Peptidase M20 domain-containing protein 2

Overview
NamePeptidase M20 domain-containing protein 2
Smed IDSMED30023530
Length (bp)1552
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Peptidase M20 domain-containing protein 2 (SMED30023530) t-SNE clustered cells

Violin plots show distribution of expression levels for Peptidase M20 domain-containing protein 2 (SMED30023530) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Peptidase M20 domain-containing protein 2 (SMED30023530) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Peptidase M20 domain-containing protein 2 (SMED30023530) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023530

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
gutSMED30023530SMESG000049098.1 dd_Smed_v4_7395_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023530SMESG000049098.1 dd_Smed_v4_7395_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30023530SMESG000049098.1 dd_Smed_v4_7395_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30023530SMESG000049098.1 dd_Smed_v6_7395_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Category 3 cellSMED30023530SMESG000049098.1 dd_Smed_v4_7395_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Human
Match: PM20D2 (peptidase M20 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21408])

HSP 1 Score: 258.455 bits (659), Expect = 4.093e-80
Identity = 146/400 (36.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  229 INSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAE----GFQVTRNFILETGFKAEYQTSE--------KP-HIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTV---LGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQN----VTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTL 1359
            I+   + L ++   +W  PEL  +E  AH +LT+ FE E     + V  ++ L T F+AE++  E        +P H+ + CEYDALP +GHACGHNLIAE    AA G++ A+E             LG+PAEE+ GGKI +I+     ++DV  M HP + ++ ++P  A  D+ + + G+++H+ + PWEG NALDA  LAY  ++  R+ M+P   V+  +K   + P+    IIP  + +    RAPS+++L  L  + +   + AAL + C V++      Y N++ NK L  A+  N    GI F +    +    GSTD GNVS V+P IHP F IGS+   HTE++ +  G + A   T+  AK LA T +DV     LLE I++DF+  L
Sbjct:   31 IDEAAERLGALSRAIWSQPELAYEEHHAHRVLTHFFEREPPAASWAVQPHYQLPTAFRAEWEPPEARAPSATPRPLHLGFLCEYDALPGIGHACGHNLIAEVGAAAALGVRGALEGLPRPPPPVKVVVLGTPAEEDGGGKIDLIEAGAFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWRVHGIIKNGGVKPN----IIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALASGCTVEIKGGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDTMLNGPSGSTDFGNVSFVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIREDFKLKL 426          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Xenopus
Match: galc (galactosylceramidase [Source:Xenbase;Acc:XB-GENE-1000107])

HSP 1 Score: 229.565 bits (584), Expect = 2.327e-69
Identity = 146/404 (36.14%), Postives = 217/404 (53.71%), Query Frame = 1
Query:  175 CFQQIWIRNRMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAE-GFQVTRNFILETGFKAEYQT------SEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIK--CKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQ 1350
            C  ++      KQ     I  + + L  +  ++W  PEL  +E+ AHE LT  F +  G+ +  ++ L+T F+AE+ T      S+  H+ + CEYDALP+LGHACGHNLIAE    AA GL+ A++        K+TVLG+PAEE+ GGKI +I+     D+ V  M HP + D+ ++P  A  D+ + + G+++HA A PWEG NALDA  LAY  ++ LR+ M+P    +  +K   + P+    IIP  + +E  LRAPS+++L++L  +     K AA    C V          N++ +  L   F                   STD GNVS V+P IHP F+IGS    HTEE+ +  G + A    +  AK LA T +DV  +  LL ++ +DF+
Sbjct:   12 CSAELSALEACKQRAAERIQEEAESLCELSRDIWSRPELAYQEQQAHETLTRFFSSRAGWLLEPHYKLDTAFRAEWSTPLTDNLSQPLHVGFLCEYDALPSLGHACGHNLIAEVGAAAALGLQGALQCSQPPRPVKITVLGTPAEEDGGGKIDLIEAGAFVDMHVVFMAHPAQEDAAYLPDVAEHDVTVKYYGKASHAAAYPWEGVNALDAAILAYNNLSVLRQQMKPTWRAHGIIKNGGVKPN----IIPSYSELEFYLRAPSLKELTKLQEKADACFKAAAAATGCRVT--------PNILQSSFLTLGFS------------------STDFGNVSFVVPGIHPYFYIGSDALNHTEEYTEAAGSKEAQFYALRTAKALAMTALDVLFNPDLLANVCEDFK 385          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Mouse
Match: Pm20d2 (peptidase M20 domain containing 2 [Source:MGI Symbol;Acc:MGI:2685270])

HSP 1 Score: 263.848 bits (673), Expect = 1.675e-82
Identity = 154/404 (38.12%), Postives = 227/404 (56.19%), Query Frame = 1
Query:  205 MKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAE----GFQVTRNFILETGFKAEYQTSEKP------HIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIK--CKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHF--QNVTRTG--GSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTL 1359
            +K+     I+   + L ++   +W  PEL  +E  AH  LT  FE E     + V  +F L T F+AE+   E         + + CEYDALP LGHACGHNLIAE  V AA GL+ A+E+       K+ VLG+PAEE+ GGKI +I+    +++DV  M HP + ++ ++P  A  D+ + + G+++HA A PWEG NALDA  LAY  ++ LR+ M+P   V+  +K   + P+    IIP  + +    RAPS+++L  L  + +   + AAL   C VD+      Y N++ NK L +A+  N    G+ F  ++    G  GSTD GNVS V+P IHP F+IG+    HTE++ +  G +AA   T+  AK LA T +DV     LLE ++K+F+  L
Sbjct:   22 LKRRAAERIDEAAERLGALSRAIWSAPELAYEEHRAHGELTRFFECEPPAASWAVQPHFGLPTAFRAEWAPPESAAGPRALQVAFLCEYDALPALGHACGHNLIAEVGVAAALGLRAALESIAAPPPVKVIVLGTPAEEDGGGKIDLIEAGAFENLDVVFMAHPSQENAAYLPDVAEHDVTVKYYGKASHAAAYPWEGVNALDAAVLAYTNLSVLRQQMKPTWRVHGIIKNGGVKPN----IIPSYSELVYYFRAPSMKELQVLTKKAEDCFRAAALATGCTVDIESEAHDYYNVIPNKTLCSAYTENGKKLGMEFISEDAVLNGPSGSTDFGNVSFVVPGIHPYFYIGTDALNHTEQYTEAAGSQAAQLYTLRTAKALAMTALDVIFKPALLEGVRKEFKCKL 421          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Mouse
Match: Pm20d2 (peptidase M20 domain containing 2 [Source:MGI Symbol;Acc:MGI:2685270])

HSP 1 Score: 185.652 bits (470), Expect = 3.680e-54
Identity = 108/287 (37.63%), Postives = 161/287 (56.10%), Query Frame = 1
Query:  205 MKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAE----GFQVTRNFILETGFKAEYQTSEKP------HIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIK--CKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFE 1020
            +K+     I+   + L ++   +W  PEL  +E  AH  LT  FE E     + V  +F L T F+AE+   E         + + CEYDALP LGHACGHNLIAE  V AA GL+ A+E+       K+ VLG+PAEE+ GGKI +I+    +++DV  M HP + ++ ++P  A  D+ + + G+++HA A PWEG NALDA  LAY  ++ LR+ M+P   V+  +K   + P+    IIP  + +    RAPS+++L  L  + +   + AAL   C V  F+
Sbjct:   22 LKRRAAERIDEAAERLGALSRAIWSAPELAYEEHRAHGELTRFFECEPPAASWAVQPHFGLPTAFRAEWAPPESAAGPRALQVAFLCEYDALPALGHACGHNLIAEVGVAAALGLRAALESIAAPPPVKVIVLGTPAEEDGGGKIDLIEAGAFENLDVVFMAHPSQENAAYLPDVAEHDVTVKYYGKASHAAAYPWEGVNALDAAVLAYTNLSVLRQQMKPTWRVHGIIKNGGVKPN----IIPSYSELVYYFRAPSMKELQVLTKKAEDCFRAAALATGCTVRAFQ 304          
BLAST of Peptidase M20 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|A3KG59|P20D2_MOUSE (Peptidase M20 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Pm20d2 PE=1 SV=1)

HSP 1 Score: 263.848 bits (673), Expect = 1.172e-81
Identity = 154/404 (38.12%), Postives = 227/404 (56.19%), Query Frame = 1
Query:  205 MKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAE----GFQVTRNFILETGFKAEYQTSEKP------HIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIK--CKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHF--QNVTRTG--GSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTL 1359
            +K+     I+   + L ++   +W  PEL  +E  AH  LT  FE E     + V  +F L T F+AE+   E         + + CEYDALP LGHACGHNLIAE  V AA GL+ A+E+       K+ VLG+PAEE+ GGKI +I+    +++DV  M HP + ++ ++P  A  D+ + + G+++HA A PWEG NALDA  LAY  ++ LR+ M+P   V+  +K   + P+    IIP  + +    RAPS+++L  L  + +   + AAL   C VD+      Y N++ NK L +A+  N    G+ F  ++    G  GSTD GNVS V+P IHP F+IG+    HTE++ +  G +AA   T+  AK LA T +DV     LLE ++K+F+  L
Sbjct:   22 LKRRAAERIDEAAERLGALSRAIWSAPELAYEEHRAHGELTRFFECEPPAASWAVQPHFGLPTAFRAEWAPPESAAGPRALQVAFLCEYDALPALGHACGHNLIAEVGVAAALGLRAALESIAAPPPVKVIVLGTPAEEDGGGKIDLIEAGAFENLDVVFMAHPSQENAAYLPDVAEHDVTVKYYGKASHAAAYPWEGVNALDAAVLAYTNLSVLRQQMKPTWRVHGIIKNGGVKPN----IIPSYSELVYYFRAPSMKELQVLTKKAEDCFRAAALATGCTVDIESEAHDYYNVIPNKTLCSAYTENGKKLGMEFISEDAVLNGPSGSTDFGNVSFVVPGIHPYFYIGTDALNHTEQYTEAAGSQAAQLYTLRTAKALAMTALDVIFKPALLEGVRKEFKCKL 421          
BLAST of Peptidase M20 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q8IYS1|P20D2_HUMAN (Peptidase M20 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=PM20D2 PE=1 SV=2)

HSP 1 Score: 258.455 bits (659), Expect = 1.965e-79
Identity = 146/400 (36.50%), Postives = 221/400 (55.25%), Query Frame = 1
Query:  229 INSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAE----GFQVTRNFILETGFKAEYQTSE--------KP-HIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTV---LGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQN----VTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTL 1359
            I+   + L ++   +W  PEL  +E  AH +LT+ FE E     + V  ++ L T F+AE++  E        +P H+ + CEYDALP +GHACGHNLIAE    AA G++ A+E             LG+PAEE+ GGKI +I+     ++DV  M HP + ++ ++P  A  D+ + + G+++H+ + PWEG NALDA  LAY  ++  R+ M+P   V+  +K   + P+    IIP  + +    RAPS+++L  L  + +   + AAL + C V++      Y N++ NK L  A+  N    GI F +    +    GSTD GNVS V+P IHP F IGS+   HTE++ +  G + A   T+  AK LA T +DV     LLE I++DF+  L
Sbjct:   31 IDEAAERLGALSRAIWSQPELAYEEHHAHRVLTHFFEREPPAASWAVQPHYQLPTAFRAEWEPPEARAPSATPRPLHLGFLCEYDALPGIGHACGHNLIAEVGAAAALGVRGALEGLPRPPPPVKVVVLGTPAEEDGGGKIDLIEAGAFTNLDVVFMAHPSQENAAYLPDMAEHDVTVKYYGKASHSASYPWEGLNALDAAVLAYNNLSVFRQQMKPTWRVHGIIKNGGVKPN----IIPSYSELIYYFRAPSMKELQVLTKKAEDCFRAAALASGCTVEIKGGAHDYYNVLPNKSLWKAYMENGRKLGIEFISEDTMLNGPSGSTDFGNVSFVVPGIHPYFHIGSNALNHTEQYTEAAGSQEAQFYTLRTAKALAMTALDVIFKPELLEGIREDFKLKL 426          
BLAST of Peptidase M20 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|Q501L1|P20D2_XENTR (Peptidase M20 domain-containing protein 2 OS=Xenopus tropicalis OX=8364 GN=pm20d2 PE=2 SV=1)

HSP 1 Score: 252.292 bits (643), Expect = 4.085e-77
Identity = 152/408 (37.25%), Postives = 227/408 (55.64%), Query Frame = 1
Query:  175 CFQQIWIRNRMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAE-GFQVTRNFILETGFKAEYQT------SEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIK--CKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQ----NVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQ 1350
            C  ++      KQ     I  + + L  +  ++W  PEL  +E+ AHE LT  F +  G+ +  ++ L+T F+AE+ T      S+  H+ + CEYDALP+LGHACGHNLIAE    AA GL+ A++        K+TVLG+PAEE+ GGKI +I+     D+ V  M HP + D+ ++P  A  D+ + + G+++HA A PWEG NALDA  LAY  ++ LR+ M+P    +  +K   + P+    IIP  + +E  LRAPS+++L++L  +     K AA    C V++      Y N++ NK L   +  N    G+ F      +    GSTD GNVS V+P IHP F+IGS    HTEE+ +  G + A    +  AK LA T +DV  +  LL ++ +DF+
Sbjct:   12 CSAELSALEACKQRAAERIQEEAESLCELSRDIWSRPELAYQEQQAHETLTRFFSSRAGWLLEPHYKLDTAFRAEWSTPLTDNLSQPLHVGFLCEYDALPSLGHACGHNLIAEVGAAAALGLQGALQCSQPPRPVKITVLGTPAEEDGGGKIDLIEAGAFVDMHVVFMAHPAQEDAAYLPDVAEHDVTVKYYGKASHAAAYPWEGVNALDAAILAYNNLSVLRQQMKPTWRAHGIIKNGGVKPN----IIPSYSELEFYLRAPSLKELTKLQEKADACFKAAAAATGCRVELSSSGHDYYNVLQNKTLAKTYVENGKKLGMQFAADNLALNSLSGSTDFGNVSFVVPGIHPYFYIGSDALNHTEEYTEAAGSKEAQFYALRTAKALAMTALDVLFNPDLLANVCEDFK 415          
BLAST of Peptidase M20 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|P76052|ABGB_ECOLI (p-aminobenzoyl-glutamate hydrolase subunit B OS=Escherichia coli (strain K12) OX=83333 GN=abgB PE=1 SV=1)

HSP 1 Score: 145.591 bits (366), Expect = 8.852e-37
Identity = 128/471 (27.18%), Postives = 200/471 (42.46%), Query Frame = 1
Query:  211 QSIYNYINSKNDILRS----VGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNF-ILETGFKAEYQTSEKPHIVYFCEYDALPNL-----------------GHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLIT--FKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVD----LRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGI-------------------------HFQNVTRTGG-------------------------------STDMGNVSHVIP---SIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTLD 1362
            Q IY +I+   +  R     +  ++W  PE   +E ++ E L +  E+ GF VTRN   +   F A +    KP I    EYDAL  L                 GH CGHNL+  A+  AA  +K  +E +     +   G P EE   GK  M++E V  DVD A+  HP     +      L ++  +  FKG +AHA  SP  G++ALDA TL   G  +L  ++     V+ ++     ++ GI P+    + +    +RAP +  +  +  RV +I +GAALM +  V+   +D+   + + N+ L  A      HFG                             N+  TGG                               STD+G+VS  +P      P F +G+ +  HT + V       AH   ++ AK +AAT V++ +D  LL++ Q++ Q+  D
Sbjct:    2 QEIYRFIDDAIEADRQRYTDIADQIWDHPETRFEEFWSAEHLASALESAGFTVTRNVGNIPNAFIASFGQG-KPVIALLGEYDALAGLSQQAGCAQPTSVTPGENGHGCGHNLLGTAAFAAAIAVKKWLEQYGQGGTVRFYGCPGEEGGSGKTFMVREGVFDDVDAALTWHPEAFAGMFNTR-TLANIQASWRFKGIAAHAANSPHLGRSALDAVTLMTTGTNFLNEHIIEKARVHYAIT----NSGGISPNVVQAQAEVLYLIRAPEMTDVQHIYDRVAKIAEGAALMTETTVEC-RFDKACSSYLPNRTLENAMYQALSHFGTPEWNSEELAFAKQIQATLTSNDRQNSLNNIAATGGENGKVFALRHRETVLANEVAPYAATDNVLAASTDVGDVSWKLPVAQCFSPCFAVGTPL--HTWQLVSQGRTSIAHKGMLLAAKTMAATTVNLFLDSGLLQECQQEHQQVTD 463          
BLAST of Peptidase M20 domain-containing protein 2 vs. UniProt/SwissProt
Match: sp|C5D827|DAPEL_GEOSW (N-acetyldiaminopimelate deacetylase OS=Geobacillus sp. (strain WCH70) OX=471223 GN=GWCH70_0945 PE=3 SV=1)

HSP 1 Score: 76.2554 bits (186), Expect = 1.310e-13
Identity = 87/363 (23.97%), Postives = 150/363 (41.32%), Query Frame = 1
Query:  268 ELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQ-TSEKPHIVYFCEYDALP---------------NLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHM-PHYAL--------------KDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSV-KMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHF-GIHFQNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHD 1257
            +L K PELG +E    + L     A   +       +TG   + + T+ +  I Y  + D LP               N+ HACGH++     +  A GL        I+  L  +  PAEE  GG   M++ +++K      +  P  I +LH+ P Y +               +L I  KG+  HA          + A +L  Q  + + RN+ P     +++ K+   +   +I +   +E  +R  S+  + ++  R++ +V G  +   CE ++ +Y  MY  + ++  L T F   A+++ GI F          D G +   IP    +F++G    P+     K T  EAA D
Sbjct:   13 DLHKIPELGFQEFKTQQYLLRYIHALPQERLEIQTWKTGIFVKVKGTAPRKMIGYRTDIDGLPIKEETGLPYSSEHEGNM-HACGHDV----HMSIALGLLTHFAEHPIQDDLLFIFQPAEEGPGGAKPMLESEIMK------VWKPDMILALHIAPEYPVGTIATKEGLLFANTSELFIDLKGKGGHAAFPHLANDMVVAACSLVTQLQSIVARNVDPLDSAVITIGKISGGTVQNVIAEHARLEGTIRTLSVDSMKKVKERIEAMVSGIKMAYQCEAEI-DYGSMYHQVYNDPELTTEFIQFAENYQGIRFIRCKEAMTGEDFGYMLAEIPGF--MFWLGVD-SPYGLHHAKLTPNEAAID 360          
BLAST of Peptidase M20 domain-containing protein 2 vs. TrEMBL
Match: A0A267FIF1 (Peptidase M20 domain-containing protein 2 (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig017625g3 PE=3 SV=1)

HSP 1 Score: 338.191 bits (866), Expect = 1.974e-108
Identity = 163/390 (41.79%), Postives = 243/390 (62.31%), Query Frame = 1
Query:  199 NRMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSE--KPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTR-TGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTL 1359
             ++K      I+   ++L  V   LW+ PEL L+E+ AH++LT   E+ GF VTR+F+L+TGFKAE+ ++   +PHI   CE+DALP +GHACGHNLIAE +VGA  G+K AME   +  ++TVLG+PAEE+ GGKI+ I+    KDVDVA+M HP ++ ++H+PH ++  L  T+ G+++HA  SPWEG NALDA   AYQ V+ LR+ MRP   V+  VK +      IIP++  ++  +R PS ++L+ L  RV+  ++  A+ + CE  + +    Y +++ N PL  A+  N    G+    +T    GSTDMGNVS+ +P+IHP+F++G     H+ EF ++  L  A   T+ QAK LA TG+D+     LL   +  F+  L
Sbjct:    6 QQLKDVAAAKIDESRELLLGVSSRLWQNPELALEERMAHQLLTETLESSGFSVTRHFVLDTGFKAEFGSAGAGRPHIAVMCEFDALPGIGHACGHNLIAEVAVGAGLGIKAAMEAGGVAGRVTVLGTPAEEHYGGKINFIEAGFFKDVDVALMAHPYKLTAVHVPHLSVAFLRATYTGKASHAAGSPWEGLNALDAAVTAYQSVSNLRQQMRPEWRVHGIVK-EGGQRPNIIPERAVLDYFVRCPSDRELAVLRARVEACLRAGAVASGCECSIEDISRGYSSVICNAPLGAAYSANLTALGVEHVGITELPSGSTDMGNVSYTVPAIHPMFYMGGDAPNHSVEFTRFVNLPEAQPYTLAQAKALAMTGIDILTGPELLAKCEAQFKADL 394          
BLAST of Peptidase M20 domain-containing protein 2 vs. TrEMBL
Match: A0A267DF18 (Peptidase M20 domain-containing protein 2 (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005194g2 PE=3 SV=1)

HSP 1 Score: 337.806 bits (865), Expect = 8.348e-108
Identity = 163/390 (41.79%), Postives = 243/390 (62.31%), Query Frame = 1
Query:  199 NRMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSE--KPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTR-TGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTL 1359
             ++K      I+   ++L  V   LW+ PEL L+E+ AH++LT   E+ GF VTR+F+L+TGFKAE+ ++   +PHI   CE+DALP +GHACGHNLIAE +VGA  G+K AME   +  ++TVLG+PAEE+ GGKI+ I+    KDVDVA+M HP ++ ++H+PH ++  L  T+ G+++HA  SPWEG NALDA   AYQ V+ LR+ MRP   V+  VK +      IIP++  ++  +R PS ++L+ L  RV+  ++  A+ + CE  + +    Y +++ N PL  A+  N    G+    +T    GSTDMGNVS+ +P+IHP+F++G     H+ EF ++  L  A   T+ QAK LA TG+D+     LL   +  F+  L
Sbjct:    6 QQLKDVAAAKIDESRELLLGVSSRLWQNPELALEERMAHQLLTETLESSGFSVTRHFVLDTGFKAEFGSAGAGRPHIAVMCEFDALPGIGHACGHNLIAEVAVGAGLGIKAAMEAGGVAGRVTVLGTPAEEHYGGKINFIEAGFFKDVDVALMAHPYKLTAVHVPHLSVAFLRATYTGKASHAAGSPWEGLNALDAAVTAYQSVSNLRQQMRPEWRVHGIVK-EGGQRPNIIPERAVLDYFVRCPSDRELAVLRARVEACLRAGAVASGCECSIEDISRGYSSVICNAPLGAAYSANLTALGVEHVGITELPSGSTDMGNVSYTVPAIHPMFYMGGDAPNHSVEFTRFVNLPEAQPYTLAQAKALAMTGIDILTGPELLAKCEAQFKADL 394          
BLAST of Peptidase M20 domain-containing protein 2 vs. TrEMBL
Match: A0A267F5F1 (Peptidase M20 domain-containing protein 2 (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005194g1 PE=3 SV=1)

HSP 1 Score: 333.569 bits (854), Expect = 1.101e-106
Identity = 168/391 (42.97%), Postives = 237/391 (60.61%), Query Frame = 1
Query:  199 NRMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSE--KPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGI-HFQNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTLD 1362
             ++K      I+   ++L SV   LW+ PEL L+E+ AH++LT   E+ GF VTR+F+L+TGFKAE+ ++   +PHI   CE+DALP +GHACGHNLIAE +VGA  G+K AME   +  ++TVLG+PAEE +GGKI+MI     KDVDVA+M HP  + ++H  H +L  + + F G+++HA  SPWEG NALDA   AYQ V+ LR+ MRP+  V+  VK +      IIP++  +E   RA +      L  +VKQ +  AA+   CE  + E +  Y+N++ N+ L  A+  N    G+ H Q      GSTDMGNVS+ +PSIHP+FFIG     H+  F    G   A    + QAK LA TG+DV  +  L++   + F + L 
Sbjct:    7 QQLKDVAAAKIDESRELLLSVSSRLWQNPELALEERMAHQLLTETLESSGFSVTRHFVLDTGFKAEFGSAGAGRPHIAVMCEFDALPGIGHACGHNLIAEVAVGAGLGIKAAMEAGGLAGRVTVLGTPAEEAQGGKINMINAGFFKDVDVALMAHPDRMTTVHSAHLSLSSIEVIFTGKASHAAGSPWEGLNALDAAVTAYQSVSNLRQQMRPDWRVHGIVK-EGGQRPNIIPERAVLEYCTRASTGGDSQLLLNKVKQCMHAAAMATGCECLISESEPEYKNVIPNRALAGAYSANLRALGVEHTQLYPEPTGSTDMGNVSYEVPSIHPMFFIGGDAATHSAGFAVLAGAAEAQRYVLEQAKALAMTGIDVLTEPALVQRCWETFHEDLS 396          
BLAST of Peptidase M20 domain-containing protein 2 vs. TrEMBL
Match: A0A267G537 (Peptidase M20 domain-containing protein 2 (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig012277g2 PE=3 SV=1)

HSP 1 Score: 333.183 bits (853), Expect = 1.809e-106
Identity = 163/388 (42.01%), Postives = 237/388 (61.08%), Query Frame = 1
Query:  199 NRMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTR-TGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTL 1359
             ++K      I+   ++L SV   LW+ PEL L+E+ AH++LT   E+ GF VTR+F+L+TGFKAE+  S +PHI   CE+DALP +GHACGHNLIAE +VGA  G+K AME   +  ++TVLG+PAEE  GGKI MI+     DVDVAMM HP ++        +++   +TF G+++HA  SPWEG NALDA   AYQ V+ LR+ MRP+  V+  VK +      IIP++  ++  +R PS ++L+ L  RV+  ++  A+ + CE  + +    Y +++ N PL  A+  N    G+    +T    GSTDMGNVS+ +P+IHP+F++G     H+ EF ++  L  A   T+ QAK LA TG+D+     LL   +  F+  L
Sbjct:   10 QQLKDVAAAKIDESRELLLSVSSRLWQNPELALEERMAHQLLTETLESSGFSVTRHFVLDTGFKAEF-GSARPHIAVMCEFDALPGIGHACGHNLIAEVAVGAGLGIKAAMEAGGLSGRVTVLGTPAEEAHGGKIDMIRSAFFTDVDVAMMAHPYKLTVARPRALSIQAFDVTFTGKASHAAGSPWEGLNALDAAVTAYQSVSNLRQEMRPDWRVHGIVK-EGGQRPNIIPERAVLDYFVRCPSDRELAVLRARVEACLRAGAVASGCECSIEDISRGYSSVICNAPLGAAYSANLTALGVEHVGITELPSGSTDMGNVSYTVPAIHPMFYMGGDAPNHSVEFTRFVNLPEAQPYTLAQAKALAMTGIDILTGPELLAKCEAQFKADL 395          
BLAST of Peptidase M20 domain-containing protein 2 vs. TrEMBL
Match: A0A1I8H9I6 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=4 SV=1)

HSP 1 Score: 338.576 bits (867), Expect = 5.373e-104
Identity = 163/389 (41.90%), Postives = 243/389 (62.47%), Query Frame = 1
Query:  202 RMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSE--KPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTR-TGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTL 1359
            ++K      I+   ++L  V   LW+ PEL L+E+ AH++LT   E+ GF VTR+F+L+TGFKAE+ ++   +PHI   CE+DALP +GHACGHNLIAE +VGA  G+K AME   +  ++TVLG+PAEE+ GGKI+ I+    KDVDVA+M HP ++ ++H+PH ++  L  T+ G+++HA  SPWEG NALDA   AYQ V+ LR+ MRP   V+  VK +      IIP++  ++  +R PS ++L+ L  RV+  ++  A+ + CE  + +    Y +++ N PL  A+  N    G+    +T    GSTDMGNVS+ +P+IHP+F++G     H+ EF ++  L  A   T+ QAK LA TG+D+     LL   +  F+  L
Sbjct:  381 QLKDVAAAKIDESRELLLGVSSRLWQNPELALEERMAHQLLTETLESSGFSVTRHFVLDTGFKAEFGSAGAGRPHIAVMCEFDALPGIGHACGHNLIAEVAVGAGLGIKAAMEAGGLAGRVTVLGTPAEEHYGGKINFIEAGFFKDVDVALMAHPYKLTAVHVPHLSVAFLRATYTGKASHAAGSPWEGLNALDAAVTAYQSVSNLRQQMRPEWRVHGIVK-EGGQRPNIIPERAVLDYFVRCPSDRELAVLRARVEACLRAGAVASGCECSIEDISRGYSSVICNAPLGAAYSANLTALGVEHVGITELPSGSTDMGNVSYTVPAIHPMFYMGGDAPNHSVEFTRFVNLPEAQPYTLAQAKALAMTGIDILTGPELLAKCEAQFKADL 768          

HSP 2 Score: 322.013 bits (824), Expect = 9.499e-98
Identity = 166/383 (43.34%), Postives = 233/383 (60.84%), Query Frame = 1
Query:  199 NRMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSE--KPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGI-HFQNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVL-LEDI 1335
             ++K      I+   ++L SV   LW+ PEL L+E+ AH++LT   E+ GF VTR+F+L+TGFKAE+ ++   +PHI   CE+DALP + HACGHNLIAE +VGA  G+K AME   +  ++TVLG+PAEE +GGKI+MI     KDVDVA+M HP  + ++H  H +L  + + F G+++HA  SP EG NALDA   AYQ V+ LR+ MRP+  V+  VK +      IIP++  +E   RA +      L  +VKQ +  AA+   CE  + E +  Y+N++ N+ L  A+  N    G+ H Q      GSTDMGNVS+ +PSIHP+FFIG     H+  F    G   A    + QAK LA TG+DV  +  L L+D+
Sbjct:    4 QQLKDVAAAKIDESRELLLSVSSRLWQNPELALEERMAHQLLTETLESSGFSVTRHFVLDTGFKAEFGSAGAGRPHIAVMCEFDALPGIRHACGHNLIAEVAVGAGLGIKAAMEAGGVAGRVTVLGTPAEEAQGGKINMINAGFFKDVDVALMAHPDRMTTVHSAHLSLSSIEVIFTGKASHAAGSPREGLNALDAAVTAYQSVSNLRQQMRPDWRVHGIVK-EGGQRPNIIPERAVLEYCTRASTGGDSQLLLNKVKQCMHAAAMATGCECLISESEPEYKNVIPNRALAGAYSANLRALGVEHTQLYPEPTGSTDMGNVSYEVPSIHPMFFIGGDTATHSAGFAVLAGAAEAQRYVLEQAKALAMTGIDVLTEPALQLKDV 385          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Cavefish
Match: PM20D2 (peptidase M20 domain-containing protein 2-like [Source:NCBI gene;Acc:103044189])

HSP 1 Score: 293.893 bits (751), Expect = 1.626e-94
Identity = 155/390 (39.74%), Postives = 233/390 (59.74%), Query Frame = 1
Query:  202 RMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIF-EAEGFQVTRNFILETGFKAEY-----QTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENF-NIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHF-QNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDF 1347
            R+KQ I   ++   + L ++   +W  PEL  +EK +H++L  +F E  G+ V  +F+++T F+A +     +T    ++ + CEYDALP LGHACGHNLIAEA VGAA GLK A+EN  +I  K+TVLG+PAEE+ GGKI +IK     D+DV  M HP + D    P  A+ +  + ++G+++HA A PWEG NALDA  LAY  ++ LR+ ++P+  ++  ++    +   IIPD T ME  +R P ++ LS+L  +V+     AAL   C+V++   +  Y N++ N  L   ++ N    G+ F ++ +   GSTD GNVS V+P IHP F+IG+    HT E+    G E A   T+  AK LA T  DV +D  LL+ ++ +F
Sbjct:   11 RLKQEISECVDQCREKLHALSQGIWSRPELAYQEKHSHDLLVALFSEVGGWTVEPSFVVDTAFRATWCRSVGETRRPVNVGFLCEYDALPALGHACGHNLIAEAGVGAALGLKGALENQPHIPVKITVLGTPAEEDRGGKIDLIKAGAFADMDVVFMAHPAQEDKAFSPCIAITNCNVKYRGKASHAAAYPWEGVNALDAAVLAYSSLSVLRQQLKPDWRLHGIIRHG-GTKPNIIPDYTEMEYYIRTPLLKNLSDLKDKVEACFHSAALATGCQVEINYPNPAYSNILQNTILEKLYEENGSSVGMKFNKDSSNFSGSTDFGNVSFVVPGIHPFFYIGTDALNHTPEYTVAAGSEKAQMYTLRTAKALAMTAADVLLDPALLKQVKDEF 399          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Cavefish
Match: PM20D2 (peptidase M20 domain-containing protein 2-like [Source:NCBI gene;Acc:103044189])

HSP 1 Score: 290.426 bits (742), Expect = 4.545e-93
Identity = 155/390 (39.74%), Postives = 231/390 (59.23%), Query Frame = 1
Query:  202 RMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIF-EAEGFQVTRNFILETGFKAEY-----QTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENF-NIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHF-QNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDF 1347
            R+KQ I   ++   + L ++   +W  PEL  +EK +H++L  +F E  G+ V  +F+++T F+A +     +T    ++ + CEYDALP LGHACGHNLIAEA VGAA GLK A+EN  +I  K+TVLG+PAEE+ GGKI +IK     D+DV  M HP + D    P  A+ +  + ++G+++HA A PWEG NALDA  LAY  ++ LR+ ++P+  ++  ++    +   IIPD T ME  +R P ++ LS+L  +V+     AAL   C+V++   +  Y N++ N  L   ++ N    G+ F ++ +   GSTD GNVS V+P IHP F+IG+    HT E+    G E A   T+  AK LA T  DV +D  LL+ +   F
Sbjct:   11 RLKQEISECVDQCREKLHALSQGIWSRPELAYQEKHSHDLLVALFSEVGGWTVEPSFVVDTAFRATWCRSVGETRRPVNVGFLCEYDALPALGHACGHNLIAEAGVGAALGLKGALENQPHIPVKITVLGTPAEEDRGGKIDLIKAGAFADMDVVFMAHPAQEDKAFSPCIAITNCNVKYRGKASHAAAYPWEGVNALDAAVLAYSSLSVLRQQLKPDWRLHGIIRHG-GTKPNIIPDYTEMEYYIRTPLLKNLSDLKDKVEACFHSAALATGCQVEINYPNPAYSNILQNTILEKLYEENGSSVGMKFNKDSSNFSGSTDFGNVSFVVPGIHPFFYIGTDALNHTPEYTVAAGSEKAQMYTLRTAKALAMTAADVLLDPALLKQLLLPF 399          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Cavefish
Match: PM20D2 (peptidase M20 domain-containing protein 2-like [Source:NCBI gene;Acc:103044189])

HSP 1 Score: 289.656 bits (740), Expect = 6.558e-93
Identity = 154/384 (40.10%), Postives = 229/384 (59.64%), Query Frame = 1
Query:  202 RMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIF-EAEGFQVTRNFILETGFKAEY-----QTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENF-NIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHF-QNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLE 1329
            R+KQ I   ++   + L ++   +W  PEL  +EK +H++L  +F E  G+ V  +F+++T F+A +     +T    ++ + CEYDALP LGHACGHNLIAEA VGAA GLK A+EN  +I  K+TVLG+PAEE+ GGKI +IK     D+DV  M HP + D    P  A+ +  + ++G+++HA A PWEG NALDA  LAY  ++ LR+ ++P+  ++  ++    +   IIPD T ME  +R P ++ LS+L  +V+     AAL   C+V++   +  Y N++ N  L   ++ N    G+ F ++ +   GSTD GNVS V+P IHP F+IG+    HT E+    G E A   T+  AK LA T  DV +D  LL+
Sbjct:   11 RLKQEISECVDQCREKLHALSQGIWSRPELAYQEKHSHDLLVALFSEVGGWTVEPSFVVDTAFRATWCRSVGETRRPVNVGFLCEYDALPALGHACGHNLIAEAGVGAALGLKGALENQPHIPVKITVLGTPAEEDRGGKIDLIKAGAFADMDVVFMAHPAQEDKAFSPCIAITNCNVKYRGKASHAAAYPWEGVNALDAAVLAYSSLSVLRQQLKPDWRLHGIIRHG-GTKPNIIPDYTEMEYYIRTPLLKNLSDLKDKVEACFHSAALATGCQVEINYPNPAYSNILQNTILEKLYEENGSSVGMKFNKDSSNFSGSTDFGNVSFVVPGIHPFFYIGTDALNHTPEYTVAAGSEKAQMYTLRTAKALAMTAADVLLDPALLK 393          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Cavefish
Match: PM20D2 (peptidase M20 domain containing 2 [Source:HGNC Symbol;Acc:HGNC:21408])

HSP 1 Score: 199.904 bits (507), Expect = 2.642e-59
Identity = 104/275 (37.82%), Postives = 163/275 (59.27%), Query Frame = 1
Query:  538 FNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQK 1353
             N +  +TVLG+PAEE+ GGKI +++E   + +DV +M HP + D+ ++P  A  D+++ + GR++HA+A PWEG NALDA  +AY  ++ LR+ +RP+  ++  +K   + P+    IIPD T +E  LR PS + L+ +  + +   + AA+   CEV V   +E YE ++ N+ L   ++ N    G+ F     + GSTD GNV+H  P IHP F+IGS    HTEE+   +G   A   T+  AK LA T VDV     +LE ++++F +
Sbjct:   31 LNCRIPVTVLGTPAEEDGGGKIDLLREGAFEGLDVVLMAHPSQEDTTYIPDVAEHDVVVKYHGRASHASAYPWEGVNALDAAVMAYSSLSVLRQQLRPDWRIHGIIKHGGVKPN----IIPDYTELEYYLRTPSHRDLATIRAKAEACFRAAAMATGCEVSVLLDNEFYE-ILRNRTLEDLYEENGKALGMKFI-TDDSSGSTDFGNVTHSAPGIHPYFYIGSDALNHTEEYTAASGEYEAQFFTLRAAKALAMTAVDVLFSPSVLERVKQEFTE 299          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO47269 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RMG7])

HSP 1 Score: 293.508 bits (750), Expect = 6.724e-95
Identity = 157/394 (39.85%), Postives = 233/394 (59.14%), Query Frame = 1
Query:  193 IRNRMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQV-TRNFILETGFKAEYQTSEKPHIV-YFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKC-KLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDV-FEYDEMYENLVSNKPLLTAFKLNADHFGIHF----QNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQ 1350
            + + +K+S    I+++   L  +   +W  PELG +E +AH  L   FE  GF+V      LET F+A   +S++   V   CEYDALP +GHACGHNLI+EA VG A GLK A+E       ++ +LG+PAEE+ GGK+ MI +    D+D+ MMVHP+ ++ ++    A +D+ +TF G S+HA A PWEG+NALDA  LAY  ++ LR+ M+P   V+  V  +  +   IIPD  +M   +R P    +  L  +V    K AAL   C  D+ +     Y NLV+N  L   ++ +A+ FG+ +    + V    GSTDMGNVSH+ P+IHP + IG+ V  HT EF +    + AH+ T+ QAKILA   ++V  +K++ E++Q+DF+
Sbjct:    1 MADALKKSALEAIDNRAKDLFDLNQRIWNKPELGFQEFYAHSQLVEFFENAGFEVDNTQGGLETAFRASIGSSKEGITVGIMCEYDALPGIGHACGHNLISEAGVGCALGLKAALEASAAPIGRVVILGTPAEEDGGGKVKMIDKGCFDDIDICMMVHPKPLNCVYATCLAREDVTVTFHGHSSHAAAFPWEGRNALDAVVLAYNSISALRQQMKPTWRVH-GVVTNGGAKPNIIPDSASMSYYIRTPLENDIKVLHQKVHACFKAAALATGCTADIKWNTTPFYSNLVTNNALAKLYQTHAESFGLKYPPKSEQVKIPFGSTDMGNVSHIKPAIHPYYDIGTDVANHTAEFAEAAKTKVAHESTLKQAKILAMVAIEVMTNKLVWEEVQQDFR 393          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO45341 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RT88])

HSP 1 Score: 265.003 bits (676), Expect = 6.972e-84
Identity = 145/389 (37.28%), Postives = 216/389 (55.53%), Query Frame = 1
Query:  202 RMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKC-KLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHF----QNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQK 1353
            ++KQ     I+     L  +   +WK PE+  KE+ AHE+LT+    +GF VTR + ++T F A Y   + P +  FCEYDALP +GHACGHNLIAEA V A+ G+K AM++       L V G+PAEE+ GGKI M+      +VD AMMVHP   D L     +   L + +KG +AHA A P EG NALDA  +AY  ++ LR+ M+P   V+  + ++      IIPD+T +E  +R    + +  L  +V    +GAA    C ++   + E Y+ +  N  L+  ++ NA+  G+ F    +  T   GSTDMGNVS V+P+IHP++ I +    H+  F    G + AH  T++ AK +A T +DV        ++++ F +
Sbjct:   11 KLKQVACEAIDKNASELHELNKHIWKHPEVAYKERNAHEILTSYLAIKGFDVTRQWTMDTAFGARYGIPKGPCVGIFCEYDALPLVGHACGHNLIAEAGVAASIGIKAAMDSVEEPLGNLLVAGTPAEESGGGKIQMLDSGCFSEVDFAMMVHPCPFDVLQHSFLSCATLEVIYKGHAAHAAAFPSEGVNALDAAIMAYNNISTLRQQMKPAWRVH-GIIVEGGVKPNIIPDRTKLEYSVRTEDDKDMETLKHKVMACFEGAAQATGCSLET-SWKEEYKTVKHNPKLVQLYQGNAESLGVKFLTKEEAATLGSGSTDMGNVSQVLPAIHPMYGIETKEVNHSHGFTAAAGTDVAHQKTLIAAKAMAMTTIDVICCPDTFAEMKRQFAR 397          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO49722 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RFH7])

HSP 1 Score: 254.218 bits (648), Expect = 1.072e-79
Identity = 132/379 (34.83%), Postives = 208/379 (54.88%), Query Frame = 1
Query:  229 INSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFI-LETGFKAEYQTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTR----TGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQ 1350
            + S +  L  + + +W  PELG KE FAH+ LT+  E++GFQVTR +  LET F+AE+ +   P + + CEYDALP + H CGHNLIAEA V +   +K  +       K+ V+G+PAEE EGGKI +I       +D+ +M HP   +  +    +L  +  TF G + HA ASPW G NALDA   AY G++ LR+ ++P   V+  +  D  +   +IP +  + + +R  +    + L  +++ I++ A +      ++      + ++ +N  L   ++  A+  G  F +         GSTDMGNV+  +P IHP++ I   V  HT EF K  G  +AHD T++ A+ LA T ++V  D  LL   +++F+
Sbjct:   15 VASHSQELYELSHRIWNKPELGYKEFFAHQQLTDFLESKGFQVTRQYGGLETAFRAEFGSGSGPTVAFLCEYDALPEVDHGCGHNLIAEAGVASGLAIKEVVSRTG-NGKVVVMGTPAEEGEGGKIDLINAGCFTGIDLCLMAHPAPFNVAYYRSQSLAKVTATFHGLATHAAASPWCGINALDAAVTAYNGISMLRQQLKPTWRVH-GIFTDAGTKPSVIPQRAELALFVRTTTNPDFNILKQKIQNILESAEMSTGVTAEIKWLSNAFASMETNPTLAGVYQKQAEGLGEEFMSREEQEAIVDGSTDMGNVTLEVPGIHPLYCIDPKVAYHTHEFRKAAGTRSAHDKTLITARALARTAIEVMHDAELLNQAREEFR 391          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Nematostella
Match: EDO32545 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SUT4])

HSP 1 Score: 243.817 bits (621), Expect = 4.895e-76
Identity = 153/376 (40.69%), Postives = 214/376 (56.91%), Query Frame = 1
Query:  250 LRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSEK-PHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKC-KLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLI-TFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNV----TRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKT 1356
            LR +  ++W+ PE   +EKFAH++LT+  E +GF VTR++ LET F A     +  P +   CEYDALP +GHACGHNLIAEA   A  G+K A+   N K  KL V+G+PAEE  GGK+ MI     K VD  MMVHP  ID+  +P    +D +I T++G +AHA A PWEG NALDA  +AY  ++ +R+ M+P   V+ S+  +      IIPDKT +E+ LRAP  Q L +L  +V   ++GAA                            ++ +A+  G+ F ++     +  GSTDMGNVSHV+PSIHP++ I S    H+  F      + AH+ T+V AK +A T +D+  +K L E  +K F  T
Sbjct:   22 LRQLSKQIWENPEENFEEKFAHKVLTDFLEEKGFDVTRSWTLETAFVARSGNGDDGPCVGVICEYDALPEVGHACGHNLIAEAGAAAGIGIKAALAAANNKLGKLLVIGTPAEEGGGGKVKMIDNGCFKGVDFCMMVHPAPIDTT-VPLVLARDAVIATYRGHAAHAAAFPWEGINALDAVVMAYTSISAMRQQMKPTWRVH-SIIAEGGVKPNIIPDKTKLEIYLRAPDDQDLQQLKEKVIGCLEGAA-----------------------KATATYQSHAESLGVEFPSLEEQKNKMIGSTDMGNVSHVLPSIHPIYSIDSMAVNHSYAFTAAANTDVAHEKTLVAAKSMAMTAIDLLCNKELREQAKKQFTAT 372          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Medaka
Match: PM20D2 (peptidase M20 domain-containing protein 2 [Source:NCBI gene;Acc:101158110])

HSP 1 Score: 264.233 bits (674), Expect = 5.110e-83
Identity = 146/401 (36.41%), Postives = 231/401 (57.61%), Query Frame = 1
Query:  202 RMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIF-EAEGFQVTRNFILETGFKAEYQTS--EKPHIV---YFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMEN---FNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQN----VTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKT 1356
            ++K  + + I+     L S+  ++W CPEL  +E  +H+ L   F + EG++V  +F L+T F+A + ++   + H V   + CEYDALP +GHACGHNLIAE    AA GLK  +E+     ++ K+TVLG+PAEE+ GGK+ M++E   + +DV  M HP + D+ ++P  + +D+ + + G++AHA+A PW G NALDA  L Y  ++  R+ M+P+  V+  +K   + P+    IIPD T +E  LR PS  +L  L  + +   + AA+   CEV++      Y+N++ N  L   ++ N    G+ F      +    GSTD GNV+  +P IHP F+IGS    HT E+    G E A    +  AK LA T +D+ +D  LL+ ++++F +T
Sbjct:    5 QLKHKVSSCIDDNKTKLHSLSQDIWSCPELAYQEVKSHDRLVAFFHQEEGWRVDSHFKLDTAFRACWHSAGVAQGHEVSLGFLCEYDALPGIGHACGHNLIAEVGAAAAIGLKATLEDEHKLPVQVKVTVLGTPAEEDGGGKVDMLREGAFEGLDVVFMAHPSKEDATYLPCVSEQDVTVKYHGKAAHASAYPWRGINALDAAVLCYNNLSAFRQQMKPDWRVHGIIKNGGVKPN----IIPDFTELEYYLRTPSRTELPILKAKAESCFRSAAMATGCEVEIEFTRNQYDNILRNSALEELYERNGTALGMTFTTDEDVLKNESGSTDFGNVTFAVPGIHPYFYIGSDALNHTAEYTAAAGDERAQFFALRVAKALAMTALDLLLDPELLQKVKQEFMET 401          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Medaka
Match: PM20D2 (peptidase M20 domain-containing protein 2 [Source:NCBI gene;Acc:101158110])

HSP 1 Score: 261.151 bits (666), Expect = 1.628e-81
Identity = 145/396 (36.62%), Postives = 228/396 (57.58%), Query Frame = 1
Query:  217 IYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIF-EAEGFQVTRNFILETGFKAEYQTS--EKPHIV---YFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMEN---FNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQN----VTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKT 1356
            + + I+     L S+  ++W CPEL  +E  +H+ L   F + EG++V  +F L+T F+A + ++   + H V   + CEYDALP +GHACGHNLIAE    AA GLK  +E+     ++ K+TVLG+PAEE+ GGK+ M++E   + +DV  M HP + D+ ++P  + +D+ + + G++AHA+A PW G NALDA  L Y  ++  R+ M+P+  V+  +K   + P+    IIPD T +E  LR PS  +L  L  + +   + AA+   CEV++      Y+N++ N  L   ++ N    G+ F      +    GSTD GNV+  +P IHP F+IGS    HT E+    G E A    +  AK LA T +D+ +D  LL+ ++++F +T
Sbjct:   32 VSSCIDDNKTKLHSLSQDIWSCPELAYQEVKSHDRLVAFFHQEEGWRVDSHFKLDTAFRACWHSAGVAQGHEVSLGFLCEYDALPGIGHACGHNLIAEVGAAAAIGLKATLEDEHKLPVQVKVTVLGTPAEEDGGGKVDMLREGAFEGLDVVFMAHPSKEDATYLPCVSEQDVTVKYHGKAAHASAYPWRGINALDAAVLCYNNLSAFRQQMKPDWRVHGIIKNGGVKPN----IIPDFTELEYYLRTPSRTELPILKAKAESCFRSAAMATGCEVEIEFTRNQYDNILRNSALEELYERNGTALGMTFTTDEDVLKNESGSTDFGNVTFAVPGIHPYFYIGSDALNHTAEYTAAAGDERAQFFALRVAKALAMTALDLLLDPELLQKVKQEFMET 423          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Medaka
Match: ENSORLT00000018484.2 (peptidase M20 domain-containing protein 2 [Source:NCBI gene;Acc:101173825])

HSP 1 Score: 243.047 bits (619), Expect = 7.054e-75
Identity = 146/402 (36.32%), Postives = 221/402 (54.98%), Query Frame = 1
Query:  199 NRMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAE--GFQVTRNFILETGFKAEY-QTSEKP-------HIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMEN---FNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHF-QNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQK 1353
             +MK ++  +I+S  D L S+  ++W  PEL   E  AH+ L   F      + V  +F L T F+A +     +P       ++ + CEYDALP+LGHACGHNLIAE    AA GLK A++      +  K+TVLG+PAEE  GGKI +I+     D+D+  M HP + D+  +P   ++++ + + G+++HA+A PWEG NALDA  LAY  ++ LR+ ++P   ++  +K   + P+    IIP    +E  LR P ++ L  L  + +   + AAL   C+V++      Y N++ N  L   ++ N    GI F +      GSTD GNVS ++P IH  F IGS+   HT+E+ +  G E A   T+  AK LA T VDV     LL+  ++DF +
Sbjct:    5 QQMKDTLQIHIDSIQDELNSLSQDIWSHPELAGNETKAHDRLVRFFSQRDGAWTVESHFKLPTAFRASWGPVGGEPKEGNTVLNVGFLCEYDALPDLGHACGHNLIAEVGAAAAVGLKAALDRQSELPVSVKITVLGTPAEEAIGGKIDLIQAGAFSDLDLVFMAHPAQQDASFLPTVTIEEVTVKYHGKASHASAYPWEGVNALDAAVLAYNNLSALRQQLKPEWRLHGIIKNGGVKPN----IIPAYAELEFYLRTPLLKDLLNLKAKAEACFRAAALATGCQVEIIYPSHTYYNILPNATLANLYESNGKTLGIEFPEQPDLFSGSTDFGNVSFIVPGIHAFFSIGSAALNHTKEYTEAAGAEKAQLFTLRTAKALAMTAVDVVCRPDLLQQTREDFSR 402          
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Medaka
Match: PM20D2 (peptidase M20 domain-containing protein 2 [Source:NCBI gene;Acc:101158110])

HSP 1 Score: 207.994 bits (528), Expect = 1.577e-62
Identity = 107/283 (37.81%), Postives = 170/283 (60.07%), Query Frame = 1
Query:  202 RMKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIF-EAEGFQVTRNFILETGFKAEYQTS--EKPHIV---YFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMEN---FNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVK---MDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDV 1014
            ++K  + + I+     L S+  ++W CPEL  +E  +H+ L   F + EG++V  +F L+T F+A + ++   + H V   + CEYDALP +GHACGHNLIAE    AA GLK  +E+     ++ K+TVLG+PAEE+ GGK+ M++E   + +DV  M HP + D+ ++P  + +D+ + + G++AHA+A PW G NALDA  L Y  ++  R+ M+P+  V+  +K   + P+    IIPD T +E  LR PS  +L  L  + +   + AA+   CE D+
Sbjct:    5 QLKHKVSSCIDDNKTKLHSLSQDIWSCPELAYQEVKSHDRLVAFFHQEEGWRVDSHFKLDTAFRACWHSAGVAQGHEVSLGFLCEYDALPGIGHACGHNLIAEVGAAAAIGLKATLEDEHKLPVQVKVTVLGTPAEEDGGGKVDMLREGAFEGLDVVFMAHPSKEDATYLPCVSEQDVTVKYHGKAAHASAYPWRGINALDAAVLCYNNLSAFRQQMKPDWRVHGIIKNGGVKPN----IIPDFTELEYYLRTPSRTELPILKAKAESCFRSAAMATGCEEDL 283          
BLAST of Peptidase M20 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000049098.1 (SMESG000049098.1)

HSP 1 Score: 834.328 bits (2154), Expect = 0.000e+0
Identity = 399/399 (100.00%), Postives = 399/399 (100.00%), Query Frame = 1
Query:  205 MKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTLDNNFSDIDYNDLYN 1401
            MKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTLDNNFSDIDYNDLYN
Sbjct:    1 MKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTLDNNFSDIDYNDLYN 399          
BLAST of Peptidase M20 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000037362.1 (SMESG000037362.1)

HSP 1 Score: 310.457 bits (794), Expect = 3.320e-101
Identity = 160/383 (41.78%), Postives = 234/383 (61.10%), Query Frame = 1
Query:  220 YNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHF-QNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDKV--LLEDIQKDFQKTL 1359
            +N+I+   + L ++   L K PE+ LKE  AH+ + +  E  GF+  RNFILETGF A Y+T+ KPH     E DALP++GHACGHNLIAE SV A  GL   M+  N+K KL++LG+PAEE  GGKI+ ++E   KDVD+A+M HP   + +H  H A+    I+F G+ AHA ASPW GKNALDA  +AYQ V+ LR+ + P C +N  + +    A  IIP+   ME ++RA +  +L+ +  +V    +GA L   C+V +   +  +ENL+SNK L+  F+ NA    I   ++   + GS+D+GNVSHV PS+ P+F+IG++   HT+++   TG   A    + QAK +  T  D+  D     + +I++ F+K L
Sbjct:    8 FNFIDKAAEQLYNLASYLHKNPEIALKEHKAHDYICSFLEKNGFKTERNFILETGFLATYETAPKPHFAILVEMDALPDIGHACGHNLIAECSVAAGLGLMEIMKMHNLKGKLSLLGTPAEETCGGKITYVREGFFKDVDLAIMSHPSMENVVHKSHLAVSQYKISFIGKEAHAAASPWMGKNALDAAVIAYQSVSCLRQQINPTCRIN-GIFIHGGVATNIIPNYIEMEYEIRATTSHELNNIVPKVLACFEGAGLATGCQVQISNKNPTFENLISNKFLIKIFEENAKILEIPLDKDNGLSDGSSDIGNVSHVCPSLQPLFYIGTNFDTHTKDYAIETGKREAQKYVLTQAKCIVGTLTDILCDSSGHYVAEIKRQFKKDL 389          
BLAST of Peptidase M20 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000037364.1 (SMESG000037364.1)

HSP 1 Score: 309.301 bits (791), Expect = 7.156e-101
Identity = 165/382 (43.19%), Postives = 237/382 (62.04%), Query Frame = 1
Query:  229 INSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQVTRNFILETGFKAEYQTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTRT-GGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDK--VLLEDIQKDFQKTLDN 1365
            IN  +  L  +   L   PE   +E  AH+ +TN  E + F+V RNFI  TGF+A ++TS  PH     EYDALP +GHACGHN+IAE+SV AA GLK AME   +KCKL+VLG+PAEE  GGKI  + E +  D+D+++M HP   ++L+    A+  L++TF G+ +HA+  PWEG NALDA  LAYQ ++ LR+ M+P+  ++  +     +   IIP+ T ME  +RAP+++ L E   RV     GAA M  CEV++ E   +YE+++SN  LL  F+ NA   G+  +    T  GS+D+GNVSHV P+IHPVF +G     HT+EF   +G   A +  ++Q KI++ T +D+ +DK   LL++I+ DF   + N
Sbjct:   11 INECSKDLCDLAMFLHSNPETAFQEVKAHDYITNYLERKNFKVERNFIHPTGFRATFETSSSPHFAILVEYDALPLIGHACGHNIIAESSVAAAIGLKAAMEK-GLKCKLSVLGTPAEEKGGGKIKFVTEGIFNDIDLSIMSHPFNKNALYFYSLAVIRLIVTFTGKESHASVLPWEGINALDAAVLAYQAISCLRQQMQPDFRIH-GIISKGGTVPNIIPNLTEMEYYVRAPTVKLLKEFIPRVYDCFHGAAKMTHCEVNIGEPCNLYEDILSNPTLLNVFEKNAISCGMSIEIPLETFRGSSDVGNVSHVCPTIHPVFTLGDDSMIHTKEFSIGSGTTKAVNAGILQGKIMSGTLIDILLDKDGNLLKNIKADFLNQILN 390          
BLAST of Peptidase M20 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000037374.1 (SMESG000037374.1)

HSP 1 Score: 258.84 bits (660), Expect = 1.719e-82
Identity = 134/304 (44.08%), Postives = 196/304 (64.47%), Query Frame = 1
Query:  463 HACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTRT-GGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDK--VLLEDIQKDFQKTLDN 1365
            HACGHN+IAE+SV AA GLK AME   +KCKL+VLG+PAEE  GGKI  + E++  D+D+++M HP   ++L+    A+  L +TF G+  HA+  PWEG NALDA  LAYQ ++ LR+ M+P+  ++  +     +   IIP+ T ME ++RAP+++ L E   RV     GAA M  CEV++ E   +YE+++SN  LL  F+ NA  +G+ F+    T  GS+D+GNVSHV P+IHPVF +G     HT+EF   +G   A +  ++Q KI++ T +D+ +DK   LL++I+ DFQ  + N
Sbjct:    4 HACGHNIIAESSVAAAIGLKAAMEK-GLKCKLSVLGTPAEEKGGGKIKFVTERIFDDIDLSIMSHPFNKNALYFYSLAVIGLRVTFTGKETHASVLPWEGINALDAAVLAYQSISCLRQQMQPDFRIH-GIISKGGTVPNIIPNLTEMEYNVRAPTVKLLKEFIPRVYDCFHGAAKMTHCEVNIVETCNLYEDILSNPTLLKVFEKNAISYGMSFEMPLETFRGSSDVGNVSHVCPTIHPVFTLGEDFMIHTKEFSIGSGTTKAVNAGILQGKIMSGTLIDILLDKDGNLLKNIKSDFQNQILN 305          
BLAST of Peptidase M20 domain-containing protein 2 vs. Planmine SMEST
Match: SMESG000037374.1 (SMESG000037374.1)

HSP 1 Score: 259.225 bits (661), Expect = 1.909e-82
Identity = 134/304 (44.08%), Postives = 196/304 (64.47%), Query Frame = 1
Query:  463 HACGHNLIAEASVGAAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMVHPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGVAYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELDTRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIHFQNVTRT-GGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAHDLTVVQAKILAATGVDVTIDK--VLLEDIQKDFQKTLDN 1365
            HACGHN+IAE+SV AA GLK AME   +KCKL+VLG+PAEE  GGKI  + E++  D+D+++M HP   ++L+    A+  L +TF G+  HA+  PWEG NALDA  LAYQ ++ LR+ M+P+  ++  +     +   IIP+ T ME ++RAP+++ L E   RV     GAA M  CEV++ E   +YE+++SN  LL  F+ NA  +G+ F+    T  GS+D+GNVSHV P+IHPVF +G     HT+EF   +G   A +  ++Q KI++ T +D+ +DK   LL++I+ DFQ  + N
Sbjct:    9 HACGHNIIAESSVAAAIGLKAAMEK-GLKCKLSVLGTPAEEKGGGKIKFVTERIFDDIDLSIMSHPFNKNALYFYSLAVIGLRVTFTGKETHASVLPWEGINALDAAVLAYQSISCLRQQMQPDFRIH-GIISKGGTVPNIIPNLTEMEYNVRAPTVKLLKEFIPRVYDCFHGAAKMTHCEVNIVETCNLYEDILSNPTLLKVFEKNAISYGMSFEMPLETFRGSSDVGNVSHVCPTIHPVFTLGEDFMIHTKEFSIGSGTTKAVNAGILQGKIMSGTLIDILLDKDGNLLKNIKSDFQNQILN 310          
The following BLAST results are available for this feature:
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 1
Match NameE-valueIdentityDescription
PM20D24.093e-8036.50peptidase M20 domain containing 2 [Source:HGNC Sym... [more]
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 1
Match NameE-valueIdentityDescription
galc2.327e-6936.14galactosylceramidase [Source:Xenbase;Acc:XB-GENE-1... [more]
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 2
Match NameE-valueIdentityDescription
Pm20d21.675e-8238.12peptidase M20 domain containing 2 [Source:MGI Symb... [more]
Pm20d23.680e-5437.63peptidase M20 domain containing 2 [Source:MGI Symb... [more]
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|A3KG59|P20D2_MOUSE1.172e-8138.12Peptidase M20 domain-containing protein 2 OS=Mus m... [more]
sp|Q8IYS1|P20D2_HUMAN1.965e-7936.50Peptidase M20 domain-containing protein 2 OS=Homo ... [more]
sp|Q501L1|P20D2_XENTR4.085e-7737.25Peptidase M20 domain-containing protein 2 OS=Xenop... [more]
sp|P76052|ABGB_ECOLI8.852e-3727.18p-aminobenzoyl-glutamate hydrolase subunit B OS=Es... [more]
sp|C5D827|DAPEL_GEOSW1.310e-1323.97N-acetyldiaminopimelate deacetylase OS=Geobacillus... [more]
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A267FIF11.974e-10841.79Peptidase M20 domain-containing protein 2 (Fragmen... [more]
A0A267DF188.348e-10841.79Peptidase M20 domain-containing protein 2 (Fragmen... [more]
A0A267F5F11.101e-10642.97Peptidase M20 domain-containing protein 2 (Fragmen... [more]
A0A267G5371.809e-10642.01Peptidase M20 domain-containing protein 2 (Fragmen... [more]
A0A1I8H9I65.373e-10441.90Uncharacterized protein OS=Macrostomum lignano OX=... [more]
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PM20D21.626e-9439.74peptidase M20 domain-containing protein 2-like [So... [more]
PM20D24.545e-9339.74peptidase M20 domain-containing protein 2-like [So... [more]
PM20D26.558e-9340.10peptidase M20 domain-containing protein 2-like [So... [more]
PM20D22.642e-5937.82peptidase M20 domain containing 2 [Source:HGNC Sym... [more]
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 4
Match NameE-valueIdentityDescription
EDO472696.724e-9539.85Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO453416.972e-8437.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO497221.072e-7934.83Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO325454.895e-7640.69Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
PM20D25.110e-8336.41peptidase M20 domain-containing protein 2 [Source:... [more]
PM20D21.628e-8136.62peptidase M20 domain-containing protein 2 [Source:... [more]
ENSORLT00000018484.27.054e-7536.32peptidase M20 domain-containing protein 2 [Source:... [more]
PM20D21.577e-6237.81peptidase M20 domain-containing protein 2 [Source:... [more]
back to top
BLAST of Peptidase M20 domain-containing protein 2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000049098.10.000e+0100.00SMESG000049098.1[more]
SMESG000037362.13.320e-10141.78SMESG000037362.1[more]
SMESG000037364.17.156e-10143.19SMESG000037364.1[more]
SMESG000037374.11.719e-8244.08SMESG000037374.1[more]
SMESG000037374.11.909e-8244.08SMESG000037374.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023530 ID=SMED30023530|Name=Peptidase M20 domain-containing protein 2|organism=Schmidtea mediterranea sexual|type=transcript|length=1552bp
TGACTATTATAAAACTTCGATAAATAAATAAAAATGTATAAAAAATTATA
GTGATTTTAACAAATTTTTAAAACATTATAATTTAAGAAATTAGTCATAT
TTAAATAAAACTAAACATAATTACATTACCCACATATTTTATACTCTCAT
CAAGTTAGGTCGGCAGAATTACTTTGTTTTCAGCAAATTTGGATACGAAA
TAGAATGAAGCAGTCCATTTATAATTATATTAATTCTAAAAATGATATCT
TGCGATCTGTTGGCTACGAATTATGGAAATGTCCGGAACTGGGATTGAAA
GAAAAATTTGCGCATGAGATGCTCACAAATATTTTTGAAGCCGAAGGTTT
TCAGGTTACGAGGAACTTTATTCTTGAAACTGGATTCAAAGCAGAATATC
AAACATCTGAGAAGCCCCATATTGTTTATTTCTGTGAATATGATGCTCTA
CCGAATTTAGGTCATGCATGCGGACATAATCTAATCGCTGAAGCTAGCGT
AGGGGCAGCTTTTGGACTAAAATATGCCATGGAAAATTTTAACATAAAAT
GCAAACTCACAGTTCTAGGGTCTCCCGCAGAAGAAAACGAAGGTGGGAAA
ATATCAATGATAAAGGAAAAAGTGTTGAAGGATGTCGATGTTGCTATGAT
GGTCCATCCCCGAGAAATTGACAGTCTTCATATGCCACATTACGCTTTGA
AAGATTTATTAATTACATTTAAAGGCCGAAGTGCTCATGCTACTGCATCT
CCATGGGAAGGTAAAAACGCTCTGGATGCAGGAACATTAGCATATCAAGG
TGTTGCATATTTACGCAGGAATATGAGACCAAATTGTTTTGTTAACGTTA
GCGTGAAAATGGATCCAGATAGTGCTATTGGAATAATACCTGACAAAACT
ACAATGGAAGTGGACCTTAGAGCACCTTCAATTCAGCAATTATCAGAATT
AGACACGCGAGTAAAGCAAATTGTGAAAGGTGCCGCCTTAATGGCGGATT
GTGAAGTTGATGTTTTTGAGTATGATGAGATGTACGAAAATCTCGTATCC
AATAAACCATTACTCACAGCCTTTAAATTAAATGCTGACCATTTCGGAAT
TCATTTTCAAAATGTCACTCGAACCGGCGGATCTACTGATATGGGCAATG
TGAGTCATGTCATTCCATCAATTCATCCAGTATTTTTTATCGGATCTTCG
GTTGGACCTCATACCGAGGAATTTGTGAAATGGACAGGTCTGGAAGCTGC
ACACGATCTAACTGTTGTCCAAGCTAAAATTTTAGCTGCGACAGGAGTTG
ACGTGACTATTGATAAGGTCTTGTTAGAAGATATTCAAAAAGACTTTCAA
AAAACTCTTGATAATAACTTTTCTGACATTGATTATAATGACCTATACAA
CTGAGGGATCTATCCTATAATCCAAAGTATGTAGTTGTTGCGTTTAGTAA
TCTCTGTGAGTCTCGACGGTAGACTAACGTTACCTTGCTTGGAATGTGAG
TTCATTGTGTTTAAATATGTAAGCCTTCAACTCTAAGCCAAATATTCTAA
TA
back to top

protein sequence of SMED30023530-orf-1

>SMED30023530-orf-1 ID=SMED30023530-orf-1|Name=SMED30023530-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=400bp
MKQSIYNYINSKNDILRSVGYELWKCPELGLKEKFAHEMLTNIFEAEGFQ
VTRNFILETGFKAEYQTSEKPHIVYFCEYDALPNLGHACGHNLIAEASVG
AAFGLKYAMENFNIKCKLTVLGSPAEENEGGKISMIKEKVLKDVDVAMMV
HPREIDSLHMPHYALKDLLITFKGRSAHATASPWEGKNALDAGTLAYQGV
AYLRRNMRPNCFVNVSVKMDPDSAIGIIPDKTTMEVDLRAPSIQQLSELD
TRVKQIVKGAALMADCEVDVFEYDEMYENLVSNKPLLTAFKLNADHFGIH
FQNVTRTGGSTDMGNVSHVIPSIHPVFFIGSSVGPHTEEFVKWTGLEAAH
DLTVVQAKILAATGVDVTIDKVLLEDIQKDFQKTLDNNFSDIDYNDLYN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR017439Amidohydrolase
IPR036264Bact_exopeptidase_dim_dom
IPR017144Pept_M20A_amidohydro_pred
IPR011650Peptidase_M20_dimer
Vocabulary: biological process
TermDefinition
GO:0008152metabolic process
Vocabulary: molecular function
TermDefinition
GO:0016787hydrolase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR017439AmidohydrolaseTIGRFAMTIGR01891TIGR01891coord: 21..329
e-value: 4.1E-53
score: 178.8
NoneNo IPR availableGENE3DG3DSA:3.30.70.360coord: 164..282
e-value: 2.6E-110
score: 370.6
NoneNo IPR availableGENE3DG3DSA:3.40.630.10coord: 20..357
e-value: 2.6E-110
score: 370.6
NoneNo IPR availablePANTHERPTHR30575:SF0PEPTIDASE M20 DOMAIN-CONTAINING PROTEIN 2coord: 2..385
NoneNo IPR availablePANTHERPTHR30575AMINOBENZOYL-GLUTAMATE UTILIZATION PROTEIN Bcoord: 2..385
NoneNo IPR availableCDDcd05672M20_ACY1L2-likecoord: 9..365
e-value: 4.79576E-143
score: 409.26
NoneNo IPR availableSUPERFAMILYSSF53187Zn-dependent exopeptidasescoord: 3..369
IPR011650Peptidase M20, dimerisation domainPFAMPF07687M20_dimercoord: 167..259
e-value: 6.6E-5
score: 22.8
IPR017144Peptidase M20A, amidohydrolase, predictedPIRSFPIRSF037226Amidohydrolase_ACY1L2coord: 1..389
e-value: 2.9E-105
score: 349.9
IPR036264Bacterial exopeptidase dimerisation domainSUPERFAMILYSSF55031Bacterial exopeptidase dimerisation domaincoord: 168..270