 (Uncharacterized protein sll1147 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1147 PE=3 SV=1)

HSP 1 Score: 52.7582 bits (125), Expect = 2.949e-7
Identity = 35/105 (33.33%), Postives = 52/105 (49.52%), Query Frame = 3
Query:  456 LVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGL-KYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMS 767
            L+   + +L + L+I V RAR +Y V  P    +   DF  + R   N LE   FF+P L +  + + P  A + G  +LLGR+ YA GY  +   KR  G  + 
Sbjct:   11 LITALATMLYLVLVINVGRARAKYGVMPPATTGNE--DFERVLRVQYNTLEQLAFFLPGLWLFAIYRDPTIAAILGAVWLLGRILYAWGYY-QAAEKRMVGFALG 112          
BLAST of Microsomal glutathione S-transferase 3 vs. TrEMBL
Match: H8ZQF6 (Microsomal GST3 (Fragment) OS=Reishia clavigera OX=272940 PE=2 SV=1)

HSP 1 Score: 118.242 bits (295), Expect = 1.136e-28
Identity = 54/106 (50.94%), Postives = 81/106 (76.42%), Query Frame = 3
Query:  438 NYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            +YG VLLV+V ++ILN +L ++V++ARK+YDV++P LYS+ S +FNC+QR HQN LE+   F+ FLL++GLK+PR + L G  YL+ R+ YA+GY   + +KR+ G
Sbjct:    8 DYGYVLLVVVATWILNNWLGLQVMKARKKYDVQYPTLYSETSKEFNCVQRAHQNTLENIPMFLTFLLLAGLKFPRLSALFGVIYLVSRVVYAYGYYTGDPSKRNRG 113          
BLAST of Microsomal glutathione S-transferase 3 vs. TrEMBL
Match: A0A0X3NHA9 (Microsomal glutathione S-transferase 3 OS=Schistocephalus solidus OX=70667 GN=MGST3 PE=4 SV=1)

HSP 1 Score: 111.694 bits (278), Expect = 7.199e-26
Identity = 54/105 (51.43%), Postives = 72/105 (68.57%), Query Frame = 3
Query:  441 YGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            YGGVLLV V S+ LNM+L  RVV+ RK++D++ P +Y   + +FNCIQR HQNYLES  FF+  L + GL+ P  A + G+ YL+GR+ Y HGYT+ N   R  G
Sbjct:   22 YGGVLLVGVGSFALNMFLAARVVQGRKKWDIQAPLMYHPTNEEFNCIQRAHQNYLESLPFFLMSLFVGGLRSPVGAAVVGSIYLVGRVVYYHGYTSGNPKNRCRG 126          
BLAST of Microsomal glutathione S-transferase 3 vs. TrEMBL
Match: A0A131XKS3 (Putative microsomal glutathione s-transferase OS=Hyalomma excavatum OX=257692 PE=2 SV=1)

HSP 1 Score: 110.153 bits (274), Expect = 1.170e-25
Identity = 55/106 (51.89%), Postives = 72/106 (67.92%), Query Frame = 3
Query:  438 NYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
             YG VL V V S I+NM+L  RV RARK++DV++P +YSD ++ FNCIQR HQN+LES   F+  L + GL+YPR A   G  YL GR+ YA GY+  + +KR  G
Sbjct:   11 EYGYVLFVGVGSAIVNMWLAFRVGRARKRFDVKYPAMYSDTNVVFNCIQRSHQNFLESYPQFLMMLFLGGLEYPRLAACAGVVYLAGRIVYAIGYSTGDPSKRMRG 116          
BLAST of Microsomal glutathione S-transferase 3 vs. TrEMBL
Match: A0A131YGX4 (Glutathione S-transferase OS=Rhipicephalus appendiculatus OX=34631 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 3.078e-25
Identity = 52/106 (49.06%), Postives = 73/106 (68.87%), Query Frame = 3
Query:  438 NYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
             YG V+LV V S I+NM+L  RV RARKQ+D+++P +YSD ++ FNC+QR HQN+LES   F+  L + G++YP+ A   G  YL GR+ YA GY+  + +KR  G
Sbjct:   12 EYGYVVLVGVGSAIVNMWLAFRVGRARKQFDIKYPTMYSDTNVVFNCVQRSHQNFLESYPQFLMTLFLGGVEYPKLAACAGVVYLAGRIVYAIGYSTGDPSKRMRG 117          
BLAST of Microsomal glutathione S-transferase 3 vs. TrEMBL
Match: V3ZXM0 (Uncharacterized protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_235705 PE=4 SV=1)

HSP 1 Score: 105.531 bits (262), Expect = 7.249e-24
Identity = 51/106 (48.11%), Postives = 74/106 (69.81%), Query Frame = 3
Query:  438 NYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            +YG V+LVL  ++++  +L + V++ARK+Y+VE+PNLYS+   +FNC+QR HQN LE+  FFI FLL  GL +P+    +G  YL+ RL YAHGY   +  KR+ G
Sbjct:    8 DYGYVILVLPATWVIMNFLALNVMKARKKYNVEYPNLYSNNH-NFNCVQRAHQNTLENLPFFIMFLLTGGLMFPKLCAASGVLYLISRLVYAHGYYTGDPAKRNYG 112          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Cavefish
Match: mgst3b (microsomal glutathione S-transferase 3-like [Source:NCBI gene;Acc:111189777])

HSP 1 Score: 89.3521 bits (220), Expect = 2.538e-21
Identity = 45/111 (40.54%), Postives = 66/111 (59.46%), Query Frame = 3
Query:  423 NIFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            +I   N+G V+L  + S+I+  YL ++V  ARK+Y++++P +YSD+   FNCIQR HQN LE    ++ F  I+ L YP  A + G  ++  R  YA GY   N  KR  G
Sbjct:    5 DILPANFGYVILTYLYSWIMLTYLAVKVGGARKKYNIKYPTMYSDKEDVFNCIQRAHQNTLEVYPQWLVFQTIAALVYPTVASVLGVIWVTSRFSYAWGYYTGNPVKRMNG 115          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Cavefish
Match: mgst3b (microsomal glutathione S-transferase 3b [Source:ZFIN;Acc:ZDB-GENE-061215-48])

HSP 1 Score: 89.7373 bits (221), Expect = 2.654e-21
Identity = 45/111 (40.54%), Postives = 66/111 (59.46%), Query Frame = 3
Query:  423 NIFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            +I   N+G V+L  + S+I+  YL ++V  ARK+Y++++P +YSD+   FNCIQR HQN LE    ++ F  I+ L YP  A + G  ++  R  YA GY   N  KR  G
Sbjct:    5 DILPANFGYVILTYLYSWIMLTYLAVKVGGARKKYNIKYPTMYSDKEDVFNCIQRAHQNTLEVYPQWLVFQTIAALVYPTVASVLGVIWVTSRFSYAWGYYTGNPVKRMNG 115          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Sea Lamprey
Match: mgst3a (microsomal glutathione S-transferase 3a [Source:ZFIN;Acc:ZDB-GENE-040426-2767])

HSP 1 Score: 91.6633 bits (226), Expect = 9.343e-23
Identity = 48/110 (43.64%), Postives = 65/110 (59.09%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYS---DRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKR 746
            + +  YG V+L  V S +L  YL IRV  ARK+Y V +P +YS   +    FNCIQR HQN LE    F+  L+  GL++PR +   G  ++LGR  YAHGY+  +  KR
Sbjct:    3 VLSKEYGCVVLTGVASTLLVTYLGIRVGMARKKYKVLYPEMYSNDPEHGHIFNCIQRAHQNTLEGYPVFLFLLMTGGLQHPRISSALGGVWILGRFVYAHGYSTGDPRKR 112          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Nematostella
Match: EDO44678 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RV33])

HSP 1 Score: 82.8037 bits (203), Expect = 2.862e-19
Identity = 45/106 (42.45%), Postives = 67/106 (63.21%), Query Frame = 3
Query:  438 NYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
             YG V+L  + S  +  YL IRV  ARK++ +++P +Y D+ + FNC+QR HQN LE+   F+  L + GL++P    L G  ++LGR+ YAHGY   + +KRS G
Sbjct:    9 EYGYVVLTGISSAFMLTYLGIRVGVARKKFKIQYPKMYDDKEIVFNCVQRAHQNTLENYPQFLMLLFLGGLEHPIVCSLAGLVWILGRIVYAHGYYTGDPSKRSRG 114          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Medaka
Match: mgst3b (microsomal glutathione S-transferase 3 [Source:NCBI gene;Acc:101161354])

HSP 1 Score: 85.5001 bits (210), Expect = 7.137e-20
Identity = 42/106 (39.62%), Postives = 62/106 (58.49%), Query Frame = 3
Query:  438 NYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            ++G V+   + S+I+  YL ++V  ARK+Y V++P +YSD+   FNCIQR HQN LE    ++ F  I+ L YP  A + G  ++  R  YA GY   +  KR  G
Sbjct:   10 DFGYVIFTYLYSWIMMAYLAVKVGAARKKYGVKYPAMYSDKDQVFNCIQRAHQNTLEVYPQWLVFQTIAALVYPLTASVLGAIWVTSRFSYAWGYYTGDPEKRMKG 115          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Medaka
Match: ENSORLT00000045035.1 (microsomal glutathione S-transferase 3 [Source:NCBI gene;Acc:101173739])

HSP 1 Score: 82.8037 bits (203), Expect = 9.095e-19
Identity = 45/113 (39.82%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSD---RSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            + +  YG V+L    S I+  +L ++V +ARK+Y+V +P +YSD     + FNCIQR HQN LE    F+  L + GL  PR     G  +++GR  YAHGY   +  KR  G
Sbjct:    3 VLSKEYGYVVLTGFASMIMVGHLAVKVGKARKKYNVPYPKMYSDDPETGVIFNCIQRAHQNTLELYPAFLFCLAVGGLHCPRLVSGLGMVWIVGREVYAHGYATGDPKKRMRG 115          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Medaka
Match: ENSORLT00000042109.1 (microsomal glutathione S-transferase 3 [Source:NCBI gene;Acc:101173739])

HSP 1 Score: 82.8037 bits (203), Expect = 1.047e-18
Identity = 45/113 (39.82%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSD---RSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            + +  YG V+L    S I+  +L ++V +ARK+Y+V +P +YSD     + FNCIQR HQN LE    F+  L + GL  PR     G  +++GR  YAHGY   +  KR  G
Sbjct:   10 VLSKEYGYVVLTGFASMIMVGHLAVKVGKARKKYNVPYPKMYSDDPETGVIFNCIQRAHQNTLELYPAFLFCLAVGGLHCPRLVSGLGMVWIVGREVYAHGYATGDPKKRMRG 122          
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Medaka
Match: ENSORLT00000012768.2 (microsomal glutathione S-transferase 3 [Source:NCBI gene;Acc:101173739])

HSP 1 Score: 83.1889 bits (204), Expect = 7.623e-18
Identity = 45/113 (39.82%), Postives = 64/113 (56.64%), Query Frame = 3
Query:  426 IFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSD---RSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCG 755
            + +  YG V+L    S I+  +L ++V +ARK+Y+V +P +YSD     + FNCIQR HQN LE    F+  L + GL  PR     G  +++GR  YAHGY   +  KR  G
Sbjct:  117 VLSKEYGYVVLTGFASMIMVGHLAVKVGKARKKYNVPYPKMYSDDPETGVIFNCIQRAHQNTLELYPAFLFCLAVGGLHCPRLVSGLGMVWIVGREVYAHGYATGDPKKRMRG 229          
BLAST of Microsomal glutathione S-transferase 3 vs. Planmine SMEST
Match: SMESG000078588.1 (SMESG000078588.1)

HSP 1 Score: 272.707 bits (696), Expect = 3.521e-92
Identity = 132/132 (100.00%), Postives = 132/132 (100.00%), Query Frame = 3
Query:  378 MGSFISKDCYEIVHRNIFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSMF 773
            MGSFISKDCYEIVHRNIFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSMF
Sbjct:    1 MGSFISKDCYEIVHRNIFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSMF 132          

HSP 2 Score: 51.9878 bits (123), Expect = 5.592e-8
Identity = 23/23 (100.00%), Postives = 23/23 (100.00%), Query Frame = 3
Query:  141 MGSFISKDCYEIVHRNIFNFNYG 209
            MGSFISKDCYEIVHRNIFNFNYG
Sbjct:    1 MGSFISKDCYEIVHRNIFNFNYG 23          
BLAST of Microsomal glutathione S-transferase 3 vs. Planmine SMEST
Match: SMESG000078591.1 (SMESG000078591.1)

HSP 1 Score: 181.03 bits (458), Expect = 4.209e-56
Identity = 82/132 (62.12%), Postives = 105/132 (79.55%), Query Frame = 3
Query:  378 MGSFISKDCYEIVHRNIFNFNYGGVLLVLVESYILNMYLMIRVVRARKQYDVEFPNLYSDRSMDFNCIQRGHQNYLESTLFFIPFLLISGLKYPRFAFLTGTTYLLGRLCYAHGYTAENVNKRSCGMKMSMF 773
            MGS ISK+   + HR+IF   YGGVLLVLVE+Y++NMYL IRVV+ARK+Y VE+P +YSD S++FNCIQR HQN+LESTLFFIPFLL SG++YPR + L G  YLLGR+ YAH Y + ++ KR  G ++S+F
Sbjct:    1 MGSDISKEIRALAHRDIFPAGYGGVLLVLVETYMVNMYLTIRVVKARKEYHVEYPQMYSDSSVEFNCIQRSHQNFLESTLFFIPFLLFSGIEYPRLSTLAGNIYLLGRVLYAHKYKSTDIKKRIVGFRISLF 132          
The following BLAST results are available for this feature:
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MGST31.378e-2041.53microsomal glutathione S-transferase 3 [Source:HGN... [more]
MGST31.378e-2041.53microsomal glutathione S-transferase 3 [Source:HGN... [more]
MGST31.664e-2041.53microsomal glutathione S-transferase 3 [Source:HGN... [more]
MGST31.664e-2041.53microsomal glutathione S-transferase 3 [Source:HGN... [more]
MGST31.664e-2041.53microsomal glutathione S-transferase 3 [Source:HGN... [more]
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mgst3b3.785e-2138.94microsomal glutathione S-transferase 3b [Source:ZF... [more]
mgst3a4.025e-1938.05microsomal glutathione S-transferase 3a [Source:ZF... [more]
mgst3a4.025e-1938.05microsomal glutathione S-transferase 3a [Source:ZF... [more]
mgst3a4.025e-1938.05microsomal glutathione S-transferase 3a [Source:ZF... [more]
mgst3a6.534e-1838.46microsomal glutathione S-transferase 3a [Source:ZF... [more]
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
sigirr3.184e-2444.55single immunoglobulin and toll-interleukin 1 recep... [more]
post23.094e-1542.53posterior protein 2 [Source:Xenbase;Acc:XB-GENE-58... [more]
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Mgst33.484e-2039.83microsomal glutathione S-transferase 3 [Source:MGI... [more]
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 4
Match NameE-valueIdentityDescription
sp|O14880|MGST3_HUMAN6.618e-2041.53Microsomal glutathione S-transferase 3 OS=Homo sap... [more]
sp|Q9CPU4|MGST3_MOUSE2.437e-1939.83Microsomal glutathione S-transferase 3 OS=Mus musc... [more]
sp|Q3T100|MGST3_BOVIN4.685e-1838.94Microsomal glutathione S-transferase 3 OS=Bos taur... [more]
sp|P73795|Y1147_SYNY32.949e-733.33Uncharacterized protein sll1147 OS=Synechocystis s... [more]
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H8ZQF61.136e-2850.94Microsomal GST3 (Fragment) OS=Reishia clavigera OX... [more]
A0A0X3NHA97.199e-2651.43Microsomal glutathione S-transferase 3 OS=Schistoc... [more]
A0A131XKS31.170e-2551.89Putative microsomal glutathione s-transferase OS=H... [more]
A0A131YGX43.078e-2549.06Glutathione S-transferase OS=Rhipicephalus appendi... [more]
V3ZXM07.249e-2448.11Uncharacterized protein OS=Lottia gigantea OX=2251... [more]
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mgst3b2.538e-2140.54microsomal glutathione S-transferase 3-like [Sourc... [more]
mgst3b2.654e-2140.54microsomal glutathione S-transferase 3b [Source:ZF... [more]
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mgst3a9.343e-2343.64microsomal glutathione S-transferase 3a [Source:ZF... [more]
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO446782.862e-1942.45Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
mgst3b7.137e-2039.62microsomal glutathione S-transferase 3 [Source:NCB... [more]
ENSORLT00000045035.19.095e-1939.82microsomal glutathione S-transferase 3 [Source:NCB... [more]
ENSORLT00000042109.11.047e-1839.82microsomal glutathione S-transferase 3 [Source:NCB... [more]
ENSORLT00000012768.27.623e-1839.82microsomal glutathione S-transferase 3 [Source:NCB... [more]
back to top
BLAST of Microsomal glutathione S-transferase 3 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 2
Match NameE-valueIdentityDescription
SMESG000078588.13.521e-92100.00SMESG000078588.1[more]
SMESG000078591.14.209e-5662.12SMESG000078591.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023536 ID=SMED30023536|Name=Microsomal glutathione S-transferase 3|organism=Schmidtea mediterranea sexual|type=transcript|length=1085bp
TATCTTGAATATGTACCTAAGTGTTCAGGTGCACGACCTATCAAATAATT
GCAAATTTTATAAGTACAATTACACTTCAGTAGTCTGTTTAATATTTAGT
TTAACGTTAATTCAAATATTTTGCTTTTTTTTAAAAAAAAATGGGAAGCT
TCATTTCTAAAGATTGTTATGAAATAGTTCATAGAAATATTTTTAATTTT
AACTATGGTNNNNNANNNNNNNTANNTNNNTNAANCNTNNNNNNTNAAAT
GCTCTAATTGTTCAGGTGCACGACCTATCAAATAATTGCAAATTTTATAA
GTACAATTACACTTCAGTAGTCTGTTTAATATTTAGTTTAACGTTAATTC
AAATATTTTGCTTTTTTTAAAAAAAAAATGGGAAGCTTCATTTCTAAAGA
TTGTTATGAAATAGTTCATAGAAATATTTTTAATTTTAACTATGGTGGGG
TACTATTGGTACTCGTTGAATCATACATCTTGAATATGTACCTAATGATT
CGAGTTGTACGTGCTCGTAAGCAATACGACGTTGAGTTCCCAAATTTATA
TTCTGATAGAAGTATGGATTTTAACTGCATTCAGCGGGGTCATCAAAATT
ATTTAGAATCTACTTTGTTTTTCATCCCATTTCTATTGATTAGTGGTCTT
AAATATCCGAGATTTGCATTTTTAACTGGTACAACTTACTTACTTGGTCG
ATTGTGTTATGCGCATGGATACACAGCCGAAAATGTTAATAAGCGAAGTT
GTGGTATGAAGATGAGCATGTTTGGTGGATTATTACCACTTGTTGGCTCG
GTAGGAGTTTTAGCTGTTGGTTGTTTAATGAAAAAAACAAATACTAACTT
TCTTGAATAATTGATTTTTAGTGTTATCCGAATTTAGGGTAATTTTATTG
ATTTTTCCAATGACGTAAGTCATATTAGCAGCTCAACTGAAAAATCTTGA
AATTTTTGTTTTCTTTATAATAAAATGCTTTTAGTTTTCAAAAAAAAGTT
TTGAAGTTAGATTGCATAAGGGCCTCACTTGTGTATGCTTGTTTAATAAT
TGTTGTGTTAGTGGCCACAAAGCGTGCAAAAAAAG
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000034epidermis
PLANA:0000035Category 3 cell
PLANA:0000101muscle cell
PLANA:0000142posterior region of the whole animal
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
PLANA:0003001lateral region of the whole animal
Vocabulary: INTERPRO
TermDefinition
IPR001129Membr-assoc_MAPEG
IPR023352MAPEG-like_dom_sf
Vocabulary: cellular component
TermDefinition
GO:0016020membrane
GO:0016021integral component of membrane
Vocabulary: molecular function
TermDefinition
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001129Membrane-associated, eicosanoid/glutathione metabolism (MAPEG) proteinPFAMPF01124MAPEGcoord: 27..135
e-value: 2.3E-17
score: 63.1
IPR023352Membrane associated eicosanoid/glutathione metabolism-like domain superfamilyGENE3DG3DSA:1.20.120.550coord: 14..158
e-value: 1.3E-31
score: 111.2
IPR023352Membrane associated eicosanoid/glutathione metabolism-like domain superfamilySUPERFAMILYSSF161084MAPEG domain-likecoord: 21..145
NoneNo IPR availablePANTHERPTHR10250MICROSOMAL GLUTATHIONE S-TRANSFERASEcoord: 19..148
NoneNo IPR availablePANTHERPTHR10250:SF17MICROSOMAL GLUTATHIONE S-TRANSFERASE 3coord: 19..148
NoneNo IPR availableTMHMMTMhelixcoord: 80..99
NoneNo IPR availableTMHMMTMhelixcoord: 20..39
NoneNo IPR availableTMHMMTMhelixcoord: 129..151