DH domain-containing protein

Overview
NameDH domain-containing protein
Smed IDSMED30023509
Length (bp)4461
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of DH domain-containing protein (SMED30023509) t-SNE clustered cells

Violin plots show distribution of expression levels for DH domain-containing protein (SMED30023509) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of DH domain-containing protein (SMED30023509) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for DH domain-containing protein (SMED30023509) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023509

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 5

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
protonephridiaSMED30023509SMESG000017234.1 dd_Smed_v4_4803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023509SMESG000017234.1 dd_Smed_v4_4803_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023509SMESG000017234.1 Contig49163uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023509SMESG000017234.1 Contig49163newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
epidermisSMED30023509SMESG000058206.1 SMESG000013025.1 dd_Smed_v4_5062_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of DH domain-containing protein vs. Ensembl Human
Match: PLEKHG1 (pleckstrin homology and RhoGEF domain containing G1 [Source:HGNC Symbol;Acc:HGNC:20884])

HSP 1 Score: 125.946 bits (315), Expect = 3.254e-28
Identity = 103/333 (30.93%), Postives = 172/333 (51.65%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDK------EVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+QE++ETE  YV+ L  + E Y+   D I    K      E   +F N +++  F+S  L+ L+   +   +    ++ECF+ +   F  +Y++YCTNY +SV  L         A +   + Q  L H LPL ++LLKPVQRILKYHL+L E+     L        VV   L A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  ++   +N R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++    I  +AK+ +L+
Sbjct:  117 VVQEILETERTYVQDLKSIVEDYL---DCIRDQTKLPLGTEERSALFGNIQDIYHFNSELLQDLENCENDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAVLTECMRNKILA-KFFRERQETLKHSLPLGSYLLKPVQRILKYHLLLHEIEN--HLDKDTEGYDVV---LDAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKR-DDTFTYKAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENHAA-KIPAKAKQAILE 433          
BLAST of DH domain-containing protein vs. Ensembl Human
Match: PLEKHG1 (pleckstrin homology and RhoGEF domain containing G1 [Source:HGNC Symbol;Acc:HGNC:20884])

HSP 1 Score: 125.946 bits (315), Expect = 3.254e-28
Identity = 103/333 (30.93%), Postives = 172/333 (51.65%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDK------EVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+QE++ETE  YV+ L  + E Y+   D I    K      E   +F N +++  F+S  L+ L+   +   +    ++ECF+ +   F  +Y++YCTNY +SV  L         A +   + Q  L H LPL ++LLKPVQRILKYHL+L E+     L        VV   L A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  ++   +N R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++    I  +AK+ +L+
Sbjct:  117 VVQEILETERTYVQDLKSIVEDYL---DCIRDQTKLPLGTEERSALFGNIQDIYHFNSELLQDLENCENDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAVLTECMRNKILA-KFFRERQETLKHSLPLGSYLLKPVQRILKYHLLLHEIEN--HLDKDTEGYDVV---LDAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKR-DDTFTYKAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENHAA-KIPAKAKQAILE 433          
BLAST of DH domain-containing protein vs. Ensembl Human
Match: PLEKHG3 (pleckstrin homology and RhoGEF domain containing G3 [Source:HGNC Symbol;Acc:HGNC:20364])

HSP 1 Score: 119.783 bits (299), Expect = 1.995e-26
Identity = 102/329 (31.00%), Postives = 166/329 (50.46%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYM-KMSDSI-FSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V++E+VETE +YV+ L  + E Y+ K+ D+      ++V  +F N  N+   +S  L  L   NS   +    ++ CF+E    F+ +Y++YC NY  SV  L         A +     Q  L H LPL ++LLKPVQRILKYHL+L+E+ +            VVE    A+D M  VA  IN+ +   E  +R  +++  L +    +    G   L+G  +V   RN R   L +  L++ K+ G+  +  +  I C+ +ML E   +  L F V     +K + ++Q    +EK  W   IK+LI+ ++ H +I ++AK  +L+
Sbjct:   97 VVREIVETERMYVQDLRSIVEDYLLKIIDTPGLLKPEQVSALFGNIENIYALNSQLLRDLDSCNSDPVA----VASCFVERSQEFD-IYTQYCNNYPNSVAALTECMRDKQQA-KFFRDRQELLQHSLPLGSYLLKPVQRILKYHLLLQEIAK--HFDEEEDGFEVVED---AIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTTYGELVLEGTFRVHRVRNERTFFLFDKTLLITKKRGD-HFVYKGNIPCSSLMLIEST-RDSLCFTVTHYKHSKQQYSIQAKTVEEKRNWTHHIKRLILENH-HATIPQKAKEAILE 411          
BLAST of DH domain-containing protein vs. Ensembl Human
Match: PLEKHG1 (pleckstrin homology and RhoGEF domain containing G1 [Source:HGNC Symbol;Acc:HGNC:20884])

HSP 1 Score: 109.383 bits (272), Expect = 1.670e-24
Identity = 87/294 (29.59%), Postives = 156/294 (53.06%), Query Frame = 2
Query:  830 KEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANG-VVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            +E   +F N +++  F+S  L+ L+   +   +    ++ECF+ +   F  +Y++YCTNY +SV  L         A +   + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  +    + +L A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  ++   +N R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++    I  +AK+ +L+
Sbjct:    1 EERSALFGNIQDIYHFNSELLQDLENCENDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAVLTECMRNKILA-KFFRERQETLKHSLPLGSYLLKPVQRILKYHLLLHE------IENHLDKDTEGYDVVLDAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKK-RDDTFTYKAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENHA-AKIPAKAKQAILE 280          
BLAST of DH domain-containing protein vs. Ensembl Human
Match: PLEKHG2 (pleckstrin homology and RhoGEF domain containing G2 [Source:HGNC Symbol;Acc:HGNC:29515])

HSP 1 Score: 98.9821 bits (245), Expect = 2.304e-20
Identity = 76/221 (34.39%), Postives = 116/221 (52.49%), Query Frame = 2
Query:  629 SRPQATVKHIVNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMK--MSDSIFS-NDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHA-WQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINE 1279
            SRP+      + +  L P G +       +   V +E+VETE  YV+ L  + E Y+   +   +   + ++V  +F+N  ++  F S  LE L+  NS   SS   ++ECF++    F+ +Y+ YC NY  S+  L  +  +   A W  L + Q QL H LPL +FLLKPVQRILKYHL+L+EL    K  +     G  E + +A+ +M  VA  IN+
Sbjct:   75 SRPEPLPGPPI-RLHLSPVG-IPGSARPSRLERVAREIVETERAYVRDLRSIVEDYLGPLLDGGVLGLSVEQVGTLFANIEDIYEFSSELLEDLE--NS---SSAGGIAECFVQRSEDFD-IYTLYCMNYPSSLALLRELSLSPPAALW--LQERQAQLRHSLPLQSFLLKPVQRILKYHLLLQEL---GKHWAEGPGTGGREMVEEAIVSMTAVAWYIND 282          
BLAST of DH domain-containing protein vs. Ensembl Celegans
Match: uig-1 (UNC-112-Interacting Guanine nucleotide exchange factor [Source:UniProtKB/TrEMBL;Acc:H1UBJ0])

HSP 1 Score: 114.775 bits (286), Expect = 1.832e-25
Identity = 102/338 (30.18%), Postives = 175/338 (51.78%), Query Frame = 2
Query:  737 ELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVELIFSNWRNL-RIFHSLFLEKLKLINSYEFSSLQ--RLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQ------SLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINE--KQMXXXXXXXXXXXXXXXYDSD---IFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYI-PKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            EL++TE  YV+ L  V +GYM   D +  + +++++      +L      +F    +L N  + + L   ++S CF+E  G FE  Y EYCTNY       HRM +T  H  Q      +L + Q  L H L LS +LLKPVQRILKYHL L+ +++     +H      V+   +A + M   A RIN+  K+ E  E++ +L+   + + +D   I N    G   L+   +  G + +RL+ L E  L++ K+ G   +  +  I C+ +ML E+I P++PL F V+   + + +      + ++K  W + +K++++  Y  + I E+ K+++L
Sbjct:   86 ELLDTERTYVEDLNAVIKGYM---DFLVEDREKLKVTLDAISSLFGCIERIFAFNKQLYNQLDAADLDCVKMSRCFVESSGKFED-YIEYCTNY-------HRMMSTLYHLQQQPLVARALQERQLALNHSLQLSAYLLKPVQRILKYHLFLENILKNMPSTTHPEELIQVK---RAHEVMTSQAARINDEKKKAEHIERVGQLQSTLQKWKADEIQISNLSAYGDLLLEATFRQAGSKTTRLLFLFEEMLLIVKQRG-ANYVCKDYIMCSNLMLNEWICPEEPLSFQVLSFDNPRAQYVFMASSMEQKRTWMQELKRMMLDHYSVE-IPEKTKQLML 407          
BLAST of DH domain-containing protein vs. Ensembl Celegans
Match: uig-1 (UNC-112-Interacting Guanine nucleotide exchange factor [Source:UniProtKB/TrEMBL;Acc:H1UBJ0])

HSP 1 Score: 114.775 bits (286), Expect = 2.093e-25
Identity = 102/338 (30.18%), Postives = 175/338 (51.78%), Query Frame = 2
Query:  737 ELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVELIFSNWRNL-RIFHSLFLEKLKLINSYEFSSLQ--RLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQ------SLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINE--KQMXXXXXXXXXXXXXXXYDSD---IFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYI-PKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            EL++TE  YV+ L  V +GYM   D +  + +++++      +L      +F    +L N  + + L   ++S CF+E  G FE  Y EYCTNY       HRM +T  H  Q      +L + Q  L H L LS +LLKPVQRILKYHL L+ +++     +H      V+   +A + M   A RIN+  K+ E  E++ +L+   + + +D   I N    G   L+   +  G + +RL+ L E  L++ K+ G   +  +  I C+ +ML E+I P++PL F V+   + + +      + ++K  W + +K++++  Y  + I E+ K+++L
Sbjct:  269 ELLDTERTYVEDLNAVIKGYM---DFLVEDREKLKVTLDAISSLFGCIERIFAFNKQLYNQLDAADLDCVKMSRCFVESSGKFED-YIEYCTNY-------HRMMSTLYHLQQQPLVARALQERQLALNHSLQLSAYLLKPVQRILKYHLFLENILKNMPSTTHPEELIQVK---RAHEVMTSQAARINDEKKKAEHIERVGQLQSTLQKWKADEIQISNLSAYGDLLLEATFRQAGSKTTRLLFLFEEMLLIVKQRG-ANYVCKDYIMCSNLMLNEWICPEEPLSFQVLSFDNPRAQYVFMASSMEQKRTWMQELKRMMLDHYSVE-IPEKTKQLML 590          
BLAST of DH domain-containing protein vs. Ensembl Celegans
Match: uig-1 (UNC-112-Interacting Guanine nucleotide exchange factor [Source:UniProtKB/TrEMBL;Acc:H1UBJ0])

HSP 1 Score: 114.775 bits (286), Expect = 2.345e-25
Identity = 103/341 (30.21%), Postives = 176/341 (51.61%), Query Frame = 2
Query:  737 ELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVELIFSNWRNL-RIFHSLFLEKLKLINSYEFSSLQ--RLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQ------SLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLL---KALDNMLQVANRINE--KQMXXXXXXXXXXXXXXXYDSD---IFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYI-PKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            EL++TE  YV+ L  V +GYM   D +  + +++++      +L      +F    +L N  + + L   ++S CF+E  G FE  Y EYCTNY       HRM +T  H  Q      +L + Q  L H L LS +LLKPVQRILKYHL L+ +++     +H       E L+   +A + M   A RIN+  K+ E  E++ +L+   + + +D   I N    G   L+   +  G + +RL+ L E  L++ K+ G   +  +  I C+ +ML E+I P++PL F V+   + + +      + ++K  W + +K++++  Y  + I E+ K+++L
Sbjct:  230 ELLDTERTYVEDLNAVIKGYM---DFLVEDREKLKVTLDAISSLFGCIERIFAFNKQLYNQLDAADLDCVKMSRCFVESSGKFED-YIEYCTNY-------HRMMSTLYHLQQQPLVARALQERQLALNHSLQLSAYLLKPVQRILKYHLFLENILKNMPSTTH------PEELIQVKRAHEVMTSQAARINDEKKKAEHIERVGQLQSTLQKWKADEIQISNLSAYGDLLLEATFRQAGSKTTRLLFLFEEMLLIVKQRG-ANYVCKDYIMCSNLMLNEWICPEEPLSFQVLSFDNPRAQYVFMASSMEQKRTWMQELKRMMLDHYSVE-IPEKTKQLML 551          
BLAST of DH domain-containing protein vs. Ensembl Celegans
Match: uig-1 (UNC-112-Interacting Guanine nucleotide exchange factor [Source:UniProtKB/TrEMBL;Acc:H1UBJ0])

HSP 1 Score: 114.775 bits (286), Expect = 2.565e-25
Identity = 103/341 (30.21%), Postives = 176/341 (51.61%), Query Frame = 2
Query:  737 ELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVELIFSNWRNL-RIFHSLFLEKLKLINSYEFSSLQ--RLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQ------SLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLL---KALDNMLQVANRINE--KQMXXXXXXXXXXXXXXXYDSD---IFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYI-PKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            EL++TE  YV+ L  V +GYM   D +  + +++++      +L      +F    +L N  + + L   ++S CF+E  G FE  Y EYCTNY       HRM +T  H  Q      +L + Q  L H L LS +LLKPVQRILKYHL L+ +++     +H       E L+   +A + M   A RIN+  K+ E  E++ +L+   + + +D   I N    G   L+   +  G + +RL+ L E  L++ K+ G   +  +  I C+ +ML E+I P++PL F V+   + + +      + ++K  W + +K++++  Y  + I E+ K+++L
Sbjct:  283 ELLDTERTYVEDLNAVIKGYM---DFLVEDREKLKVTLDAISSLFGCIERIFAFNKQLYNQLDAADLDCVKMSRCFVESSGKFED-YIEYCTNY-------HRMMSTLYHLQQQPLVARALQERQLALNHSLQLSAYLLKPVQRILKYHLFLENILKNMPSTTH------PEELIQVKRAHEVMTSQAARINDEKKKAEHIERVGQLQSTLQKWKADEIQISNLSAYGDLLLEATFRQAGSKTTRLLFLFEEMLLIVKQRG-ANYVCKDYIMCSNLMLNEWICPEEPLSFQVLSFDNPRAQYVFMASSMEQKRTWMQELKRMMLDHYSVE-IPEKTKQLML 604          
BLAST of DH domain-containing protein vs. Ensembl Celegans
Match: uig-1 (UNC-112-Interacting Guanine nucleotide exchange factor [Source:UniProtKB/TrEMBL;Acc:H1UBJ0])

HSP 1 Score: 114.39 bits (285), Expect = 2.685e-25
Identity = 103/341 (30.21%), Postives = 176/341 (51.61%), Query Frame = 2
Query:  737 ELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVELIFSNWRNL-RIFHSLFLEKLKLINSYEFSSLQ--RLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQ------SLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLL---KALDNMLQVANRINE--KQMXXXXXXXXXXXXXXXYDSD---IFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYI-PKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            EL++TE  YV+ L  V +GYM   D +  + +++++      +L      +F    +L N  + + L   ++S CF+E  G FE  Y EYCTNY       HRM +T  H  Q      +L + Q  L H L LS +LLKPVQRILKYHL L+ +++     +H       E L+   +A + M   A RIN+  K+ E  E++ +L+   + + +D   I N    G   L+   +  G + +RL+ L E  L++ K+ G   +  +  I C+ +ML E+I P++PL F V+   + + +      + ++K  W + +K++++  Y  + I E+ K+++L
Sbjct:  263 ELLDTERTYVEDLNAVIKGYM---DFLVEDREKLKVTLDAISSLFGCIERIFAFNKQLYNQLDAADLDCVKMSRCFVESSGKFED-YIEYCTNY-------HRMMSTLYHLQQQPLVARALQERQLALNHSLQLSAYLLKPVQRILKYHLFLENILKNMPSTTH------PEELIQVKRAHEVMTSQAARINDEKKKAEHIERVGQLQSTLQKWKADEIQISNLSAYGDLLLEATFRQAGSKTTRLLFLFEEMLLIVKQRG-ANYVCKDYIMCSNLMLNEWICPEEPLSFQVLSFDNPRAQYVFMASSMEQKRTWMQELKRMMLDHYSVE-IPEKTKQLML 584          
BLAST of DH domain-containing protein vs. Ensembl Fly
Match: GEFmeso (gene:FBgn0050115 transcript:FBtr0300421)

HSP 1 Score: 129.798 bits (325), Expect = 1.160e-29
Identity = 102/330 (30.91%), Postives = 180/330 (54.55%), Query Frame = 2
Query:  737 ELVETEHIYVKSLMEVEEGYMK-MSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLD--GELKVPGC-----RNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRIL 1702
            E+V++E  +V+ L +V +GY++   +       E++++F+N   +  F+S+ L++L  IN+       R++ CF++    F+ +Y+ YCT+Y +++  L ++   A+H +  L   Q  L H+LPL ++LLKPVQRILKYHL+L  L + C +   V A+ +          M QVA+ I++ + ++E+Q R  +L      S I +  +LG P L   GEL+  G         RLVLL    L++ K+  +G+   +  I  N +ML E++P +P  F+VI   + +++  L   N  +K +W + IK +++   E   I  RAK ++
Sbjct:  548 EIVDSERSFVEDLGQVIKGYLQDWKERACLRVDELQILFANIEEIYEFNSMLLQRL--INTGRDPG--RIARCFIDLRDGFD-VYTTYCTSYPEAISLLTKL-LQATHTYSLLASTQKLLQHRLPLGSYLLKPVQRILKYHLLLDSLRKHCDVKEVVEAHVI----------MRQVAHNIDQVKRKQEQQSRVKEL------SGILDG-WLG-PELTVLGELRQEGLLMEQHNKQRLVLLFATMLIITKQKEDGRLQFKTYISQNNLMLSEHLPGEPTSFYVIPFDEPRHQIKLTARNRDQKRIWTQHIKGVML---EKLDIPMRAKELV 850          
BLAST of DH domain-containing protein vs. Ensembl Fly
Match: GEFmeso (gene:FBgn0050115 transcript:FBtr0340387)

HSP 1 Score: 129.413 bits (324), Expect = 1.241e-29
Identity = 102/330 (30.91%), Postives = 180/330 (54.55%), Query Frame = 2
Query:  737 ELVETEHIYVKSLMEVEEGYMK-MSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLD--GELKVPGC-----RNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRIL 1702
            E+V++E  +V+ L +V +GY++   +       E++++F+N   +  F+S+ L++L  IN+       R++ CF++    F+ +Y+ YCT+Y +++  L ++   A+H +  L   Q  L H+LPL ++LLKPVQRILKYHL+L  L + C +   V A+ +          M QVA+ I++ + ++E+Q R  +L      S I +  +LG P L   GEL+  G         RLVLL    L++ K+  +G+   +  I  N +ML E++P +P  F+VI   + +++  L   N  +K +W + IK +++   E   I  RAK ++
Sbjct:  236 EIVDSERSFVEDLGQVIKGYLQDWKERACLRVDELQILFANIEEIYEFNSMLLQRL--INTGRDPG--RIARCFIDLRDGFD-VYTTYCTSYPEAISLLTKL-LQATHTYSLLASTQKLLQHRLPLGSYLLKPVQRILKYHLLLDSLRKHCDVKEVVEAHVI----------MRQVAHNIDQVKRKQEQQSRVKEL------SGILDG-WLG-PELTVLGELRQEGLLMEQHNKQRLVLLFATMLIITKQKEDGRLQFKTYISQNNLMLSEHLPGEPTSFYVIPFDEPRHQIKLTARNRDQKRIWTQHIKGVML---EKLDIPMRAKELV 538          
BLAST of DH domain-containing protein vs. Ensembl Fly
Match: GEFmeso (gene:FBgn0050115 transcript:FBtr0310055)

HSP 1 Score: 127.872 bits (320), Expect = 2.174e-29
Identity = 101/330 (30.61%), Postives = 180/330 (54.55%), Query Frame = 2
Query:  737 ELVETEHIYVKSLMEVEEGYMK-MSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLD--GELKVPGC-----RNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRIL 1702
            E+V++E  +V+ L +V +GY++   +       E++++F+N   +  F+S+ L++L  IN+       R++ CF++    F+ +Y+ YCT+Y +++  L ++   A+H +  L   Q  L H+LPL ++LLKPVQRILKYHL+L  L + C +   V A+ +          M QVA+ I++ + ++E+Q R  +L      S I +  +LG P L   GEL+  G         RLVLL    L++ K+  +G+   +  I  N +ML E++P +P  F+VI   + +++  L   N  +K +W + IK +++   +   I  RAK ++
Sbjct:  548 EIVDSERSFVEDLGQVIKGYLQDWKERACLRVDELQILFANIEEIYEFNSMLLQRL--INTGRDPG--RIARCFIDLRDGFD-VYTTYCTSYPEAISLLTKL-LQATHTYSLLASTQKLLQHRLPLGSYLLKPVQRILKYHLLLDSLRKHCDVKEVVEAHVI----------MRQVAHNIDQVKRKQEQQSRVKEL------SGILDG-WLG-PELTVLGELRQEGLLMEQHNKQRLVLLFATMLIITKQKEDGRLQFKTYISQNNLMLSEHLPGEPTSFYVIPFDEPRHQIKLTARNRDQKRIWTQHIKGVMLEKLD---IPMRAKELV 850          
BLAST of DH domain-containing protein vs. Ensembl Fly
Match: sif (gene:FBgn0085447 transcript:FBtr0340656)

HSP 1 Score: 90.1225 bits (222), Expect = 1.597e-17
Identity = 74/243 (30.45%), Postives = 121/243 (49.79%), Query Frame = 2
Query:  599 FVFEKDKLLQSRPQATVKHIVNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMK-MSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKL-------INSYEFSSLQR-----LSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQT-QLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQ 1285
            F     +  +S P  +V   V+  +L P+  L    + EK   V+ ELV+TE  YVK L  + E Y++ M    F ++ E+  +F N   +  F   FL+ L+         N +E     R     +   FL  + HF+ LYS +C +++++ K LH  E   +HA Q  +  +  +  H   L ++L+KP+QRILKY L+L+++    + ++   A+  V  L +AL  M +VA  INE Q
Sbjct: 1219 FCRSPQETRKSSPTGSVTSSVSTTALTPSRQL---TDAEKLRKVVMELVDTERTYVKHLNNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFLQNLEESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFK-LYSSFCASHSKAQKVLHPNE--GNHALQEFLAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQM----RNLTDTRADEHVH-LCEALKGMEKVAEHINEMQ 1450          
BLAST of DH domain-containing protein vs. Ensembl Fly
Match: sif (gene:FBgn0085447 transcript:FBtr0330123)

HSP 1 Score: 90.1225 bits (222), Expect = 1.768e-17
Identity = 73/234 (31.20%), Postives = 119/234 (50.85%), Query Frame = 2
Query:  626 QSRPQATVKHIVNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMK-MSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKL-------INSYEFSSLQR-----LSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQT-QLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQ 1285
            +S P  +V   V+  +L P+  L    + EK   V+ ELV+TE  YVK L  + E Y++ M    F ++ E+  +F N   +  F   FL+ L+         N +E     R     +   FL  + HF+ LYS +C +++++ K LH  E   +HA Q  +  +  +  H   L ++L+KP+QRILKY L+L+++    + ++   A+  V  L +AL  M +VA  INE Q
Sbjct: 1428 KSSPTGSVTSSVSTTALTPSRQL---TDAEKLRKVVMELVDTERTYVKHLNNLLEHYLEPMKRETFLSNAEINALFGNIHEIVTFQRQFLQNLEESLDLEPDFNKFEHCGQFRNVLFAIGSAFLYYVNHFK-LYSSFCASHSKAQKVLHPNE--GNHALQEFLAARNPKQQHSSTLESYLIKPIQRILKYPLLLQQM----RNLTDTRADEHVH-LCEALKGMEKVAEHINEMQ 1650          
BLAST of DH domain-containing protein vs. Ensembl Zebrafish
Match: AL935335.1 (pleckstrin homology domain containing, family G (with RhoGef domain) member 2 [Source:NCBI gene;Acc:565988])

HSP 1 Score: 112.464 bits (280), Expect = 2.706e-24
Identity = 104/337 (30.86%), Postives = 168/337 (49.85%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKM---SDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQC----QTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHV-SANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLA-KRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLDN 1711
            V  E++ETE  YV+ L  + E Y+        +    +EV  +F N  ++  F+S  LE L+            ++ECF+E    F+ +Y+ YC NY  SV  L           +SL++     Q  L H LPL T+LLKPVQRILKYHL+L+EL +      H   ++   E +  A+  M  VA  IN+ + ++E  +R  ++   L +    +    G   L+G  +V   +  R   L +  L++A KRL +  +     I C  ++L E + K PL F V D T  K +  +Q  N +EK +W   +K+LI+ ++   S+ ++A+++L DN
Sbjct:  135 VALEILETEQAYVRDLKSIVEDYLGCIIDCGDLPLKPEEVSTLFCNIEDIYEFNSELLEDLE-----RSPHAAAIAECFVERSEAFD-IYTIYCMNYPNSVTVLRDCMKN-----ESLVRFFQERQATLCHSLPLETYLLKPVQRILKYHLLLQELSK------HFDKSDPGYEVVEDAIITMTAVAWYINDMKRKQEHAIRLQEIESLLLNWTGPDLSGFGELVLEGSFRVQRVKKERAFFLFDKMLLIAKKRLDHFIYSTH--IFCCNLLLVENM-KDPLCFKVSDQTIPKQQHVVQAKNQEEKRLWLHYLKRLIVENHPA-SLPQKARQVLGDN 450          
BLAST of DH domain-containing protein vs. Ensembl Zebrafish
Match: plekhg2 (pleckstrin homology domain containing, family G (with RhoGef domain) member 2 [Source:ZFIN;Acc:ZDB-GENE-090819-1])

HSP 1 Score: 112.464 bits (280), Expect = 3.254e-24
Identity = 104/337 (30.86%), Postives = 168/337 (49.85%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKM---SDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQC----QTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHV-SANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLA-KRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLDN 1711
            V  E++ETE  YV+ L  + E Y+        +    +EV  +F N  ++  F+S  LE L+            ++ECF+E    F+ +Y+ YC NY  SV  L           +SL++     Q  L H LPL T+LLKPVQRILKYHL+L+EL +      H   ++   E +  A+  M  VA  IN+ + ++E  +R  ++   L +    +    G   L+G  +V   +  R   L +  L++A KRL +  +     I C  ++L E + K PL F V D T  K +  +Q  N +EK +W   +K+LI+ ++   S+ ++A+++L DN
Sbjct:  132 VALEILETEQAYVRDLKSIVEDYLGCIIDCGDLPLKPEEVSTLFCNIEDIYEFNSELLEDLE-----RSPHAAAIAECFVERSEAFD-IYTIYCMNYPNSVTVLRDCMKN-----ESLVRFFQERQATLCHSLPLETYLLKPVQRILKYHLLLQELSK------HFDKSDPGYEVVEDAIITMTAVAWYINDMKRKQEHAIRLQEIESLLLNWTGPDLSGFGELVLEGSFRVQRVKKERAFFLFDKMLLIAKKRLDHFIYSTH--IFCCNLLLVENM-KDPLCFKVSDQTIPKQQHVVQAKNQEEKRLWLHYLKRLIVENHPA-SLPQKARQVLGDN 447          
BLAST of DH domain-containing protein vs. Ensembl Zebrafish
Match: mcf2b (MCF.2 cell line derived transforming sequence b [Source:ZFIN;Acc:ZDB-GENE-091118-4])

HSP 1 Score: 89.7373 bits (221), Expect = 1.719e-17
Identity = 72/214 (33.64%), Postives = 107/214 (50.00%), Query Frame = 2
Query:  668 FSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMKMSD---------SIFSNDKEVELIFSNWRNLRIFHS-LFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINE 1279
             S  P G  N D  + +   VM+EL+ETE IYV+ LM V  GY    D         S+  N KE   +F N   +  FHS +FL+ L+        + +R+   FLE   HF+ +Y  YC N  +S     +   +A      + +C+ +L H+L L ++LLKPVQR+ KY L+LKEL++      H S +     L  AL+ ML +   +N+
Sbjct:  495 LSYGPEGVENPDQHKRR---VMKELIETERIYVEELMSVLLGYRAEMDNPALSNILPSVLRNKKED--LFGNLPEIYKFHSRIFLQDLESC----LETPERVGARFLERKEHFQ-VYERYCQNKPRSDALWRQCSDSAF-----IQECKGKLDHKLGLDSYLLKPVQRLTKYQLLLKELLK------HSSNSQYASELQGALNAMLDLLKSVND 687          
BLAST of DH domain-containing protein vs. Ensembl Zebrafish
Match: CABZ01048666.1 (pep chromosome:GRCz11:23:2361184:2397031:1 gene:ENSDARG00000111585.1 transcript:ENSDART00000184469.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:CABZ01048666.1)

HSP 1 Score: 81.6481 bits (200), Expect = 1.694e-16
Identity = 53/149 (35.57%), Postives = 85/149 (57.05%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKMSDS---IFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLIL 1165
            V++E++ETE  YV+ L  + + Y+    +   +   D+E   +F N R++  F+S  L  L+  N+   +    +++CF+ +   F  +Y++YCTNY +SV  L         A + L + Q  L H LPL ++LLKPVQRILKYHL+L
Sbjct:   92 VVEEILETEKTYVQDLRSIVQDYLDCISNQSLLLLGDEERNSLFGNIRDIYRFNSELLRDLEKCNANPVA----IAKCFVAKSEDFH-IYTQYCTNYPRSVAVLTECMRNKMVA-KFLRERQESLKHSLPLGSYLLKPVQRILKYHLLL 234          
BLAST of DH domain-containing protein vs. Ensembl Zebrafish
Match: mcf2lb (mcf.2 cell line derived transforming sequence-like b [Source:ZFIN;Acc:ZDB-GENE-081104-416])

HSP 1 Score: 83.1889 bits (204), Expect = 2.773e-16
Identity = 66/194 (34.02%), Postives = 102/194 (52.58%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKMSD---------SIFSNDKEVELIFSNWRNLRIFHS-LFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINE 1279
            VM EL+ETE  YV+ LM V +GY    D         +   N K+V  +F N + +  FH  +FL +L+    Y     + +  CFL+ +G  + +Y +YC N  +S + L R  +  +       +CQ +L H+L L ++LLKPVQRI KY L++KE+I+  K        G VE L  AL ++L +   +N+
Sbjct:   24 VMNELLETERAYVEELMCVLQGYAAEMDNPSMAPLIPAALQNKKDV--LFGNMQEIYNFHKRIFLRELETYTDYP----ELVGRCFLDWMGELQ-IYEKYCHNKPRS-ESLWRQCSDCAF----FQECQKKLEHKLGLDSYLLKPVQRITKYQLLIKEMIKYSK-----GCEGSVE-LQAALSSILGILKAVND 199          
BLAST of DH domain-containing protein vs. Ensembl Xenopus
Match: tmem117 (transmembrane protein 117 [Source:Xenbase;Acc:XB-GENE-982355])

HSP 1 Score: 120.168 bits (300), Expect = 1.646e-26
Identity = 99/331 (29.91%), Postives = 176/331 (53.17%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMK-MSDS--IFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANG-VVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+QE++ TE  YV+ L  + E Y+  +SD   +    +E   +F N  ++  F+S  L++L+  ++   +    ++ECF+ +   F  +Y++YCTNY +SV  L         A +   + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  +    + +L A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  +    +N R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++    I  +AK+ +L+
Sbjct:  165 VVQEILHTERAYVQDLKSIVEDYLNCISDQSRLSLGTEERSALFGNICDIYHFNSELLQELENCDNDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAILTECMRNKILA-KFFRERQEVLQHSLPLGSYLLKPVQRILKYHLLLHE------ISNHLDKDTEGYDIVLDAIDTMQRVAWHINDMKRKHEHDIRLQEIQSLLTNWKGPDLTSYGELVLEGTFRFQRAKNERTLFLFDRLLLITKKR-DDTYTYKAHILCCNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWILHLKRLILENHP-AKIPAKAKQAILE 481          
BLAST of DH domain-containing protein vs. Ensembl Xenopus
Match: tmem117 (transmembrane protein 117 [Source:Xenbase;Acc:XB-GENE-982355])

HSP 1 Score: 120.168 bits (300), Expect = 1.877e-26
Identity = 99/331 (29.91%), Postives = 176/331 (53.17%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMK-MSDS--IFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANG-VVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+QE++ TE  YV+ L  + E Y+  +SD   +    +E   +F N  ++  F+S  L++L+  ++   +    ++ECF+ +   F  +Y++YCTNY +SV  L         A +   + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  +    + +L A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  +    +N R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++    I  +AK+ +L+
Sbjct:  178 VVQEILHTERAYVQDLKSIVEDYLNCISDQSRLSLGTEERSALFGNICDIYHFNSELLQELENCDNDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAILTECMRNKILA-KFFRERQEVLQHSLPLGSYLLKPVQRILKYHLLLHE------ISNHLDKDTEGYDIVLDAIDTMQRVAWHINDMKRKHEHDIRLQEIQSLLTNWKGPDLTSYGELVLEGTFRFQRAKNERTLFLFDRLLLITKKR-DDTYTYKAHILCCNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWILHLKRLILENHP-AKIPAKAKQAILE 494          
BLAST of DH domain-containing protein vs. Ensembl Xenopus
Match: tmem117 (transmembrane protein 117 [Source:Xenbase;Acc:XB-GENE-982355])

HSP 1 Score: 117.857 bits (294), Expect = 7.409e-26
Identity = 95/316 (30.06%), Postives = 168/316 (53.16%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMK-MSDS--IFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANG-VVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSY 1663
            V+QE++ TE  YV+ L  + E Y+  +SD   +    +E   +F N  ++  F+S  L++L+  ++   +    ++ECF+ +   F  +Y++YCTNY +SV  L         A +   + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  +    + +L A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  +    +N R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++
Sbjct:  122 VVQEILHTERAYVQDLKSIVEDYLNCISDQSRLSLGTEERSALFGNICDIYHFNSELLQELENCDNDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAILTECMRNKILA-KFFRERQEVLQHSLPLGSYLLKPVQRILKYHLLLHE------ISNHLDKDTEGYDIVLDAIDTMQRVAWHINDMKRKHEHDIRLQEIQSLLTNWKGPDLTSYGELVLEGTFRFQRAKNERTLFLFDRLLLITKK-RDDTYTYKAHILCCNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWILHLKRLILENH 424          
BLAST of DH domain-containing protein vs. Ensembl Xenopus
Match: tmem117 (transmembrane protein 117 [Source:Xenbase;Acc:XB-GENE-982355])

HSP 1 Score: 117.857 bits (294), Expect = 7.755e-26
Identity = 101/330 (30.61%), Postives = 173/330 (52.42%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMK-MSDS--IFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANG-VVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            V+QE++ TE  YV+ L  + E Y+  +SD   +    +E   +F N  ++  F+S  L++L+  ++   +    ++ECF+ +   F  +Y++YCTNY +SV  L         A +   + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  +    + +L A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  +    +N R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+   E+      AK ILL
Sbjct:   26 VVQEILHTERAYVQDLKSIVEDYLNCISDQSRLSLGTEERSALFGNICDIYHFNSELLQELENCDNDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAILTECMRNKILA-KFFRERQEVLQHSLPLGSYLLKPVQRILKYHLLLHE------ISNHLDKDTEGYDIVLDAIDTMQRVAWHINDMKRKHEHDIRLQEIQSLLTNWKGPDLTSYGELVLEGTFRFQRAKNERTLFLFDRLLLITKK-RDDTYTYKAHILCCNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWILHLKRLIL---ENHPAKIPAKVILL 339          
BLAST of DH domain-containing protein vs. Ensembl Xenopus
Match: tmem117 (transmembrane protein 117 [Source:Xenbase;Acc:XB-GENE-982355])

HSP 1 Score: 117.472 bits (293), Expect = 9.965e-26
Identity = 101/330 (30.61%), Postives = 173/330 (52.42%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMK-MSDS--IFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANG-VVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            V+QE++ TE  YV+ L  + E Y+  +SD   +    +E   +F N  ++  F+S  L++L+  ++   +    ++ECF+ +   F  +Y++YCTNY +SV  L         A +   + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  +    + +L A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  +    +N R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+   E+      AK ILL
Sbjct:  122 VVQEILHTERAYVQDLKSIVEDYLNCISDQSRLSLGTEERSALFGNICDIYHFNSELLQELENCDNDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAILTECMRNKILA-KFFRERQEVLQHSLPLGSYLLKPVQRILKYHLLLHE------ISNHLDKDTEGYDIVLDAIDTMQRVAWHINDMKRKHEHDIRLQEIQSLLTNWKGPDLTSYGELVLEGTFRFQRAKNERTLFLFDRLLLITKKR-DDTYTYKAHILCCNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWILHLKRLIL---ENHPAKIPAKVILL 435          
BLAST of DH domain-containing protein vs. Ensembl Mouse
Match: Plekhg1 (pleckstrin homology domain containing, family G (with RhoGef domain) member 1 [Source:MGI Symbol;Acc:MGI:2676551])

HSP 1 Score: 118.242 bits (295), Expect = 4.991e-26
Identity = 96/319 (30.09%), Postives = 171/319 (53.61%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMK-MSD----SIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLI-QCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVS-ANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSY 1663
            V+QE++ETE  YV+ L  + EGY++ + D     + + D+    +F N +++  F+S  L+ L+   +   +    ++ECF+ +   F  +Y++YCTNY +SV  L   E   +        + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  A    + +L A+D M +VA  IN+ + + E  +R  +++  L + +  +    G   L+G  ++   +  R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++
Sbjct:  116 VVQEILETERTYVQDLKSIVEGYLECIRDQTKLPLVTEDRAA--LFGNIQDIYHFNSELLQDLENCENDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAVL--TECMRNKILTKFFRERQETLRHSLPLGSYLLKPVQRILKYHLLLHE------IENHLDKATEGYDVVLDAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWEGPDLTSYGELVLEGTFRIQKAKKERTLFLLDQLLLITKKR-DDTFTYKAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENH 418          
BLAST of DH domain-containing protein vs. Ensembl Mouse
Match: Plekhg1 (pleckstrin homology domain containing, family G (with RhoGef domain) member 1 [Source:MGI Symbol;Acc:MGI:2676551])

HSP 1 Score: 118.242 bits (295), Expect = 4.991e-26
Identity = 96/319 (30.09%), Postives = 171/319 (53.61%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMK-MSD----SIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLI-QCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVS-ANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSY 1663
            V+QE++ETE  YV+ L  + EGY++ + D     + + D+    +F N +++  F+S  L+ L+   +   +    ++ECF+ +   F  +Y++YCTNY +SV  L   E   +        + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  A    + +L A+D M +VA  IN+ + + E  +R  +++  L + +  +    G   L+G  ++   +  R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++
Sbjct:  116 VVQEILETERTYVQDLKSIVEGYLECIRDQTKLPLVTEDRAA--LFGNIQDIYHFNSELLQDLENCENDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAVL--TECMRNKILTKFFRERQETLRHSLPLGSYLLKPVQRILKYHLLLHE------IENHLDKATEGYDVVLDAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWEGPDLTSYGELVLEGTFRIQKAKKERTLFLLDQLLLITKKR-DDTFTYKAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENH 418          
BLAST of DH domain-containing protein vs. Ensembl Mouse
Match: Plekhg1 (pleckstrin homology domain containing, family G (with RhoGef domain) member 1 [Source:MGI Symbol;Acc:MGI:2676551])

HSP 1 Score: 117.857 bits (294), Expect = 5.848e-26
Identity = 96/319 (30.09%), Postives = 171/319 (53.61%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMK-MSD----SIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLI-QCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVS-ANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSY 1663
            V+QE++ETE  YV+ L  + EGY++ + D     + + D+    +F N +++  F+S  L+ L+   +   +    ++ECF+ +   F  +Y++YCTNY +SV  L   E   +        + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  A    + +L A+D M +VA  IN+ + + E  +R  +++  L + +  +    G   L+G  ++   +  R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++
Sbjct:  172 VVQEILETERTYVQDLKSIVEGYLECIRDQTKLPLVTEDRAA--LFGNIQDIYHFNSELLQDLENCENDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAVL--TECMRNKILTKFFRERQETLRHSLPLGSYLLKPVQRILKYHLLLHE------IENHLDKATEGYDVVLDAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWEGPDLTSYGELVLEGTFRIQKAKKERTLFLLDQLLLITKKR-DDTFTYKAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENH 474          
BLAST of DH domain-containing protein vs. Ensembl Mouse
Match: Plekhg1 (pleckstrin homology domain containing, family G (with RhoGef domain) member 1 [Source:MGI Symbol;Acc:MGI:2676551])

HSP 1 Score: 117.857 bits (294), Expect = 5.991e-26
Identity = 96/319 (30.09%), Postives = 171/319 (53.61%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMK-MSD----SIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLI-QCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVS-ANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSY 1663
            V+QE++ETE  YV+ L  + EGY++ + D     + + D+    +F N +++  F+S  L+ L+   +   +    ++ECF+ +   F  +Y++YCTNY +SV  L   E   +        + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  A    + +L A+D M +VA  IN+ + + E  +R  +++  L + +  +    G   L+G  ++   +  R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++
Sbjct:  191 VVQEILETERTYVQDLKSIVEGYLECIRDQTKLPLVTEDRAA--LFGNIQDIYHFNSELLQDLENCENDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAVL--TECMRNKILTKFFRERQETLRHSLPLGSYLLKPVQRILKYHLLLHE------IENHLDKATEGYDVVLDAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWEGPDLTSYGELVLEGTFRIQKAKKERTLFLLDQLLLITKKR-DDTFTYKAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENH 493          
BLAST of DH domain-containing protein vs. Ensembl Mouse
Match: Plekhg3 (pleckstrin homology domain containing, family G (with RhoGef domain) member 3 [Source:MGI Symbol;Acc:MGI:2388284])

HSP 1 Score: 115.931 bits (289), Expect = 2.569e-25
Identity = 111/400 (27.75%), Postives = 193/400 (48.25%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYM-KMSDSI-FSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL--DNKHNVLSQCQPISNDVLEKFQVTLNRENDVLDLESSLRKMFDP----VSTQSSQSKHKSIKRRNSVGAI 1903
            V++E+VETE +YV+ L  + E Y+ K+ D+      ++V  +F N  ++   +S  L  L   NS   +    ++ CF+E    F+ +Y++YC NY  SV  L         A +     Q  L H LPL ++LLKPVQR+LKYHL+L+E+ +            VVE    A+D M  VA  IN+ +   E  +R  +++  L +    +    G   L+   +V   RN R   L +  L++ K+ G+  +  +  I C+ +ML E   +  L F V     +K + ++Q    +EK  W   IK+LI+ ++ H +I ++AK  +L  D+ +    +C P      E+ +   + +++V       R+  +P    +   S +++   +K   S GA+
Sbjct:   97 VVREIVETERMYVQDLRSIVEDYLLKIIDTPGLLKPEQVSALFGNIESIYALNSQLLRDLDSCNSDPVA----VASCFVERSQEFD-IYTQYCNNYPNSVAALTECMQDKQQA-KFFRDRQELLQHSLPLGSYLLKPVQRVLKYHLLLQEIAK--HFDEEEDGFEVVED---AIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTTYGELVLEATFRVHRVRNDRTFFLFDKILLITKKRGD-HFVYKGHIPCSSLMLIEST-RDSLCFTVTHYKHSKQQYSIQAKTVEEKRSWTHHIKRLILENH-HATIPQKAKEAILEMDSYYPSRYRCSP------ERMKKAWSSQDEVSSHVRQGRRQSEPTRHLLRQLSEKARAVGMKHAGSAGAL 476          
BLAST of DH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9ULL1|PKHG1_HUMAN (Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens OX=9606 GN=PLEKHG1 PE=1 SV=2)

HSP 1 Score: 125.946 bits (315), Expect = 1.563e-27
Identity = 103/333 (30.93%), Postives = 172/333 (51.65%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDK------EVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+QE++ETE  YV+ L  + E Y+   D I    K      E   +F N +++  F+S  L+ L+   +   +    ++ECF+ +   F  +Y++YCTNY +SV  L         A +   + Q  L H LPL ++LLKPVQRILKYHL+L E+     L        VV   L A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  ++   +N R + L +  L++ K+  +  +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K +W   +K+LI+ ++    I  +AK+ +L+
Sbjct:  117 VVQEILETERTYVQDLKSIVEDYL---DCIRDQTKLPLGTEERSALFGNIQDIYHFNSELLQDLENCENDPVA----IAECFVSKSEEFH-IYTQYCTNYPRSVAVLTECMRNKILA-KFFRERQETLKHSLPLGSYLLKPVQRILKYHLLLHEIEN--HLDKDTEGYDVV---LDAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWKGPDLTSYGELVLEGTFRIQRAKNERTLFLFDKLLLITKKR-DDTFTYKAHILCGNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRLWVLHLKRLILENHAA-KIPAKAKQAILE 433          
BLAST of DH domain-containing protein vs. UniProt/SwissProt
Match: sp|A1L390|PKHG3_HUMAN (Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens OX=9606 GN=PLEKHG3 PE=1 SV=1)

HSP 1 Score: 119.783 bits (299), Expect = 9.579e-26
Identity = 102/329 (31.00%), Postives = 166/329 (50.46%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYM-KMSDSI-FSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V++E+VETE +YV+ L  + E Y+ K+ D+      ++V  +F N  N+   +S  L  L   NS   +    ++ CF+E    F+ +Y++YC NY  SV  L         A +     Q  L H LPL ++LLKPVQRILKYHL+L+E+ +            VVE    A+D M  VA  IN+ +   E  +R  +++  L +    +    G   L+G  +V   RN R   L +  L++ K+ G+  +  +  I C+ +ML E   +  L F V     +K + ++Q    +EK  W   IK+LI+ ++ H +I ++AK  +L+
Sbjct:   97 VVREIVETERMYVQDLRSIVEDYLLKIIDTPGLLKPEQVSALFGNIENIYALNSQLLRDLDSCNSDPVA----VASCFVERSQEFD-IYTQYCNNYPNSVAALTECMRDKQQA-KFFRDRQELLQHSLPLGSYLLKPVQRILKYHLLLQEIAK--HFDEEEDGFEVVED---AIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTTYGELVLEGTFRVHRVRNERTFFLFDKTLLITKKRGD-HFVYKGNIPCSSLMLIEST-RDSLCFTVTHYKHSKQQYSIQAKTVEEKRNWTHHIKRLILENH-HATIPQKAKEAILE 411          
BLAST of DH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q4VAC9|PKHG3_MOUSE (Pleckstrin homology domain-containing family G member 3 OS=Mus musculus OX=10090 GN=Plekhg3 PE=1 SV=2)

HSP 1 Score: 115.546 bits (288), Expect = 2.419e-24
Identity = 102/342 (29.82%), Postives = 170/342 (49.71%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYM-KMSDSI-FSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL--DNKHNVLSQCQP 1741
            V++E+VETE +YV+ L  + E Y+ K+ D+      ++V  +F N  ++   +S  L  L   NS   +    ++ CF+E    F+ +Y++YC NY  SV  L         A +     Q  L H LPL ++LLKPVQR+LKYHL+L+E+ +            VVE    A+D M  VA  IN+ +   E  +R  +++  L +    +    G   L+   +V   RN R   L +  L++ K+ G+  +  +  I C+ +ML E   +  L F V     +K + ++Q    +EK  W   IK+LI+ ++ H +I ++AK  +L  D+ +    +C P
Sbjct:   97 VVREIVETERMYVQDLRSIVEDYLLKIIDTPGLLKPEQVSALFGNIESIYALNSQLLRDLDSCNSDPVA----VASCFVERSQEFD-IYTQYCNNYPNSVAALTECMQDKQQA-KFFRDRQELLQHSLPLGSYLLKPVQRVLKYHLLLQEIAK--HFDEEEDGFEVVED---AIDTMTCVAWYINDMKRRHEHAVRLQEIQSLLINWKGPDLTTYGELVLEATFRVHRVRNDRTFFLFDKILLITKKRGD-HFVYKGHIPCSSLMLIEST-RDSLCFTVTHYKHSKQQYSIQAKTVEEKRSWTHHIKRLILENH-HATIPQKAKEAILEMDSYYPSRYRCSP 424          
BLAST of DH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q6KAU7|PKHG2_MOUSE (Pleckstrin homology domain-containing family G member 2 OS=Mus musculus OX=10090 GN=Plekhg2 PE=2 SV=2)

HSP 1 Score: 100.908 bits (250), Expect = 6.939e-20
Identity = 74/221 (33.48%), Postives = 117/221 (52.94%), Query Frame = 2
Query:  629 SRPQATVKHIVNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMKM---SDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHA-WQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINE 1279
            SRP+   +  + +  L P G +   ++  +   V +E+VETE  YV+ L  + E Y+       ++  N ++V  +F+N  ++  F S  LE L+       SS   ++ECF++    F+ +Y+ YC NY  S+  L  +  +     W  L + Q QL H LPL +FLLKPVQRILKYHL+L+EL    K  +    +G  E + +A+ +M  VA  IN+
Sbjct:   71 SRPEPLPEPPI-RLHLLPVG-IQGSVKPSRLERVAREIVETERAYVRDLRSIVEDYLGPLMDGRALGLNMEQVGTLFANIEDIYEFSSELLEDLE-----GCSSAGGIAECFVQRSEDFD-IYTLYCMNYPSSLALLRELSVSPPATLW--LQERQAQLRHSLPLQSFLLKPVQRILKYHLLLQEL---GKHWAEGPDSGGREMVEEAIVSMTAVAWYIND 278          
BLAST of DH domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9H7P9|PKHG2_HUMAN (Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3)

HSP 1 Score: 99.7525 bits (247), Expect = 1.423e-19
Identity = 76/221 (34.39%), Postives = 116/221 (52.49%), Query Frame = 2
Query:  629 SRPQATVKHIVNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMK--MSDSIFS-NDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHA-WQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINE 1279
            SRP+      + +  L P G +       +   V +E+VETE  YV+ L  + E Y+   +   +   + ++V  +F+N  ++  F S  LE L+  NS   SS   ++ECF++    F+ +Y+ YC NY  S+  L  +  +   A W  L + Q QL H LPL +FLLKPVQRILKYHL+L+EL    K  +     G  E + +A+ +M  VA  IN+
Sbjct:   75 SRPEPLPGPPI-RLHLSPVG-IPGSARPSRLERVAREIVETERAYVRDLRSIVEDYLGPLLDGGVLGLSVEQVGTLFANIEDIYEFSSELLEDLE--NS---SSAGGIAECFVQRSEDFD-IYTLYCMNYPSSLALLRELSLSPPAALW--LQERQAQLRHSLPLQSFLLKPVQRILKYHLLLQEL---GKHWAEGPGTGGREMVEEAIVSMTAVAWYIND 282          
BLAST of DH domain-containing protein vs. TrEMBL
Match: A0A158QF70 (DH domain-containing protein OS=Hymenolepis diminuta OX=6216 GN=HDID_LOCUS8434 PE=4 SV=1)

HSP 1 Score: 191.045 bits (484), Expect = 1.180e-46
Identity = 135/402 (33.58%), Postives = 210/402 (52.24%), Query Frame = 2
Query:  593 QCFVFEKDKLLQSRPQATVKHIVNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKE-VELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMS----HVSANG----VVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNS-RLVLLCENALVLAKRL------------------GNGKWGV---RQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            Q   F +  L Q RP +   +  ++    P+ +  S +  +K   V+ EL++TE  Y+ SL +++EGY +   ++   D   ++ IFSN   +  FH  F  +L L       +L  L+  FL+    FE LY E+CT ++ S++ L       S  W S+++CQ+QLGH LPL+++LLKPVQRILKY L+ +EL++ C L      H   NG     V+ L  AL  M+QVAN INE +          +LR    D D +     G   L    ++P  +++ RLVLL E A++LAK+                   G G   V   R +I CN +ML E I K PL FH++   +   + TLQ +NA+ K +WC+ IK++I+ +++  +I E+AK ++L
Sbjct:    4 QQLKFSEHPLDQLRPSSGRSYPCSR---TPDSSKGSRVALKKVAWVIGELLDTEIAYLDSLRDIKEGYYQPLLALNKFDTSTLDTIFSNVVQIHAFHQNFSGELSL----NQENLIGLANVFLDHAADFEELYVEFCTEHSLSIQTLEHESQIQSELWTSILECQSQLGHLLPLASYLLKPVQRILKYQLLFQELVKACTLAGLDQNHSIFNGDPTTTVDHLQSALQRMVQVANHINEAK---RHHDLISQLRAGGLDVDQW-----GRLLLRDVFRLPAKKHACRLVLLFERAILLAKKFSYAGNNSTPNLTDLQSNSGEGLQSVLEIRDIISCNNLMLIECIDKDPLAFHILPFNNPNAQKTLQAVNAEVKHLWCREIKRVILENFD-AAIPEKAKHLML 389          
BLAST of DH domain-containing protein vs. TrEMBL
Match: A0A068Y0P7 (DH domain containing protein OS=Echinococcus multilocularis OX=6211 GN=EmuJ_000533900 PE=4 SV=1)

HSP 1 Score: 189.119 bits (479), Expect = 4.351e-45
Identity = 123/385 (31.95%), Postives = 206/385 (53.51%), Query Frame = 2
Query:  644 TVKHIVNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMK--MSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMS--------HVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNS-RLVLLCENALVLAKRLGNGK--------------------WGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            +++H+       P+ +  + +  +K   V+ EL+ETE  Y++SL +++EGY    +++  F +   ++ +F+N   L  FH  F  +L        ++L  L++ FLE    FE LY E+CT ++ S++ L       +  W S++ CQT+LGH LPL+++LLKPVQR+LKY L+L+ELI+ C L          +   N +V+ L  AL+ M+QVA  INE +          +LR   +D D + C  L   +     ++P  +++ RLVLL E A++LAK+   G                       +R +I CN +ML E I K PL FH++   +   + TLQ  +A  K +WC+ IK++I+ +++  +I E+AK ++L
Sbjct:   12 SLEHLRPSSGRSPDSSAEACVSLKKVAWVISELLETELTYLESLRDIKEGYYLPLLAEGKF-DATTLDTVFNNIIQLHAFHQTFSGELY----RNQANLAGLADVFLEHAVDFEGLYVEFCTEHSLSIQTLEHESLLHTELWASILACQTRLGHLLPLASYLLKPVQRVLKYQLLLQELIKGCTLAGLGQNQRILNGDPNFIVKHLQSALERMIQVATHINEAK---RRHELIGQLRASGFDVDQWGCLLLRDVF-----RLPAKKHACRLVLLFERAILLAKKFYAGNNSAPNLKDLQSSSGEELQSVLEIRDIISCNNLMLIECIDKDPLAFHILPFNNPNAQKTLQAASADVKHLWCREIKRVILENFDA-AIPEKAKHLML 382          
BLAST of DH domain-containing protein vs. TrEMBL
Match: A0A068WMG8 (DH domain containing protein OS=Echinococcus granulosus OX=6210 GN=EgrG_000533900 PE=4 SV=1)

HSP 1 Score: 188.348 bits (477), Expect = 9.688e-45
Identity = 126/380 (33.16%), Postives = 203/380 (53.42%), Query Frame = 2
Query:  659 VNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMK--MSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMS--------HVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNS-RLVLLCENALVLAKRL-----------------GNGKWGV---RQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            V   S  P+ +  + +  +K   V+ EL+ETE  Y++SL +++EGY    +++  F +   ++ +F+N   L  FH  F  +L         +L  L++ FLE    FE LY E+CT ++ S++ L       +  W S++ CQT+LGH LPL+++LLKPVQR+LKY L+L+EL++ C L          +   N VV+ L  AL+ M+QVA  INE +          +LR   +D D + C  L   +     ++P  +++ RLVLL E A++LAK+                  G G   V   R +I CN +ML E I K PL FH++   +   + TLQ  +A  K +WC+ IK++I+ +++  +I E+AK ++L
Sbjct:   23 VYSHSRSPDSSAEARVSLKKVAWVISELLETELTYLESLRDIKEGYYLPLLAEGKF-DATTLDTVFNNIIQLHAFHQTFSGELY----RNQENLVGLADVFLEHAVDFEGLYVEFCTEHSLSIQTLEHESLLHTELWASILACQTRLGHLLPLASYLLKPVQRVLKYQLLLQELVKGCTLAGLGQNQSIFNGDPNFVVKHLQSALERMIQVATHINEAK---RRHELIGQLRASGFDVDQWGCLLLRDVF-----RLPAKKHACRLVLLFERAILLAKKFYAGNNSAPNLKDLQSSSGEGLQSVLEIRDIISCNNLMLIECIDKDPLAFHILPFNNPNAQKTLQAASADVKHLWCREIKRVILENFD-AAIPEKAKHLML 388          
BLAST of DH domain-containing protein vs. TrEMBL
Match: A0A158RFB3 (DH domain-containing protein OS=Hydatigena taeniaeformis OX=6205 GN=TTAC_LOCUS9396 PE=4 SV=1)

HSP 1 Score: 186.422 bits (472), Expect = 4.226e-44
Identity = 125/380 (32.89%), Postives = 202/380 (53.16%), Query Frame = 2
Query:  659 VNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMK--MSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMS--------HVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNS-RLVLLCENALVLAKRL-----------------GNGKWGV---RQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILL 1705
            V   S  P+    + +  +K   V+ EL+ETE  Y++SL +++EGY    +++  F +   ++++FSN   L  FH +F  +L          L  L++ FLE    FE LY E+CT ++ S++ L       S  W S++ CQ++LGH LPL+++LLKPVQR+LKY L+L+EL++   L          +   N VV+ L  AL+ M+QVA  INE +          +LR    D D + C  L   +     ++P  +++ RLVLL E A++LAK+                  G G   V   R +I CN +ML E I K PL FH++   +   + TLQ  + + K++WC+ IK++I+ +++  +I E+AK ++L
Sbjct:   23 VYSHSHSPDSLTEARVALKKVAWVISELLETEVAYLESLRDIKEGYYLPLIAEGKF-DATTLDIVFSNITQLHAFHQIFSNELY----RNRDDLVGLADVFLERATDFEGLYVEFCTEHSLSIQTLEHESHLQSELWASILACQSRLGHLLPLASYLLKPVQRVLKYQLLLQELVKGYTLAGLGQNQSIFNGDPNSVVKHLQSALERMIQVATHINEAK---RRHELIGQLRASGLDVDQWGCLLLRDVF-----RLPAKKHACRLVLLFERAILLAKKFSYAGNNSAPNLKDLQSPGEGSQSVLEIRDIISCNNLMLIECIDKDPLAFHILPFNNPNAQKTLQAASTEVKQLWCREIKRVILENFDA-AIPEKAKHLML 388          
BLAST of DH domain-containing protein vs. TrEMBL
Match: A0A504YC62 (Putative transcript OS=Fasciola gigantica OX=46835 GN=FGIG_02055 PE=4 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 5.951e-41
Identity = 129/414 (31.16%), Postives = 192/414 (46.38%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVE-----LIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSA----------------------------------NGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWG------------------------------------------------VRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+ EL+ETE  YV+SL +V++GY+         D +VE      +F    +LRIFH   L  L+L        L +L+  FL     FE LY E+C NY++S+  L   +   +  W  L  CQ  LGHQLP+ T+LLKPVQR+LKY L+L+E ++ C  MS + A                                  N  V  L +AL+ M++VA+ INEK+  RE   +   +R ++ D         G   L G  +VPG ++ RLVLL   A++L K  G+ + G                                                +R++I C  +ML E IPK  L FH++   + K + TLQ    + K +WC+ IK+LI+ +Y+  +I E+AK I+L+
Sbjct:   42 VIGELIETEKNYVQSLFDVDQGYLAQ----LLQDPDVESSVLDTVFGRIGDLRIFHEHLLLNLQL----HREDLVQLARVFLNNAKQFEHLYVEFCINYSKSIHTLQDAKQNRTSLWNKLTTCQRNLGHQLPVETYLLKPVQRVLKYQLLLQECVKHC--MSAIHALNRSGEAPTDTNRAVPSSHGLDLTDSRISLLHHLNEAVPVLGQALERMIKVADHINEKKRCRELIDQLRTMRIDVDD--------WGELVLRGYFRVPGKKDLRLVLLFHRAILLCKNSGSTQSGQSGTFSASGSADQLWSASTSTIHNTEFGFSNSSLPNLGGHASGSRTVQIREIINCANLMLVECIPKDALAFHILPFDNPKAQRTLQAPTLEMKRLWCREIKRLILENYD-AAIPEKAKHIVLN 436          
BLAST of DH domain-containing protein vs. Ensembl Cavefish
Match: PLEKHG1 (pleckstrin homology and RhoGEF domain containing G1 [Source:HGNC Symbol;Acc:HGNC:20884])

HSP 1 Score: 124.405 bits (311), Expect = 5.459e-28
Identity = 99/321 (30.84%), Postives = 167/321 (52.02%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVEL-------IFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHR-METTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVV-ESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSY 1663
            V+QE++ETE  YV+ L  + + Y++      SN     L       +F N R +  F+   L  L+  N+   +    ++ECF+ +   F  +Y++YCTNY +SV  L   M   A   +  L + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  +  + E + +A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  +V   +N R + L +  L++ K+     +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K  W + +K+LI+ ++
Sbjct:   88 VVQEILETERTYVQDLRSIVQDYLE----CISNQARPLLGVEDRNSLFGNIREIYGFNRDLLHDLEKCNANPVA----IAECFVAKSEEFH-IYTQYCTNYPRSVAVLSECMRNKAVAKF--LRERQESLKHSLPLGSYLLKPVQRILKYHLLLHE------IATHLEKDSEMHEVVQEAIDTMQRVAWHINDMKRKHENTIRLQEIQSLLTNWQGPDLIGYGELVLEGTFRVQRVKNERTLFLFDKLLLITKKR-EETYTYKAHILCCNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRTWIQHLKRLILENH 390          
BLAST of DH domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000043929.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:1805767:1835459:1 gene:ENSAMXG00000040969.1 transcript:ENSAMXT00000043929.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 5.255e-22
Identity = 91/291 (31.27%), Postives = 147/291 (50.52%), Query Frame = 2
Query:  845 IFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLH---RMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            +F N   +  F+S  L+ L+L +S   +    ++ CF+++  +F  +Y++YCTNY  SV  L    R +T A    +     Q  L   LPL  +LLKPVQRILKYHL+L+E+ +            VVE   +A+D M  VA  IN+ + + E  +R+ +++  L +    +    G   L+G   V   +N R + L +  L++ K+ G   +  +  I C+ +ML E   K  L F V      K   T+Q    +EK++W   IK+LI+ ++ H  I + AK  +LD
Sbjct:   72 LFGNIEVIYEFNSELLQSLELCDSDPVA----IACCFVDKSEYFN-IYTQYCTNYPNSVATLTECMRNKTLA----KFFRDRQASLERSLPLGAYLLKPVQRILKYHLLLQEIAK--HFDPEEDGYDVVE---EAIDTMTGVAWYINDMKRKHEHAVRQQEIQSLLINWKGPDLTTYGELVLEGTFHVQRAKNERTLFLFDKMLLITKKRGE-HYVYKTHITCSTLMLIESA-KDLLRFSVTHYKHPKQPHTVQAKTVEEKKLWAHHIKRLILENH-HAVIPQTAKNAILD 345          
BLAST of DH domain-containing protein vs. Ensembl Cavefish
Match: ENSAMXT00000055531.1 (pep primary_assembly:Astyanax_mexicanus-2.0:9:1805767:1835459:1 gene:ENSAMXG00000040969.1 transcript:ENSAMXT00000055531.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 104.375 bits (259), Expect = 5.617e-22
Identity = 91/291 (31.27%), Postives = 147/291 (50.52%), Query Frame = 2
Query:  845 IFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLH---RMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            +F N   +  F+S  L+ L+L +S   +    ++ CF+++  +F  +Y++YCTNY  SV  L    R +T A    +     Q  L   LPL  +LLKPVQRILKYHL+L+E+ +            VVE   +A+D M  VA  IN+ + + E  +R+ +++  L +    +    G   L+G   V   +N R + L +  L++ K+ G   +  +  I C+ +ML E   K  L F V      K   T+Q    +EK++W   IK+LI+ ++ H  I + AK  +LD
Sbjct:   72 LFGNIEVIYEFNSELLQSLELCDSDPVA----IACCFVDKSEYFN-IYTQYCTNYPNSVATLTECMRNKTLA----KFFRDRQASLERSLPLGAYLLKPVQRILKYHLLLQEIAK--HFDPEEDGYDVVE---EAIDTMTGVAWYINDMKRKHEHAVRQQEIQSLLINWKGPDLTTYGELVLEGTFHVQRAKNERTLFLFDKMLLITKKRGE-HYVYKTHITCSTLMLIESA-KDLLRFSVTHYKHPKQPHTVQAKTVEEKKLWAHHIKRLILENH-HAVIPQTAKNAILD 345          
BLAST of DH domain-containing protein vs. Ensembl Cavefish
Match: plekhg2 (pleckstrin homology domain containing, family G (with RhoGef domain) member 2 [Source:ZFIN;Acc:ZDB-GENE-090819-1])

HSP 1 Score: 100.523 bits (249), Expect = 1.069e-20
Identity = 106/358 (29.61%), Postives = 172/358 (48.04%), Query Frame = 2
Query:  659 VNKFSLCPNGNLNSDIER-EKWHLVMQELVETEHIYVKSLMEVEEGYMKM---SDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQ-CQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHV-SANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLA-KRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLDN 1711
            +   SL P    ++ + +  +   V  E+VETE  YV+ L  + E Y+        +    +EV  +F N  ++  F+S  LE L+       S    ++ECF+E    F+ +Y+ YC NY  SV  L   +   +       Q  Q  L H LPL T+LLKPVQRILKYHL+L+EL +      H   ++   E +  A+  M  VA  IN+ + ++E  +R  ++   L +    +    G   L+G  +V   +  R   L +  L++A KRL +  +     I C  ++L E + K PL F V D T  K +  +Q+    E+    K IK LI+ ++   S+ ++A+++L D 
Sbjct:  103 LTPLSLLPGATPSTPLPKLSRLQRVALEIVETEQAYVRDLKSIVEDYLGCIIDCGDLPLKPEEVSTLFCNIEDIYEFNSDLLEDLE-----RSSHAAAIAECFVERSEAFD-IYTIYCMNYPNSVAVLR--DCMKNECLVRFFQERQATLCHSLPLETYLLKPVQRILKYHLLLQELSK------HFDKSDPGYEVVEDAIITMTAVAWYINDMKRKQEHAVRLQEIESLLLNWTGPDLSGFGELVLEGSFRVQRVKKERAFFLFDKMLLIAKKRLDHFIYSTH--IFCCNLLLVENM-KDPLCFKVSDQTIPKQQHIVQIT---ERMCHLKHIKILIVENHPA-SLPQKARQVLGDT 439          
BLAST of DH domain-containing protein vs. Ensembl Cavefish
Match: mcf2l2 (MCF.2 cell line derived transforming sequence-like 2 [Source:ZFIN;Acc:ZDB-GENE-100812-1])

HSP 1 Score: 85.5001 bits (210), Expect = 3.537e-16
Identity = 79/266 (29.70%), Postives = 126/266 (47.37%), Query Frame = 2
Query:  530 HSAVVKSHLKDSGTSSLNDEDQCF-VFEKDKLLQSRPQATVKHIVNKFSLCPNGNL---NSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMKMSD---------SIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLI--QCQTQLGHQLPLSTFLLKPVQRILKYHLILK-ELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINE 1279
            H  ++  H+K +  S+L   D+   +FEK  +   R  A     V   +  P  +    +    R     +M EL+E+E  YV+ L  + EGY+   D         ++  N K+V  +F N   +  FH+ FL++L+  N  E   L  +  CFL+     + +Y +YC N  +S       E        S+   +CQ +L H+L L  +LLKPVQRI KY L+LK E+++C K     ++ G  E L +AL  ML +   +N+
Sbjct:  486 HEIILSDHIKINVQSALKRLDEVQEMFEKRHISLKRLSAKQSRPVQPVAPRPESSPKRPSPKTPRPSGPHIMNELIESERYYVEELQSIMEGYVAALDNSEMTHLIPAVLENKKDV--LFGNLGEIWDFHNTFLKELE--NYVEKPEL--VGTCFLKRKEELQ-IYEKYCQNKPRS-------EALWRQCGDSMFFQECQKRLDHKLSLDAYLLKPVQRITKYQLMLKQEMLKCSK-----NSEGTAE-LEEALATMLDIIKSVND 731          
BLAST of DH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008020.1 (pep scaffold:Pmarinus_7.0:GL476484:132482:154779:-1 gene:ENSPMAG00000007248.1 transcript:ENSPMAT00000008020.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.961 bits (341), Expect = 4.776e-35
Identity = 108/327 (33.03%), Postives = 182/327 (55.66%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+ E+++TE +YV+ L  + E Y++       ND +V  +F N + +  F+S  LE+L+  ++   +    ++ECF+E+ G FE +Y++YCTN+  S++ L +   T S A +     Q  L H LPL +FLLKPVQRILKYHL+L+E+ +  +L        VV+    AL  M  VA  INE + + E  +R  +LR  L +    +   LG   L+G  ++   R  R + L +++L++ K+  +G +  +  IKC  +M+ E  P++ LEF V    + K + T Q    +EK  W   IK+LI+ ++   ++ ++AK I+L+
Sbjct:   13 VVLEILDTERMYVRHLKSIVEDYLRAISQRLPND-DVNTLFGNIKEIYKFNSELLEELEDCSNDPVA----IAECFVEKSGGFE-IYTQYCTNFPSSMELLTKCMRTKSTA-KFFRDHQAALKHNLPLGSFLLKPVQRILKYHLLLQEIEK--RLDKSTDGYEVVQD---ALSAMHGVAWHINEMKRKHEHAIRIQELRGLLINLKQ-DLSILGDLALEGSFRLHRTRKERALFLFDSSLLITKKRDDGMFLFKNEIKCRNLMILEQ-PRE-LEFCVWHYKNEKPRYTFQAKTQEEKSQWIHHIKRLILENHP-STVPDKAKNIILE 323          
BLAST of DH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008024.1 (pep scaffold:Pmarinus_7.0:GL476484:132482:154761:-1 gene:ENSPMAG00000007248.1 transcript:ENSPMAT00000008024.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 129.798 bits (325), Expect = 6.691e-33
Identity = 110/335 (32.84%), Postives = 186/335 (55.52%), Query Frame = 2
Query:  728 VMQELVETEHIYV---KSLME-----VEEGYMKMSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+ E+++TE +YV   KS++E     +E+ Y++       ND +V  +F N + +  F+S  LE+L+  ++   +    ++ECF+E+ G FE +Y++YCTN+  S++ L +   T S A +     Q  L H LPL +FLLKPVQRILKYHL+L+E+ +  +L        VV+    AL  M  VA  INE + + E  +R  +LR  L +    +   LG   L+G  ++   R  R + L +++L++ K+  +G +  +  IKC  +M+ E  P++ LEF V    + K + T Q    +EK  W   IK+LI+ ++   ++ ++AK I+L+
Sbjct:    7 VVLEILDTERMYVRHLKSIVESYVNLIEQDYLRAISQRLPND-DVNTLFGNIKEIYKFNSELLEELEDCSNDPVA----IAECFVEKSGGFE-IYTQYCTNFPSSMELLTKCMRTKSTA-KFFRDHQAALKHNLPLGSFLLKPVQRILKYHLLLQEIEK--RLDKSTDGYEVVQD---ALSAMHGVAWHINEMKRKHEHAIRIQELRGLLINLKQ-DLSILGDLALEGSFRLHRTRKERALFLFDSSLLITKKRDDGMFLFKNEIKCRNLMILEQ-PRE-LEFCVWHYKNEKPRYTFQAKTQEEKSQWIHHIKRLILENHP-STVPDKAKNIILE 325          
BLAST of DH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003234.1 (pep scaffold:Pmarinus_7.0:GL476714:93500:128189:1 gene:ENSPMAG00000002944.1 transcript:ENSPMAT00000003234.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 1.147e-27
Identity = 99/331 (29.91%), Postives = 172/331 (51.96%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKM---SDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLI-QCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+ E+++TE +YVK L  + E Y+     +  +  + +EV  +F N  ++   +  F E L  + S  F  +  +++CF+ +   F  +Y++YC NY  ++  L+  E   S A      + Q  L H LPL  +LLKPVQRILKYHL+L+E+    + +    A G +E + +A   M  VA  IN+ + + E   R  +++ +L           G   L+G  +V   R+ R + L    L+L KR  +  +  +  I C+ +ML E++PK+PL F V    ++K + T+Q  +  EK +W   +K+LI+ ++    I  +AK+ +L+
Sbjct:  119 VVLEVLQTEQMYVKDLRSIVENYLGCIIDTPDLPLSPEEVCTLFGNIEDIYALN--FSELLHELESCAFDPVA-IADCFVAKNEAFH-IYTQYCMNYPNAIDVLN--ECARSVAMTRFFGEVQASLKHSLPLGCYLLKPVQRILKYHLLLREIANHYEGL----AEG-MEVIEEATATMTSVAWHINDIKRKHEHAARVQEIQAQLVQWQGPELCRYGELVLEGTFRVHRARHERSLFLFHCILLLTKRRDDA-YAYKAHILCSNLMLVEHVPKEPLSFSVRHFKNSKVQHTVQARSFDEKRLWIHELKRLILENHP-GKIPLKAKQAILE 436          
BLAST of DH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006386.1 (pep scaffold:Pmarinus_7.0:GL476470:857650:882189:-1 gene:ENSPMAG00000005742.1 transcript:ENSPMAT00000006386.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 81.2629 bits (199), Expect = 4.149e-16
Identity = 85/352 (24.15%), Postives = 161/352 (45.74%), Query Frame = 2
Query:  665 KFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGY---MKMSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQV-IKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            + +L  +G   S +ER     V+ E+++TE  YV+ L  + + Y   M+ +  +  + +++  +F N R++   +   L+ L++      ++    + CF+ +   F+ +Y+EYC NY  +V  +H +      +  S  +C  +   Q+ + +   K V+  L   L+   L        +        ++L+ALD M  VA  INE +   E+  R  ++   L           G   L+G  +V   RN R   L  N L+ A+R  +       + I+C + +L+  +    ++FHV  T + K     Q  + +EK +W   +K+LI+ +Y  D I  +AK+ +LD
Sbjct:  100 RMTLAADGCSLSSLER-----VLLEMLQTERAYVRDLSSIVQDYLGCMEATPGLPLSSQDLGTLFGNVRSIYFLNRDLLQDLEVCGLDPVAA----ARCFISKSEAFQ-IYTEYCMNYPNTVGVVHAIPCNCVLSTSSEPRC-ARYKFQIVVISHKYKCVRWWLCRQLLGTGLKS-----QNAKRTATHRTVLEALDTMTGVAQHINEVKRRHEQASRVQEIERLLSSWHGPELGRYGELVLEGVFRVARARNQRTFFLFTNILLFARRRDHIYVCKGHILIECKQSVLYHPLVNSNMDFHVPHTRNRKLCHQYQAHSVEEKRLWVHELKRLILENYPSD-IPLKAKQAILD 434          
BLAST of DH domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006962.1 (pep scaffold:Pmarinus_7.0:GL481838:263808:335470:1 gene:ENSPMAG00000006236.1 transcript:ENSPMAT00000006962.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 78.1814 bits (191), Expect = 1.235e-14
Identity = 66/206 (32.04%), Postives = 106/206 (51.46%), Query Frame = 2
Query:  707 EREKWHLVMQELVETEHIYVKSLMEVEEGYMK-MSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLK--LINSYEFSSLQR----------LSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQ 1285
            E +K   V+ ELVETE  YVK L  ++E Y++ +    F +  ++E +F   R L IF   FL+ L+  L  + +F +L++          L   FL    HF+ LYS YC ++ ++ K L   +   +     L +   +  H   L ++L+KP+QR+LKY L+L+EL+      S  + +     L +AL  M +VA+ INE Q
Sbjct:  559 EADKLRKVILELVETERSYVKDLCTLQEIYVEPLQKEAFLSPDQLEALFGTLRELVIFQKEFLQTLEQGLSLAPDFETLEQPAHFRRVLFSLGGSFLYYSDHFK-LYSAYCASHPKAQKLLETAKRDPAFG-AFLDERNPRRQHSSTLESYLIKPIQRVLKYPLLLRELVSLTDADSEENYH-----LTEALRAMNKVASHINEMQ 757          
BLAST of DH domain-containing protein vs. Ensembl Yeast
Match: CDC24 (Guanine nucleotide exchange factor (GEF) for Cdc42p; required for polarity establishment and maintenance, and mutants have morphological defects in bud formation and shmooing; relocalizes from nucleus to cytoplasm upon DNA replication stress; thermosensitivity of the cdc24-4 mutant in the presence of sorbitol is functionally complemented by human CDC42 [Source:SGD;Acc:S000000039])

HSP 1 Score: 60.8474 bits (146), Expect = 1.239e-9
Identity = 56/190 (29.47%), Postives = 91/190 (47.89%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHL----HRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQ 1285
            +++E V TE  YV  L  +++   ++ DS     +E+ ++F N  +   F   FL  L+ IN+    S QR+   F+    HF  LY  +      +++ L    H+M    S   Q  I     + ++L L +FL KPVQR+ +Y L++KE      L++  S +   + L  ALD    +A  INE Q
Sbjct:  282 IIKEFVATERKYVHDLEILDKYRQQLLDSNLITSEELYMLFPNLGDAIDFQRRFLISLE-INALVEPSKQRIGALFMHS-KHFFKLYEPWSIGQNAAIEFLSSTLHKMRVDES---QRFI-----INNKLELQSFLYKPVQRLCRYPLLVKE------LLAESSDDNNTKELEAALDISKNIARSINENQ 455          
BLAST of DH domain-containing protein vs. Ensembl Nematostella
Match: EDO32328 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SVF8])

HSP 1 Score: 86.6557 bits (213), Expect = 4.692e-17
Identity = 92/332 (27.71%), Postives = 144/332 (43.37%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYM--------KMSDSIFSNDKEVELIFSNWRNLRIFHSL-FLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLI-------QCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNS-RLVLLCENALVLAKRLGNG------KWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLII 1654
            +M ELV TE  YV+ L  +  GY+        K+   +F    + E IF N   +  FH   FLE+L   +     + + + + F E  G FE  Y+ YC N              AS A Q  +       +CQ  LGH+LPL+ +LLKPVQRI KY L+L+E+++  K       N     L++A   M  V   +N+  +     L+            +   PFL   Y     K+P  + S R V L E  ++ +KR  +        +  +  IK +++ + E I   PL+F +           LQ  N++ KE W   I+ +++
Sbjct:  488 IMAELVTTEKDYVRDLDHIVRGYLHEFERAAGKIPIELFD---QRETIFGNIEEILEFHRCDFLEELNKCSE----TPKSVGKVFTERRGEFEK-YALYCKN------------KPASEALQQQLINVPYIRECQANLGHKLPLTAYLLKPVQRITKYQLLLREMMKNTKNDRIAYMN-----LMEAFHAMQNVLRHLND--VMHSSGLKGYHGNLGDLGKLLLQDPFL-VWYTGARRKLPPLKGSQRQVFLYEKMVIFSKREEDSTTKDAVTYHFKNSIKTSDVGITETINGAPLKFELW-LPGRTEVFLLQANNSEIKERWISEIRSVLL 790          
BLAST of DH domain-containing protein vs. Ensembl Nematostella
Match: EDO43752 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXC9])

HSP 1 Score: 85.1149 bits (209), Expect = 1.705e-16
Identity = 92/349 (26.36%), Postives = 145/349 (41.55%), Query Frame = 2
Query:  725 LVMQELVETEHIYV---KSLMEVEE----------------GYMKMSDSIFSNDKEV--------ELIFSNWRNLRIFHS-LFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCR------NSRLVLLCENALVLAKRL----GNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTT--DNKNKATLQVMNAQEKEMWCKMIKQLI 1651
             ++ EL++TE  YV   K ++EV                  GY  +  ++ S+  +V         +IF N +++  FHS  FL++++    YE +  + + E F+E    F   Y  YC N   S   L        H        Q   GH L +S +L+KPVQRI KY L+LK+L+ CC+        G   SL   LD ML V  R N+                        N   LG   L     V   +        R V L E ALV +K      G   +  +  +K +E+ + E+I + P +F V       +++K  ++  N + K++W K +++LI
Sbjct: 1209 FIVNELLQTERAYVGDLKCVIEVSSVRISSKRRMPLRISLSGYCAVFPALRSSAYDVPAGLVGKESIIFGNIQDIYKFHSNTFLQEME---KYE-THPEDVGEAFIEWGETFVRFYVSYCKNKPFSNSLL------IEHGGNFFSDLQASYGHGLSISAYLIKPVQRITKYQLLLKDLLTCCE--------GSENSLQAGLDVMLSVPRRANDAMYVNMLHGLEE------------NLDHLGRIILQDAFTVFDPKLLRRKGKDRHVFLFEQALVFSKETKDNDGKVSYLYKYKLKTSELGVTEHIAEDPCKFAVWTGKPPQSEDKRVIKAANIEVKQLWVKELRELI 1527          
BLAST of DH domain-containing protein vs. Ensembl Nematostella
Match: EDO44980 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUA3])

HSP 1 Score: 68.1662 bits (165), Expect = 2.902e-11
Identity = 59/218 (27.06%), Postives = 96/218 (44.04%), Query Frame = 2
Query:  713 EKWHLVMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDK--EVELIFSNWRNLRIFHSLFLEKLKLINSYEFS----SLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMET--TASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGV---------------------VESLLKALDNMLQVANRINE 1279
            E+   V+ EL+ TE  Y++ L       +K       N K  + E++F N       HS+     +L+ S+E +      Q L +CF E     +++YS YC N+  ++  L + E    A  A++  +           LS+FL+KPVQR+LKY L+L EL++      + S                          ++L++AL  M +VA  INE
Sbjct:  976 EQRQKVLTELLNTERDYIRDLQTC----LKYFYEELKNTKVVDAEVLFGN------MHSVVETSTRLLGSFEAALQDDKQQELGKCFAEHAEEIKSVYSTYCKNHDDAIGLLEKYEDCLEAQEAFRKCLDAVRDTTKCWDLSSFLIKPVQRVLKYPLLLSELLKVIPYKVYGSTAKCKTIRIKYMARLLKCTPQIHKDKDNLVRALSAMTEVAATINE 1183          
BLAST of DH domain-containing protein vs. Ensembl Nematostella
Match: EDO45201 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RTF1])

HSP 1 Score: 66.6254 bits (161), Expect = 3.255e-11
Identity = 60/191 (31.41%), Postives = 97/191 (50.79%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYMKMSD---SIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRM--ETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQ 1285
            V+ E++ TE  YVK+L +V EGY+  +     +FS D ++ L+FSN   +  FH   L +L+     +      +   FLE    F+ +YSEYC N+  ++  L  +       H +++    Q  +   + L  FLL PVQ+I KY L L EL++     +H   + V +    AL  M +VA+ INE++
Sbjct:   96 VVNEILNTEKDYVKNLSDVVEGYLCQAQKRVDMFSED-QIYLLFSNIEQIYEFHQKLLLQLEDCYLKDNPCDSMIGRVFLENKEGFQ-IYSEYCNNHPHAIAELKTLCESNNYKHFFEACRLLQDMIN--ISLDGFLLTPVQKICKYPLQLAELLKHT-YPTHKDYDAVHD----ALRTMKEVASLINERK 277          
BLAST of DH domain-containing protein vs. Ensembl Nematostella
Match: EDO43753 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXD0])

HSP 1 Score: 63.929 bits (154), Expect = 4.803e-11
Identity = 43/158 (27.22%), Postives = 83/158 (52.53%), Query Frame = 2
Query:  725 LVMQELVETEHIYVKSLMEVEEGYMK------MSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQ 1180
             V++EL++TE  YV SL EV +GY+       + + +   ++   ++F N + +  +H   LEK +        + ++L+  FL+     + +Y  YC N  +S   +H  + T           + +LG++L +  +L+KPVQR++KY L+LK+ ++
Sbjct:    1 FVLRELIQTEQDYVTSLGEVVDGYIAEFSKPDLPEELKGKER---MVFGNIKQIYEWHKTELEKCE-------DAPEKLASVFLKAERRLQ-MYVIYCQNKPKSTALVHEFKET------YFTDMKDRLGYRLSIEDYLIKPVQRVMKYQLLLKDFVK 141          
BLAST of DH domain-containing protein vs. Ensembl Medaka
Match: PLEKHG1 (pleckstrin homology and RhoGEF domain containing G1 [Source:NCBI gene;Acc:101161938])

HSP 1 Score: 125.946 bits (315), Expect = 1.863e-28
Identity = 105/334 (31.44%), Postives = 177/334 (52.99%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYM----KMSD-SIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLI-QCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVV-ESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+QE+++TE  YV+ L  + E Y+    K S  ++ S DK    +F N R++  F+   L  L+  NS   +    ++ECF+ +   F  +Y++YCTNY +SV  L   E   + A      + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  +    E + +A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  ++   +N R + L +  L++ K+     +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K MW   +K+LI+ ++    I  +AK+ +L+
Sbjct:  164 VVQEILDTERTYVQDLRSIVEDYLECISKQSRLALSSQDKSS--LFGNIRDIYHFNRDLLHHLEKCNSDPVA----IAECFVCKSEEFH-IYTQYCTNYPRSVAVL--TECMRNKALAKFFRERQESLRHALPLGSYLLKPVQRILKYHLLLHE------IANHMEKDTETHEVVQEAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWKGPDLIGYGELVLEGTFRLQRAKNERTLFLFDKLLLITKKR-EETYTYKAHILCCNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRMWILHLKRLILENHPA-KIPAKAKQAILE 480          
BLAST of DH domain-containing protein vs. Ensembl Medaka
Match: PLEKHG1 (pleckstrin homology and RhoGEF domain containing G1 [Source:NCBI gene;Acc:101161938])

HSP 1 Score: 125.946 bits (315), Expect = 1.955e-28
Identity = 105/334 (31.44%), Postives = 177/334 (52.99%), Query Frame = 2
Query:  728 VMQELVETEHIYVKSLMEVEEGYM----KMSD-SIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLI-QCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVV-ESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            V+QE+++TE  YV+ L  + E Y+    K S  ++ S DK    +F N R++  F+   L  L+  NS   +    ++ECF+ +   F  +Y++YCTNY +SV  L   E   + A      + Q  L H LPL ++LLKPVQRILKYHL+L E      + +H+  +    E + +A+D M +VA  IN+ + + E  +R  +++  L +    +    G   L+G  ++   +N R + L +  L++ K+     +  +  I C  +ML E IPK+PL F V    + K + T+Q  + Q+K MW   +K+LI+ ++    I  +AK+ +L+
Sbjct:  111 VVQEILDTERTYVQDLRSIVEDYLECISKQSRLALSSQDKSS--LFGNIRDIYHFNRDLLHHLEKCNSDPVA----IAECFVCKSEEFH-IYTQYCTNYPRSVAVL--TECMRNKALAKFFRERQESLRHALPLGSYLLKPVQRILKYHLLLHE------IANHMEKDTETHEVVQEAIDTMQRVAWHINDMKRKHEHAVRLQEIQSLLTNWKGPDLIGYGELVLEGTFRLQRAKNERTLFLFDKLLLITKKR-EETYTYKAHILCCNLMLVEVIPKEPLSFSVFHYKNPKLQHTVQAKSQQDKRMWILHLKRLILENHPA-KIPAKAKQAILE 427          
BLAST of DH domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000046986.1 (pleckstrin homology domain-containing family G member 3 [Source:NCBI gene;Acc:101157827])

HSP 1 Score: 123.25 bits (308), Expect = 1.201e-27
Identity = 106/358 (29.61%), Postives = 182/358 (50.84%), Query Frame = 2
Query:  665 KFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKE------VELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLH---RMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSA-NGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            + ++ PN NL   ++R     V+ E++ETE +YV+ L+ + E Y+     I  + K+      V  +F N  ++  F++  L+ L +  +   +    ++ CF+E+  +F+ +Y++YCTNY  SV  L    R ++TA    Q     Q  L   LPL ++LLKPVQRILKYHL+L+E+ +      H        E + +A++ M  VA  IN+ + + E  +R  +++  L +    +    G   L+G  KV   +N R + L +  L+  KR G   +  +  I C  +ML E   K  L F V    + K   T+Q    +EK++W   IK++I+ ++ H  I ++AK  +L+
Sbjct:  152 RATMAPNPNLTY-LDR-----VIMEIIETERMYVRDLLIIVEDYLAC---IIDHPKQLIHPDQVCALFGNITDIYAFNNELLQDLDMCENDPVA----IARCFVEKREYFD-IYTQYCTNYPNSVAALTECLRDKSTA----QFFRDRQASLKRTLPLGSYLLKPVQRILKYHLLLQEIAK------HFDPEEEGYEDVEEAINTMTGVAWYINDMKRKHEHAVRLQEVQSLLLNWKGPDLASYGELVLEGTFKVHRAKNERTLFLFDRMLLFTKRRGE-HYVYKTDIPCTTLMLIESA-KDSLSFSVTKYKNPKQPYTVQAKTVEEKKLWAHHIKRIIVENH-HAVIPQKAKEAILE 482          
BLAST of DH domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000019753.2 (pleckstrin homology domain-containing family G member 3 [Source:NCBI gene;Acc:101157827])

HSP 1 Score: 123.25 bits (308), Expect = 1.203e-27
Identity = 106/358 (29.61%), Postives = 182/358 (50.84%), Query Frame = 2
Query:  665 KFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKE------VELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLH---RMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSA-NGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            + ++ PN NL   ++R     V+ E++ETE +YV+ L+ + E Y+     I  + K+      V  +F N  ++  F++  L+ L +  +   +    ++ CF+E+  +F+ +Y++YCTNY  SV  L    R ++TA    Q     Q  L   LPL ++LLKPVQRILKYHL+L+E+ +      H        E + +A++ M  VA  IN+ + + E  +R  +++  L +    +    G   L+G  KV   +N R + L +  L+  KR G   +  +  I C  +ML E   K  L F V    + K   T+Q    +EK++W   IK++I+ ++ H  I ++AK  +L+
Sbjct:  171 RATMAPNPNLTY-LDR-----VIMEIIETERMYVRDLLIIVEDYLAC---IIDHPKQLIHPDQVCALFGNITDIYAFNNELLQDLDMCENDPVA----IARCFVEKREYFD-IYTQYCTNYPNSVAALTECLRDKSTA----QFFRDRQASLKRTLPLGSYLLKPVQRILKYHLLLQEIAK------HFDPEEEGYEDVEEAINTMTGVAWYINDMKRKHEHAVRLQEVQSLLLNWKGPDLASYGELVLEGTFKVHRAKNERTLFLFDRMLLFTKRRGE-HYVYKTDIPCTTLMLIESA-KDSLSFSVTKYKNPKQPYTVQAKTVEEKKLWAHHIKRIIVENH-HAVIPQKAKEAILE 501          
BLAST of DH domain-containing protein vs. Ensembl Medaka
Match: ENSORLT00000035892.1 (pleckstrin homology domain-containing family G member 3 [Source:NCBI gene;Acc:101157827])

HSP 1 Score: 123.25 bits (308), Expect = 1.247e-27
Identity = 106/358 (29.61%), Postives = 182/358 (50.84%), Query Frame = 2
Query:  665 KFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKE------VELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLH---RMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSA-NGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLD 1708
            + ++ PN NL   ++R     V+ E++ETE +YV+ L+ + E Y+     I  + K+      V  +F N  ++  F++  L+ L +  +   +    ++ CF+E+  +F+ +Y++YCTNY  SV  L    R ++TA    Q     Q  L   LPL ++LLKPVQRILKYHL+L+E+ +      H        E + +A++ M  VA  IN+ + + E  +R  +++  L +    +    G   L+G  KV   +N R + L +  L+  KR G   +  +  I C  +ML E   K  L F V    + K   T+Q    +EK++W   IK++I+ ++ H  I ++AK  +L+
Sbjct:  190 RATMAPNPNLTY-LDR-----VIMEIIETERMYVRDLLIIVEDYLAC---IIDHPKQLIHPDQVCALFGNITDIYAFNNELLQDLDMCENDPVA----IARCFVEKREYFD-IYTQYCTNYPNSVAALTECLRDKSTA----QFFRDRQASLKRTLPLGSYLLKPVQRILKYHLLLQEIAK------HFDPEEEGYEDVEEAINTMTGVAWYINDMKRKHEHAVRLQEVQSLLLNWKGPDLASYGELVLEGTFKVHRAKNERTLFLFDRMLLFTKRRGE-HYVYKTDIPCTTLMLIESA-KDSLSFSVTKYKNPKQPYTVQAKTVEEKKLWAHHIKRIIVENH-HAVIPQKAKEAILE 520          
BLAST of DH domain-containing protein vs. Planmine SMEST
Match: SMESG000017234.1 (SMESG000017234.1)

HSP 1 Score: 1515.75 bits (3923), Expect = 0.000e+0
Identity = 745/748 (99.60%), Postives = 746/748 (99.73%), Query Frame = 2
Query:  347 MQQRYTTEENGKPDRCKSRSTLSLLWDEICGPNELQKFMETCFNDHKIIDIEIGETVDPPLHSAVVKSHLKDSGTSSLNDEDQCFVFEKDKLLQSRPQATVKHIVNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMXXXXXXXXXXXXXXXYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLDNKHNVLSQCQPISNDVLEKFQVTLNRENDVLDLESSLRKMFDPVSTQSSQSKHKSIKRRNSVGAIKSESKINYRDPSIYQWSGRRHYANEDDVDCRSIMVDVNEENYYSRSGQQLSPYEKSYEQYTSKSRNKIRLTSDDIKEIFQPLKQMQENSDNSSVLLGEMELASLCSDADLDSVASDNATNNQHKRKSTSMDRTFGISLYAKANSFTSSMDTNSSTSREFNNNNIIGSSRAKKFLFSSVRETKTTRSNSDWGALFDGEPKPSLVKRFFKASAKLAKRDKNKSVNCAVEIE 2590
            MQQRYTTEENGKPDRCKSRSTLSLLWDEICGPNELQKFMETCFNDHKIIDIEIGETVDPPLHSAVVKSHLKDSGTSSLNDEDQCFVFEKDKLLQSRPQATVKHIVNKFSLCPN NLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGY+KMSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMEREEQLRRLKLRDELYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLDNKHNVLSQCQPISNDVLEKFQVTLNRENDVLDLESSLRKMFDPVSTQSSQSKHKSIKRRNSVGAIKSESKINYRDPSIYQWSGRRHYANEDDVDCRSIMVDVNEENYYSRSGQQLSPYEKSYEQYTSKSRNKIRLTSDDIKEIFQPLKQMQENSDNSSVLLGEMELASLCSDADLDSVASDNATNNQHKRKSTSMDRTFGISLYAKANSFTSSMDTNSSTSREFNNNNIIGS RAKKFLFSSVRETKTTRSNSDWGALFDGEPKPSLVKRFFKASAKLAKRDKNKSVNCAVEIE
Sbjct:    1 MQQRYTTEENGKPDRCKSRSTLSLLWDEICGPNELQKFMETCFNDHKIIDIEIGETVDPPLHSAVVKSHLKDSGTSSLNDEDQCFVFEKDKLLQSRPQATVKHIVNKFSLCPNANLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGYLKMSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGHQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQMEREEQLRRLKLRDELYDSDIFNCPFLGTPYLDGELKVPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPLEFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKRILLDNKHNVLSQCQPISNDVLEKFQVTLNRENDVLDLESSLRKMFDPVSTQSSQSKHKSIKRRNSVGAIKSESKINYRDPSIYQWSGRRHYANEDDVDCRSIMVDVNEENYYSRSGQQLSPYEKSYEQYTSKSRNKIRLTSDDIKEIFQPLKQMQENSDNSSVLLGEMELASLCSDADLDSVASDNATNNQHKRKSTSMDRTFGISLYAKANSFTSSMDTNSSTSREFNNNNIIGSLRAKKFLFSSVRETKTTRSNSDWGALFDGEPKPSLVKRFFKASAKLAKRDKNKSVNCAVEIE 748          
BLAST of DH domain-containing protein vs. Planmine SMEST
Match: SMESG000013025.1 (SMESG000013025.1)

HSP 1 Score: 260.766 bits (665), Expect = 1.271e-72
Identity = 133/134 (99.25%), Postives = 134/134 (100.00%), Query Frame = 2
Query: 2621 VLSNTFHPQMSTSHIIPNYAAFNRQQAPLHFIPHQTNNHSFFPPSGQIPLYNRMQNTSGHIAGPNQRFSTESIHHQQDQMPIAYNFSKNLTNLQQQAFGGNMITNNNNALKXXXXXXXXXXXXDSGYFGNKTPR 3022
            V+SNTFHPQMSTSHIIPNYAAFNRQQAPLHFIPHQTNNHSFFPPSGQIPLYNRMQNTSGHIAGPNQRFSTESIHHQQDQMPIAYNFSKNLTNLQQQAFGGNMITNNNNALKINEIINNNSNSSDSGYFGNKTPR
Sbjct:  662 VISNTFHPQMSTSHIIPNYAAFNRQQAPLHFIPHQTNNHSFFPPSGQIPLYNRMQNTSGHIAGPNQRFSTESIHHQQDQMPIAYNFSKNLTNLQQQAFGGNMITNNNNALKINEIINNNSNSSDSGYFGNKTPR 795          
BLAST of DH domain-containing protein vs. Planmine SMEST
Match: SMESG000070268.1 (SMESG000070268.1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.691e-9
Identity = 47/170 (27.65%), Postives = 91/170 (53.53%), Query Frame = 2
Query:  683 NGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEE-GYMKMSDSIFSNDKEVELIFSNWRNL--RIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLG-HQLPLSTFLLKPVQRILKYHLILKELIQ 1180
            N  L  D +R ++++  +EL+ETE  Y + L EV    Y  +  S     +E++ IF NW +L  + ++     K++  NS     +Q + +  L    +F  +Y  +C+   Q++  L + + T++   +   QC+  L   ++P+S++ LKP+QRI KY LI++ +++
Sbjct: 1121 NAILTEDEKRRQFYI--RELIETEKAYYEDLQEVHRVFYEPIKKSNLLTLEELKHIFINWTDLIPKSYNFYMALKIRKDNSGNKQPIQCVGDILLSNFPNF-IVYVRFCSLQNQAIALLEKKKQTSAKFKEFCQQCEENLRCKKMPMSSYFLKPMQRITKYKLIVENILK 1287          
BLAST of DH domain-containing protein vs. Planmine SMEST
Match: SMESG000070268.1 (SMESG000070268.1)

HSP 1 Score: 63.1586 bits (152), Expect = 1.744e-9
Identity = 47/170 (27.65%), Postives = 91/170 (53.53%), Query Frame = 2
Query:  683 NGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEE-GYMKMSDSIFSNDKEVELIFSNWRNL--RIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLG-HQLPLSTFLLKPVQRILKYHLILKELIQ 1180
            N  L  D +R ++++  +EL+ETE  Y + L EV    Y  +  S     +E++ IF NW +L  + ++     K++  NS     +Q + +  L    +F  +Y  +C+   Q++  L + + T++   +   QC+  L   ++P+S++ LKP+QRI KY LI++ +++
Sbjct:  454 NAILTEDEKRRQFYI--RELIETEKAYYEDLQEVHRVFYEPIKKSNLLTLEELKHIFINWTDLIPKSYNFYMALKIRKDNSGNKQPIQCVGDILLSNFPNF-IVYVRFCSLQNQAIALLEKKKQTSAKFKEFCQQCEENLRCKKMPMSSYFLKPMQRITKYKLIVENILK 620          
BLAST of DH domain-containing protein vs. Planmine SMEST
Match: SMESG000056121.1 (SMESG000056121.1)

HSP 1 Score: 59.6918 bits (143), Expect = 1.920e-8
Identity = 52/195 (26.67%), Postives = 92/195 (47.18%), Query Frame = 2
Query:  713 EKWHLVMQELVETEHIYVKSLMEVEEGYMKMSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLSECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLGH----QLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALDNMLQVANRINEKQ 1285
            +K   +++E++ETE  +++ L    E + K        D++  L+F + +++      FL KL   N  +      +   FL+ +  FE +Y EYC NY + +  +++ ++ AS+    +     +L         L   L+KP+QR LKY L LK +I+   L  H   N     L+ A      +A +INEK+
Sbjct:  458 QKRSKIIEEILETEKKFIQDLKITLEAFDKNLIPAKIPDQDFHLLFGDLKSVIAVAEEFLSKLSA-NMEDGLDKIAVGSVFLQSVSSFEEVYKEYCVNYDRKLDLINK-KSKASNVTDFVSDGLNRLNDLGVFASTLDMMLVKPLQRFLKYPLFLKTIIENT-LPDHPDIN----DLIAASSEFDVLAQKINEKK 645          
The following BLAST results are available for this feature:
BLAST of DH domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHG13.254e-2830.93pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG13.254e-2830.93pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG31.995e-2631.00pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG11.670e-2429.59pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG22.304e-2034.39pleckstrin homology and RhoGEF domain containing G... [more]
back to top
BLAST of DH domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
uig-11.832e-2530.18UNC-112-Interacting Guanine nucleotide exchange fa... [more]
uig-12.093e-2530.18UNC-112-Interacting Guanine nucleotide exchange fa... [more]
uig-12.345e-2530.21UNC-112-Interacting Guanine nucleotide exchange fa... [more]
uig-12.565e-2530.21UNC-112-Interacting Guanine nucleotide exchange fa... [more]
uig-12.685e-2530.21UNC-112-Interacting Guanine nucleotide exchange fa... [more]
back to top
BLAST of DH domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
GEFmeso1.160e-2930.91gene:FBgn0050115 transcript:FBtr0300421[more]
GEFmeso1.241e-2930.91gene:FBgn0050115 transcript:FBtr0340387[more]
GEFmeso2.174e-2930.61gene:FBgn0050115 transcript:FBtr0310055[more]
sif1.597e-1730.45gene:FBgn0085447 transcript:FBtr0340656[more]
sif1.768e-1731.20gene:FBgn0085447 transcript:FBtr0330123[more]
back to top
BLAST of DH domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
AL935335.12.706e-2430.86pleckstrin homology domain containing, family G (w... [more]
plekhg23.254e-2430.86pleckstrin homology domain containing, family G (w... [more]
mcf2b1.719e-1733.64MCF.2 cell line derived transforming sequence b [S... [more]
CABZ01048666.11.694e-1635.57pep chromosome:GRCz11:23:2361184:2397031:1 gene:EN... [more]
mcf2lb2.773e-1634.02mcf.2 cell line derived transforming sequence-like... [more]
back to top
BLAST of DH domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tmem1171.646e-2629.91transmembrane protein 117 [Source:Xenbase;Acc:XB-G... [more]
tmem1171.877e-2629.91transmembrane protein 117 [Source:Xenbase;Acc:XB-G... [more]
tmem1177.409e-2630.06transmembrane protein 117 [Source:Xenbase;Acc:XB-G... [more]
tmem1177.755e-2630.61transmembrane protein 117 [Source:Xenbase;Acc:XB-G... [more]
tmem1179.965e-2630.61transmembrane protein 117 [Source:Xenbase;Acc:XB-G... [more]
back to top
BLAST of DH domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Plekhg14.991e-2630.09pleckstrin homology domain containing, family G (w... [more]
Plekhg14.991e-2630.09pleckstrin homology domain containing, family G (w... [more]
Plekhg15.848e-2630.09pleckstrin homology domain containing, family G (w... [more]
Plekhg15.991e-2630.09pleckstrin homology domain containing, family G (w... [more]
Plekhg32.569e-2527.75pleckstrin homology domain containing, family G (w... [more]
back to top
BLAST of DH domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9ULL1|PKHG1_HUMAN1.563e-2730.93Pleckstrin homology domain-containing family G mem... [more]
sp|A1L390|PKHG3_HUMAN9.579e-2631.00Pleckstrin homology domain-containing family G mem... [more]
sp|Q4VAC9|PKHG3_MOUSE2.419e-2429.82Pleckstrin homology domain-containing family G mem... [more]
sp|Q6KAU7|PKHG2_MOUSE6.939e-2033.48Pleckstrin homology domain-containing family G mem... [more]
sp|Q9H7P9|PKHG2_HUMAN1.423e-1934.39Pleckstrin homology domain-containing family G mem... [more]
back to top
BLAST of DH domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A158QF701.180e-4633.58DH domain-containing protein OS=Hymenolepis diminu... [more]
A0A068Y0P74.351e-4531.95DH domain containing protein OS=Echinococcus multi... [more]
A0A068WMG89.688e-4533.16DH domain containing protein OS=Echinococcus granu... [more]
A0A158RFB34.226e-4432.89DH domain-containing protein OS=Hydatigena taeniae... [more]
A0A504YC625.951e-4131.16Putative transcript OS=Fasciola gigantica OX=46835... [more]
back to top
BLAST of DH domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHG15.459e-2830.84pleckstrin homology and RhoGEF domain containing G... [more]
ENSAMXT00000043929.15.255e-2231.27pep primary_assembly:Astyanax_mexicanus-2.0:9:1805... [more]
ENSAMXT00000055531.15.617e-2231.27pep primary_assembly:Astyanax_mexicanus-2.0:9:1805... [more]
plekhg21.069e-2029.61pleckstrin homology domain containing, family G (w... [more]
mcf2l23.537e-1629.70MCF.2 cell line derived transforming sequence-like... [more]
back to top
BLAST of DH domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSPMAT00000008020.14.776e-3533.03pep scaffold:Pmarinus_7.0:GL476484:132482:154779:-... [more]
ENSPMAT00000008024.16.691e-3332.84pep scaffold:Pmarinus_7.0:GL476484:132482:154761:-... [more]
ENSPMAT00000003234.11.147e-2729.91pep scaffold:Pmarinus_7.0:GL476714:93500:128189:1 ... [more]
ENSPMAT00000006386.14.149e-1624.15pep scaffold:Pmarinus_7.0:GL476470:857650:882189:-... [more]
ENSPMAT00000006962.11.235e-1432.04pep scaffold:Pmarinus_7.0:GL481838:263808:335470:1... [more]
back to top
BLAST of DH domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
CDC241.239e-929.47Guanine nucleotide exchange factor (GEF) for Cdc42... [more]
back to top
BLAST of DH domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO323284.692e-1727.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437521.705e-1626.36Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO449802.902e-1127.06Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO452013.255e-1131.41Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437534.803e-1127.22Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of DH domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
PLEKHG11.863e-2831.44pleckstrin homology and RhoGEF domain containing G... [more]
PLEKHG11.955e-2831.44pleckstrin homology and RhoGEF domain containing G... [more]
ENSORLT00000046986.11.201e-2729.61pleckstrin homology domain-containing family G mem... [more]
ENSORLT00000019753.21.203e-2729.61pleckstrin homology domain-containing family G mem... [more]
ENSORLT00000035892.11.247e-2729.61pleckstrin homology domain-containing family G mem... [more]
back to top
BLAST of DH domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000017234.10.000e+099.60SMESG000017234.1[more]
SMESG000013025.11.271e-7299.25SMESG000013025.1[more]
SMESG000070268.11.691e-927.65SMESG000070268.1[more]
SMESG000070268.11.744e-927.65SMESG000070268.1[more]
SMESG000056121.11.920e-826.67SMESG000056121.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023509 ID=SMED30023509|Name=DH domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=4461bp
CATGCGTGTATGCATGCGACTGTGTGCATTCTGAGCTGTGTGTATTCTCC
AGACAACACGCATCGTCCTCTGATCGCCGATGACTCATACATGCATACCA
GAAATACACACTGATGTATTGATTTCTCTTTCTCTGCCCCTACATTATTC
ATTCAATCAAGGTGTAGAAAATCTGCATTTTGATTCGTCGAATTTTGTAG
CAGATTTCAAATGGGTAATGCAAATATTTTTCATTTCTTTTTTTTCTGAA
ATTCGTGTCAGTTTTGTTTCGTAAATAATCAAATGAAAAAAATTTTCTTT
CTTAAGTATTTTGCGCCAACGAGCATTTGATTTGTGGATTTATTTAATGC
AACAGAGATATACAACTGAAGAAAATGGCAAACCAGATCGTTGTAAAAGC
AGGAGTACTTTAAGTCTTTTGTGGGACGAAATTTGTGGACCAAATGAGCT
TCAGAAGTTTATGGAAACATGTTTCAATGACCACAAAATCATTGACATTG
AAATCGGTGAAACCGTAGATCCTCCTCTCCATTCCGCTGTAGTCAAGTCT
CACCTCAAAGACAGTGGAACATCGAGTCTCAATGATGAAGACCAGTGTTT
TGTGTTTGAAAAGGACAAGCTCCTTCAATCACGACCACAAGCAACAGTTA
AACATATCGTCAACAAGTTCTCCCTCTGTCCCAACGGTAATTTAAACAGC
GATATTGAACGTGAAAAATGGCACCTCGTAATGCAGGAACTCGTGGAAAC
CGAGCATATCTATGTGAAGAGTCTCATGGAAGTTGAGGAGGGCTACATGA
AAATGTCGGACTCGATATTCTCTAATGACAAAGAGGTGGAGCTGATATTC
TCAAATTGGAGGAATTTACGCATATTTCACTCATTGTTCCTGGAAAAGCT
CAAATTAATAAATTCGTACGAATTCAGCAGCCTCCAACGGTTATCAGAAT
GTTTTCTAGAGGAAATCGGCCATTTTGAAGCTCTCTATTCAGAATATTGC
ACAAATTATACACAGTCCGTGAAACATTTGCATCGCATGGAGACTACTGC
GTCACACGCGTGGCAAAGCCTTATTCAGTGCCAAACACAGCTTGGACACC
AATTACCCCTCAGCACATTCCTACTCAAACCAGTTCAAAGGATATTGAAA
TATCATTTGATTCTCAAAGAGCTTATTCAGTGTTGCAAATTAATGAGCCA
TGTCAGTGCAAACGGTGTCGTGGAATCCCTATTAAAAGCCCTGGATAATA
TGCTGCAAGTTGCCAATCGTATCAATGAGAAACAGATGGAGCGTGAGGAA
CAGTTGCGACGGCTGAAGCTACGTGATGAATTGTATGACTCGGACATATT
CAACTGTCCGTTTCTTGGAACTCCATATCTTGATGGTGAGCTGAAGGTAC
CCGGATGTAGGAATTCCAGGTTGGTCTTGCTCTGTGAAAATGCGTTGGTG
CTAGCCAAACGATTGGGAAATGGAAAGTGGGGCGTTAGACAAGTGATAAA
GTGTAACGAGATGATGCTATTTGAATATATTCCGAAACAGCCGTTAGAAT
TCCACGTAATCGACACGACAGACAACAAAAATAAAGCCACTCTTCAGGTG
ATGAATGCGCAAGAGAAAGAAATGTGGTGTAAGATGATCAAACAACTTAT
CATTAGTTCCTATGAACACGACTCGATTTCAGAACGGGCAAAACGGATCC
TTTTGGATAATAAGCACAACGTCCTTTCTCAGTGCCAACCAATCAGTAAC
GATGTGTTGGAAAAATTTCAAGTTACCTTAAATCGAGAGAACGATGTTCT
GGATTTGGAATCAAGTCTTCGTAAAATGTTTGACCCAGTTTCCACACAAT
CCAGTCAAAGTAAACATAAAAGTATTAAAAGACGGAATAGTGTCGGTGCC
ATAAAGTCCGAATCAAAGATCAATTATCGTGACCCCAGCATATACCAGTG
GTCGGGCAGGAGACATTATGCCAATGAAGACGATGTTGACTGCCGGTCCA
TCATGGTGGATGTGAATGAAGAGAATTATTACAGTCGCAGCGGCCAACAG
TTATCTCCTTATGAAAAATCCTATGAGCAATATACATCTAAATCAAGAAA
TAAAATCAGATTGACATCAGACGATATCAAAGAAATTTTCCAGCCTTTGA
AACAGATGCAGGAAAATTCAGATAATTCCAGCGTTTTGCTGGGTGAGATG
GAGTTAGCTTCTCTTTGCTCCGATGCAGATCTAGATTCGGTGGCCAGTGA
TAATGCAACAAATAATCAACACAAACGCAAGTCAACATCAATGGATCGGA
CGTTTGGAATTTCGCTCTATGCTAAGGCTAATTCCTTTACCAGCAGCATG
GATACCAACTCGTCGACATCCAGGGAATTCAACAATAACAATATTATCGG
CAGCTCGCGGGCCAAAAAGTTTTTGTTCTCCAGTGTTCGTGAGACGAAAA
CTACAAGAAGCAACAGTGACTGGGGAGCGCTTTTTGACGGAGAACCAAAA
CCAAGCCTTGTCAAAAGGTTCTTCAAGGCCTCGGCAAAGTTGGCGAAACG
AGATAAAAATAAATCTGTAAACTGCGCTGTAGAGATTGAAAACAACAACA
ACAACAACAACAATAATCAAGTTTTATCAAATACATTTCATCCACAAATG
TCTACATCGCACATAATCCCCAACTATGCCGCTTTCAATCGCCAACAAGC
ACCACTTCACTTTATTCCTCACCAGACAAACAATCACTCATTTTTCCCTC
CTTCTGGACAAATTCCGCTTTATAACCGCATGCAGAACACCAGTGGTCAT
ATAGCGGGTCCCAATCAACGGTTTTCCACGGAATCTATTCATCATCAACA
AGATCAAATGCCTATTGCATATAATTTCTCCAAAAATCTCACTAATCTCC
AGCAGCAAGCTTTTGGCGGAAATATGATTACCAATAACAATAACGCTTTA
AAAATCAACGAGATCATAAATAATAACAGCAACTCCTCAGATTCTGGCTA
TTTTGGAAATAAAACTCCAAGATGATTATCATTTATTTCCCATCCATTCA
AATATGATATTATCTGTATTAGAATTGCATAAATTTGTCTTATTCTTTTT
ATTCTCGTAGTTTTGTTAAGTTATAGTTGTTAGTTTTATTTATTTAAGTC
CTGCTATTATTGTTTATTACTTTTGTTAATTTATATCTATCTATATATAT
AACAATGGTTTGCAACCGTTTGATTATTTGGTGTGTTTAAATCTCTATCT
CTATCACTCTTGCTCTCTTTTATAATATATACATTTATTTGACATTTCTA
GCCAGAATCAACCAACCAATCGTCGTCATCCTACGAATGAATGAATATAT
AATTAACGAAATGAGAAAAAGTCCGCATCAAATCTTTTATCTTGAAATAC
AAAATGATAAAAATTGAAGCATAATTTGTTTTATCGATTTATATTTTTCA
TAGGAGAGTATGATTTGTATTGTGCATTTATTTTATCCCAATTTTTTATT
CTAATTGCAGCACTATAACTTAGTGCAATGTTATTATTATATATATAAAT
ATATATGTGAATCAGTTCTAGGACATTTCTGATTATATCGAGCAATTTTT
GCTTATTATTAGTGTCAAGACTTTTATGAGTCTTTCTTTGTTTGTGATAT
GTATTTAATGTTAATTGCTTGACAAATGAATATATACATCATATATATAA
TCACACGCGTATATATATATATAGATTGATATTGGGCTTTCTTATATATT
CTCTAGAAAGTTTTAGTGAAATATGCTTTCCGGTGATTATTATTGATTTT
TGCTGGAAATATATATTAATTAATAACTGCAGATTATATTTGCAATTAGG
TGATAAAATATTTGAAATTACCTTTTGGGGGATTTGTGCATTTGATACAA
GTTGTGCTTTTACGAATTATTTTATGTCTAATATTAATATATATAAGATT
AAAAATTCGTTTTTTAAATCATTTAATTATATTTTCAATGGAGAATAAAT
TTGGTTTAATGTTCTCTAATTAATATTGGAGAGTTTATTGTTTATCCACT
ATTTTGTATTTCATATTTACACCAATATCTACGGTTGCTCAATATTTTTT
TGTTGGATTATAGATTCTGTATTATTATTATGTAGTTGTTTGTAATTTAG
TTTTAATGACTTGAGTTTCATAGTTATTATTTTTGTGGTAATGTGTTGAA
TAAACCTATTGAAATTGTGATTTTATTGGTTCTTTTTTCATTTAATGATT
TCAGTTTGTTTTGTTATTTTCTTATATCTGGTGTGTTAACCACACGAGAC
GATGTTTCGGTTTTAATTTCTCAAATATAACACTTAAATGTTTACATTGT
TGTAATAATTTTTAACTGACAATTCAAAATAAAGGGAATTTGAATTGGTT
CGTGTATAGTTTTGTGTTACCTGGGTTCATAAATATTTAAATATAATTAA
TATCTTCGAAT
back to top

protein sequence of SMED30023509-orf-1

>SMED30023509-orf-1 ID=SMED30023509-orf-1|Name=SMED30023509-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=893bp
MQQRYTTEENGKPDRCKSRSTLSLLWDEICGPNELQKFMETCFNDHKIID
IEIGETVDPPLHSAVVKSHLKDSGTSSLNDEDQCFVFEKDKLLQSRPQAT
VKHIVNKFSLCPNGNLNSDIEREKWHLVMQELVETEHIYVKSLMEVEEGY
MKMSDSIFSNDKEVELIFSNWRNLRIFHSLFLEKLKLINSYEFSSLQRLS
ECFLEEIGHFEALYSEYCTNYTQSVKHLHRMETTASHAWQSLIQCQTQLG
HQLPLSTFLLKPVQRILKYHLILKELIQCCKLMSHVSANGVVESLLKALD
NMLQVANRINEKQMEREEQLRRLKLRDELYDSDIFNCPFLGTPYLDGELK
VPGCRNSRLVLLCENALVLAKRLGNGKWGVRQVIKCNEMMLFEYIPKQPL
EFHVIDTTDNKNKATLQVMNAQEKEMWCKMIKQLIISSYEHDSISERAKR
ILLDNKHNVLSQCQPISNDVLEKFQVTLNRENDVLDLESSLRKMFDPVST
QSSQSKHKSIKRRNSVGAIKSESKINYRDPSIYQWSGRRHYANEDDVDCR
SIMVDVNEENYYSRSGQQLSPYEKSYEQYTSKSRNKIRLTSDDIKEIFQP
LKQMQENSDNSSVLLGEMELASLCSDADLDSVASDNATNNQHKRKSTSMD
RTFGISLYAKANSFTSSMDTNSSTSREFNNNNIIGSSRAKKFLFSSVRET
KTTRSNSDWGALFDGEPKPSLVKRFFKASAKLAKRDKNKSVNCAVEIENN
NNNNNNNQVLSNTFHPQMSTSHIIPNYAAFNRQQAPLHFIPHQTNNHSFF
PPSGQIPLYNRMQNTSGHIAGPNQRFSTESIHHQQDQMPIAYNFSKNLTN
LQQQAFGGNMITNNNNALKINEIINNNSNSSDSGYFGNKTPR*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0005085guanyl-nucleotide exchange factor activity
GO:0005089Rho guanyl-nucleotide exchange factor activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000020protonephridia
PLANA:0000034epidermis
Vocabulary: INTERPRO
TermDefinition
IPR035899DBL_dom_sf
IPR000219DH-domain
IPR011993PH-like_dom_sf
Vocabulary: biological process
TermDefinition
GO:0035023regulation of Rho protein signal transduction
GO:0043547positive regulation of GTPase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 292..326
NoneNo IPR availablePANTHERPTHR45924FAMILY NOT NAMEDcoord: 128..700
NoneNo IPR availableSUPERFAMILYSSF50729PH domain-likecoord: 341..435
IPR000219Dbl homology (DH) domainSMARTSM00325RhoGEF_3coord: 128..311
e-value: 3.3E-30
score: 116.3
IPR000219Dbl homology (DH) domainPFAMPF00621RhoGEFcoord: 128..310
e-value: 1.3E-32
score: 113.6
IPR000219Dbl homology (DH) domainPROSITEPS50010DH_2coord: 124..312
score: 27.007
IPR000219Dbl homology (DH) domainCDDcd00160RhoGEFcoord: 126..310
e-value: 2.11863E-33
score: 124.718
IPR035899Dbl homology (DH) domain superfamilyGENE3DG3DSA:1.20.900.10coord: 110..331
e-value: 2.3E-42
score: 146.7
IPR035899Dbl homology (DH) domain superfamilySUPERFAMILYSSF48065DBL homology domain (DH-domain)coord: 123..329
IPR011993PH-like domain superfamilyGENE3DG3DSA:2.30.29.30coord: 338..458
e-value: 4.5E-11
score: 44.6