V-SNARE coiled-coil homology domain-containing protein

Overview
NameV-SNARE coiled-coil homology domain-containing protein
Smed IDSMED30023495
Length (bp)977
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of V-SNARE coiled-coil homology domain-containing protein (SMED30023495) t-SNE clustered cells

Violin plots show distribution of expression levels for V-SNARE coiled-coil homology domain-containing protein (SMED30023495) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of V-SNARE coiled-coil homology domain-containing protein (SMED30023495) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for V-SNARE coiled-coil homology domain-containing protein (SMED30023495) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023495

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 8

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023495SMESG000057424.1 SmedASXL_007285SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30023495SMESG000057424.1 dd_Smed_v4_6394_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023495SMESG000057424.1 dd_Smed_v6_6394_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
headSMED30023495SMESG000057424.1 OX_Smed_1.0.01275ox_Smed_v2PMID:24238224
Kao et al., 2013
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30023495SMESG000057424.1 DN307612ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
nervous systemSMED30023495SMESG000057424.1 DN307612ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30023495SMESG000057424.1 DN307612ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult fluorescence in situ hybridization evidence
neuronSMED30023495SMESG000057424.1 DN307612ncbi_smed_estsPMID:25356635
Cowles et al., 2014
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Human
Match: VAMP2 (vesicle associated membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:12643])

HSP 1 Score: 120.939 bits (302), Expect = 1.590e-33
Identity = 57/67 (85.07%), Postives = 63/67 (94.03%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   28 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Human
Match: VAMP2 (vesicle associated membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:12643])

HSP 1 Score: 120.939 bits (302), Expect = 1.979e-33
Identity = 57/67 (85.07%), Postives = 63/67 (94.03%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   30 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 96          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Human
Match: VAMP2 (vesicle associated membrane protein 2 [Source:HGNC Symbol;Acc:HGNC:12643])

HSP 1 Score: 120.168 bits (300), Expect = 3.128e-33
Identity = 57/67 (85.07%), Postives = 63/67 (94.03%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   28 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Human
Match: AC129492.3 (novel protein)

HSP 1 Score: 120.168 bits (300), Expect = 4.799e-33
Identity = 57/67 (85.07%), Postives = 63/67 (94.03%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   28 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Human
Match: VAMP3 (vesicle associated membrane protein 3 [Source:HGNC Symbol;Acc:HGNC:12644])

HSP 1 Score: 117.857 bits (294), Expect = 1.709e-32
Identity = 56/73 (76.71%), Postives = 64/73 (87.67%), Query Frame = 3
Query:  120 PPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            P ++  SN+RLQQTQ QVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:    5 PTAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK 77          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Celegans
Match: snb-1 (Synaptobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:O02495])

HSP 1 Score: 108.227 bits (269), Expect = 4.483e-29
Identity = 53/67 (79.10%), Postives = 60/67 (89.55%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SNKRLQQTQAQVDE+V IMK NV+KVLERDQKLS+LD+RA+ALQ GASQFE SA  LKRK+W KN+K
Sbjct:   20 SNKRLQQTQAQVDEVVGIMKVNVEKVLERDQKLSQLDDRADALQEGASQFEKSAATLKRKYWWKNIK 86          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Celegans
Match: snb-2 (SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Acc:Q19767])

HSP 1 Score: 90.8929 bits (224), Expect = 1.376e-22
Identity = 37/73 (50.68%), Postives = 59/73 (80.82%), Query Frame = 3
Query:  120 PPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            PP+   + KR+Q  QAQV+E++D+M++NV+KV+ERD +L+ LD+RAE LQ GASQF+ S+  L++K+W +N++
Sbjct:   20 PPTGTYNTKRMQMAQAQVNEVIDVMRNNVNKVMERDVQLNSLDHRAEVLQNGASQFQQSSRTLRQKYWWQNIR 92          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Celegans
Match: snb-2 (SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Acc:Q19767])

HSP 1 Score: 90.8929 bits (224), Expect = 1.376e-22
Identity = 37/73 (50.68%), Postives = 59/73 (80.82%), Query Frame = 3
Query:  120 PPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            PP+   + KR+Q  QAQV+E++D+M++NV+KV+ERD +L+ LD+RAE LQ GASQF+ S+  L++K+W +N++
Sbjct:   20 PPTGTYNTKRMQMAQAQVNEVIDVMRNNVNKVMERDVQLNSLDHRAEVLQNGASQFQQSSRTLRQKYWWQNIR 92          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Celegans
Match: vamp-7 (VAMP (Vesicle Associated Membrane Protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q95XH1])

HSP 1 Score: 58.151 bits (139), Expect = 1.580e-9
Identity = 24/65 (36.92%), Postives = 46/65 (70.77%), Query Frame = 3
Query:  144 KRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            +R+   + QVD++  +M  NV++++ER ++L  ++NR EAL+  A+ F+++A +++R F  KNLK
Sbjct:  170 QRMIDIRRQVDDVRQVMADNVERIMERGERLENMENRTEALRTSATSFKSTARRVQRHFCQKNLK 234          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Celegans
Match: vamp-8 (VAMP (Vesicle Associated Membrane Protein) homolog [Source:UniProtKB/TrEMBL;Acc:Q95QZ1])

HSP 1 Score: 51.2174 bits (121), Expect = 3.852e-8
Identity = 27/73 (36.99%), Postives = 47/73 (64.38%), Query Frame = 3
Query:  123 PSSNVSNK-RLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            PS N   K ++Q  + QVD +  +M  NV+++LER ++L  ++ R+E L A ++ F+ +A K++RKF + N K
Sbjct:   11 PSDNDQQKEKMQNLRNQVDSVKAVMVDNVERILERGERLDNIERRSEQLNATSANFKFTARKVQRKFCMLNAK 83          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0331462)

HSP 1 Score: 117.857 bits (294), Expect = 1.747e-32
Identity = 59/81 (72.84%), Postives = 67/81 (82.72%), Query Frame = 3
Query:  102 GETAGLP--PSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            GE  G P  P    + KRLQQTQAQVDE+VDIM++NV+KVLERD KLSELD+RA+ALQ GASQFE  AGKLKRKFWL+NLK
Sbjct:   24 GEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLK 104          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0306578)

HSP 1 Score: 117.857 bits (294), Expect = 2.268e-32
Identity = 59/81 (72.84%), Postives = 67/81 (82.72%), Query Frame = 3
Query:  102 GETAGLP--PSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            GE  G P  P    + KRLQQTQAQVDE+VDIM++NV+KVLERD KLSELD+RA+ALQ GASQFE  AGKLKRKFWL+NLK
Sbjct:   33 GEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLK 113          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0302310)

HSP 1 Score: 117.857 bits (294), Expect = 2.268e-32
Identity = 59/81 (72.84%), Postives = 67/81 (82.72%), Query Frame = 3
Query:  102 GETAGLP--PSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            GE  G P  P    + KRLQQTQAQVDE+VDIM++NV+KVLERD KLSELD+RA+ALQ GASQFE  AGKLKRKFWL+NLK
Sbjct:   33 GEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLK 113          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0072815)

HSP 1 Score: 118.242 bits (295), Expect = 6.564e-32
Identity = 59/81 (72.84%), Postives = 67/81 (82.72%), Query Frame = 3
Query:  102 GETAGLP--PSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            GE  G P  P    + KRLQQTQAQVDE+VDIM++NV+KVLERD KLSELD+RA+ALQ GASQFE  AGKLKRKFWL+NLK
Sbjct:   24 GEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLK 104          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Fly
Match: nSyb (gene:FBgn0013342 transcript:FBtr0300893)

HSP 1 Score: 118.242 bits (295), Expect = 6.564e-32
Identity = 59/81 (72.84%), Postives = 67/81 (82.72%), Query Frame = 3
Query:  102 GETAGLP--PSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            GE  G P  P    + KRLQQTQAQVDE+VDIM++NV+KVLERD KLSELD+RA+ALQ GASQFE  AGKLKRKFWL+NLK
Sbjct:   24 GEIVGGPHNPQQIAAQKRLQQTQAQVDEVVDIMRTNVEKVLERDSKLSELDDRADALQQGASQFEQQAGKLKRKFWLQNLK 104          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Zebrafish
Match: vamp2 (vesicle-associated membrane protein 2 [Source:ZFIN;Acc:ZDB-GENE-030131-8225])

HSP 1 Score: 122.865 bits (307), Expect = 2.036e-34
Identity = 61/87 (70.11%), Postives = 68/87 (78.16%), Query Frame = 3
Query:   78 SVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            S P G P  E     P +  SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLK K+W KN K
Sbjct:    2 SAPAGAPAPEGGNQAPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKNKYWWKNAK 88          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Zebrafish
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 120.553 bits (301), Expect = 1.033e-33
Identity = 62/87 (71.26%), Postives = 69/87 (79.31%), Query Frame = 3
Query:   78 SVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            S PG    G        S+ SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRKFW KN+K
Sbjct:    2 SAPGADASG--------SSGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVK 80          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Zebrafish
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 120.553 bits (301), Expect = 1.033e-33
Identity = 62/87 (71.26%), Postives = 69/87 (79.31%), Query Frame = 3
Query:   78 SVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            S PG    G        S+ SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRKFW KN+K
Sbjct:    2 SAPGADASG--------SSGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVK 80          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Zebrafish
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 120.553 bits (301), Expect = 1.304e-33
Identity = 62/87 (71.26%), Postives = 69/87 (79.31%), Query Frame = 3
Query:   78 SVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            S PG    G        S+ SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRKFW KN+K
Sbjct:    2 SAPGADASG--------SSGSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKFWWKNVK 80          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Zebrafish
Match: vamp1 (vesicle-associated membrane protein 1 [Source:ZFIN;Acc:ZDB-GENE-040426-2725])

HSP 1 Score: 117.472 bits (293), Expect = 2.848e-32
Identity = 59/84 (70.24%), Postives = 68/84 (80.95%), Query Frame = 3
Query:   87 GGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            GG P        P +  SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE+SA KLK K+W KN+K
Sbjct:   20 GGAPA------QPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNMK 97          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Xenopus
Match: idh1 (isocitrate dehydrogenase 1 (NADP+) [Source:Xenbase;Acc:XB-GENE-1004994])

HSP 1 Score: 115.931 bits (289), Expect = 1.021e-31
Identity = 57/84 (67.86%), Postives = 69/84 (82.14%), Query Frame = 3
Query:   87 GGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            G  P    +G PP+S  SN+RL QTQAQV+E+VDIM+ NVDKVL+RDQKL+ELD+RA+ALQAGASQFE SA KLKRK+W +N K
Sbjct:    7 GPTPTMSGSGGPPAS--SNRRLLQTQAQVNEVVDIMRVNVDKVLDRDQKLAELDDRADALQAGASQFETSAAKLKRKYWWRNCK 88          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Xenopus
Match: vamp3 (vesicle associated membrane protein 3 [Source:NCBI gene;Acc:549726])

HSP 1 Score: 114.39 bits (285), Expect = 3.804e-31
Identity = 58/87 (66.67%), Postives = 66/87 (75.86%), Query Frame = 3
Query:   78 SVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            S PG    G+           N+RLQQTQAQV+E+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:    2 SAPGPSATGDPG---------NRRLQQTQAQVNEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK 79          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Xenopus
Match: vamp3 (vesicle associated membrane protein 3 [Source:NCBI gene;Acc:549726])

HSP 1 Score: 114.39 bits (285), Expect = 5.937e-31
Identity = 58/87 (66.67%), Postives = 66/87 (75.86%), Query Frame = 3
Query:   78 SVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            S PG    G+           N+RLQQTQAQV+E+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:    2 SAPGPSATGDPG---------NRRLQQTQAQVNEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK 79          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Xenopus
Match: vamp4 (vesicle associated membrane protein 4 [Source:NCBI gene;Acc:549651])

HSP 1 Score: 60.8474 bits (146), Expect = 7.277e-11
Identity = 24/72 (33.33%), Postives = 47/72 (65.28%), Query Frame = 3
Query:  123 PSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            P     N +++  Q QVDE++D+M+ N+ +V+ER ++L EL +++E+L   A+ F + + +L+R+ W +  K
Sbjct:   44 PKFGPRNDKIRHVQNQVDEVIDVMQENITRVIERGERLDELQDKSESLSDNATAFSSRSRQLRRQMWWRECK 115          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Xenopus
Match: vamp4 (vesicle associated membrane protein 4 [Source:NCBI gene;Acc:549651])

HSP 1 Score: 60.4622 bits (145), Expect = 9.090e-11
Identity = 24/72 (33.33%), Postives = 47/72 (65.28%), Query Frame = 3
Query:  123 PSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            P     N +++  Q QVDE++D+M+ N+ +V+ER ++L EL +++E+L   A+ F + + +L+R+ W +  K
Sbjct:   44 PKFGPRNDKIRHVQNQVDEVIDVMQENITRVIERGERLDELQDKSESLSDNATAFSSRSRQLRRQMWWRECK 115          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Mouse
Match: Vamp2 (vesicle-associated membrane protein 2 [Source:MGI Symbol;Acc:MGI:1313277])

HSP 1 Score: 120.939 bits (302), Expect = 1.092e-33
Identity = 57/67 (85.07%), Postives = 63/67 (94.03%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   28 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Mouse
Match: Vamp3 (vesicle-associated membrane protein 3 [Source:MGI Symbol;Acc:MGI:1321389])

HSP 1 Score: 118.242 bits (295), Expect = 8.470e-33
Identity = 58/80 (72.50%), Postives = 67/80 (83.75%), Query Frame = 3
Query:  108 TAGLPPSSNV---SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            + G+P  S+    SN+RLQQTQ QVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:    2 STGVPSGSSAATGSNRRLQQTQNQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK 81          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Mouse
Match: Vamp2 (vesicle-associated membrane protein 2 [Source:MGI Symbol;Acc:MGI:1313277])

HSP 1 Score: 119.013 bits (297), Expect = 3.051e-32
Identity = 57/68 (83.82%), Postives = 63/68 (92.65%), Query Frame = 3
Query:  135 VSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
             SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   27 TSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Mouse
Match: Vamp1 (vesicle-associated membrane protein 1 [Source:MGI Symbol;Acc:MGI:1313276])

HSP 1 Score: 116.701 bits (291), Expect = 5.759e-32
Identity = 55/68 (80.88%), Postives = 63/68 (92.65%), Query Frame = 3
Query:  135 VSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
             SN+RLQQTQAQV+E+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE+SA KLKRK+W KN K
Sbjct:   29 TSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK 96          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Mouse
Match: Vamp1 (vesicle-associated membrane protein 1 [Source:MGI Symbol;Acc:MGI:1313276])

HSP 1 Score: 116.316 bits (290), Expect = 7.061e-32
Identity = 55/68 (80.88%), Postives = 63/68 (92.65%), Query Frame = 3
Query:  135 VSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
             SN+RLQQTQAQV+E+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE+SA KLKRK+W KN K
Sbjct:   29 TSNRRLQQTQAQVEEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKRKYWWKNCK 96          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. UniProt/SwissProt
Match: sp|P63045|VAMP2_RAT (Vesicle-associated membrane protein 2 OS=Rattus norvegicus OX=10116 GN=Vamp2 PE=1 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 7.638e-33
Identity = 57/67 (85.07%), Postives = 63/67 (94.03%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   28 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. UniProt/SwissProt
Match: sp|P63044|VAMP2_MOUSE (Vesicle-associated membrane protein 2 OS=Mus musculus OX=10090 GN=Vamp2 PE=1 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 7.638e-33
Identity = 57/67 (85.07%), Postives = 63/67 (94.03%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   28 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. UniProt/SwissProt
Match: sp|Q9N0Y0|VAMP2_MACMU (Vesicle-associated membrane protein 2 OS=Macaca mulatta OX=9544 GN=VAMP2 PE=3 SV=3)

HSP 1 Score: 120.939 bits (302), Expect = 7.638e-33
Identity = 57/67 (85.07%), Postives = 63/67 (94.03%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   28 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. UniProt/SwissProt
Match: sp|P63027|VAMP2_HUMAN (Vesicle-associated membrane protein 2 OS=Homo sapiens OX=9606 GN=VAMP2 PE=1 SV=3)

HSP 1 Score: 120.939 bits (302), Expect = 7.638e-33
Identity = 57/67 (85.07%), Postives = 63/67 (94.03%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   28 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. UniProt/SwissProt
Match: sp|P63026|VAMP2_BOVIN (Vesicle-associated membrane protein 2 OS=Bos taurus OX=9913 GN=VAMP2 PE=1 SV=2)

HSP 1 Score: 120.939 bits (302), Expect = 8.141e-33
Identity = 57/67 (85.07%), Postives = 63/67 (94.03%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KNLK
Sbjct:   28 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNLK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. TrEMBL
Match: A0A1D5PLR5 (V-SNARE coiled-coil homology domain-containing protein OS=Gallus gallus OX=9031 GN=VAMP2 PE=4 SV=2)

HSP 1 Score: 132.494 bits (332), Expect = 8.246e-35
Identity = 66/84 (78.57%), Postives = 72/84 (85.71%), Query Frame = 3
Query:   90 GPPVGETAGLPPSSNVS-NKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            GP     AG PP++NVS NKRLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELDNRA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:    9 GPTSTGAAGPPPATNVSSNKRLQQTQAQVDEVVDIMRMNVDKVLERDQKLSELDNRADALQAGASQFETSAAKLKRKYWWKNCK 92          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. TrEMBL
Match: A0A2I0LW24 (Vesicle-associated membrane protein 2 OS=Columba livia OX=8932 GN=A306_00012569 PE=4 SV=1)

HSP 1 Score: 131.339 bits (329), Expect = 2.789e-34
Identity = 65/84 (77.38%), Postives = 72/84 (85.71%), Query Frame = 3
Query:   90 GPPVGETAGLPPSSNVS-NKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            GP     AG PP+++VS NKRLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELDNRA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:    9 GPTSAGAAGPPPATSVSSNKRLQQTQAQVDEVVDIMRMNVDKVLERDQKLSELDNRADALQAGASQFETSAAKLKRKYWWKNCK 92          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. TrEMBL
Match: H0Z4K7 (V-SNARE coiled-coil homology domain-containing protein OS=Taeniopygia guttata OX=59729 PE=4 SV=1)

HSP 1 Score: 129.798 bits (325), Expect = 5.599e-34
Identity = 64/77 (83.12%), Postives = 70/77 (90.91%), Query Frame = 3
Query:  111 AGLPPSSNVS-NKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            AG PP++NVS NKRLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELDNRA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:    4 AGPPPATNVSSNKRLQQTQAQVDEVVDIMRMNVDKVLERDQKLSELDNRADALQAGASQFETSAAKLKRKYWWKNCK 80          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. TrEMBL
Match: M7B855 (Vesicle-associated membrane protein 1 (Fragment) OS=Chelonia mydas OX=8469 GN=UY3_09534 PE=4 SV=1)

HSP 1 Score: 129.413 bits (324), Expect = 1.235e-33
Identity = 64/85 (75.29%), Postives = 71/85 (83.53%), Query Frame = 3
Query:   87 GGPPVGETAGLPPSSNV-SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            GG  +    G PP +NV SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELDNRA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:   11 GGSTISGAGGPPPPTNVTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDNRADALQAGASQFETSAAKLKRKYWWKNCK 95          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. TrEMBL
Match: U3I931 (V-SNARE coiled-coil homology domain-containing protein OS=Anas platyrhynchos platyrhynchos OX=8840 PE=4 SV=2)

HSP 1 Score: 128.642 bits (322), Expect = 3.780e-33
Identity = 65/97 (67.01%), Postives = 77/97 (79.38%), Query Frame = 3
Query:   60 MAANSQSVPGGPPVGETA----GLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            ++  S+S P  P  G T+    G PP++  S+KRLQQTQA+VDE+VDIM+ NVDKVLERDQKLSELDNRA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:    9 LSFGSRSAPAPPTQGATSAGAVGPPPANVASSKRLQQTQARVDEVVDIMRMNVDKVLERDQKLSELDNRADALQAGASQFETSAAKLKRKYWWKNCK 105          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Cavefish
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:103030083])

HSP 1 Score: 123.25 bits (308), Expect = 1.635e-34
Identity = 63/94 (67.02%), Postives = 73/94 (77.66%), Query Frame = 3
Query:   66 ANSQSVPGGPPVGETAGLPPSSN---VSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            A+  + PG P   E  G PP +     SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE+SA KLK K+W KN K
Sbjct:    5 ASDAASPGAPGAPEGEGGPPGAAPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCK 98          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Cavefish
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:103030083])

HSP 1 Score: 123.25 bits (308), Expect = 1.635e-34
Identity = 63/94 (67.02%), Postives = 73/94 (77.66%), Query Frame = 3
Query:   66 ANSQSVPGGPPVGETAGLPPSSN---VSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            A+  + PG P   E  G PP +     SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE+SA KLK K+W KN K
Sbjct:    5 ASDAASPGAPGAPEGEGGPPGAAPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCK 98          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Cavefish
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:103030083])

HSP 1 Score: 123.25 bits (308), Expect = 1.635e-34
Identity = 63/94 (67.02%), Postives = 73/94 (77.66%), Query Frame = 3
Query:   66 ANSQSVPGGPPVGETAGLPPSSN---VSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            A+  + PG P   E  G PP +     SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE+SA KLK K+W KN K
Sbjct:    5 ASDAASPGAPGAPEGEGGPPGAAPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCK 98          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Cavefish
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:103030083])

HSP 1 Score: 123.25 bits (308), Expect = 1.635e-34
Identity = 63/94 (67.02%), Postives = 73/94 (77.66%), Query Frame = 3
Query:   66 ANSQSVPGGPPVGETAGLPPSSN---VSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            A+  + PG P   E  G PP +     SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE+SA KLK K+W KN K
Sbjct:    5 ASDAASPGAPGAPEGEGGPPGAAPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCK 98          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Cavefish
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:103030083])

HSP 1 Score: 122.479 bits (306), Expect = 2.378e-34
Identity = 63/94 (67.02%), Postives = 73/94 (77.66%), Query Frame = 3
Query:   66 ANSQSVPGGPPVGETAGLPPSSN---VSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            A+  + PG P   E  G PP +     SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE+SA KLK K+W KN K
Sbjct:    5 ASDAASPGAPGAPEGEGGPPGAAPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCK 98          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008529.1 (pep scaffold:Pmarinus_7.0:GL484641:5659:9131:-1 gene:ENSPMAG00000007726.1 transcript:ENSPMAT00000008529.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 116.701 bits (291), Expect = 8.909e-33
Identity = 55/67 (82.09%), Postives = 62/67 (92.54%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQ GASQFE+SA KLKRK+W KN K
Sbjct:   29 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQQGASQFESSAAKLKRKYWWKNCK 95          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Nematostella
Match: EDO42383 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1M0])

HSP 1 Score: 111.694 bits (278), Expect = 3.422e-31
Identity = 55/67 (82.09%), Postives = 60/67 (89.55%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            S+KRLQQTQAQVDE+VDIMK NVDKVLERD KLSELDNRA+ALQAGASQFE SA +LKRK W +N K
Sbjct:    2 SSKRLQQTQAQVDEVVDIMKVNVDKVLERDAKLSELDNRADALQAGASQFETSASRLKRKMWWQNCK 68          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Nematostella
Match: EDO44396 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RVJ7])

HSP 1 Score: 57.7658 bits (138), Expect = 1.958e-10
Identity = 28/81 (34.57%), Postives = 49/81 (60.49%), Query Frame = 3
Query:   96 PVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            P G T   P  +N+S     + + ++  +VD+M++N+ KVL+R  KL +L +++E L   A QF + + KL+RK W +N +
Sbjct:   40 PAGSTNKPPSDNNIS-----RVKNEIKGVVDVMQTNIAKVLDRGAKLDDLQDKSENLDMNAFQFRSGSRKLQRKLWWQNCR 115          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Nematostella
Match: EDO43738 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RXX6])

HSP 1 Score: 52.373 bits (124), Expect = 4.624e-8
Identity = 22/63 (34.92%), Postives = 41/63 (65.08%), Query Frame = 3
Query:  150 LQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            + + Q +VDE+ D+M  N++KVLER +++  L ++AE L   A  F+  + +L++K W +N +
Sbjct:  129 INKVQREVDEVKDVMTKNIEKVLERGERIDILMDKAETLDNSAQTFQRHSSRLRKKMWWQNTR 191          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Medaka
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 118.627 bits (296), Expect = 3.882e-33
Identity = 57/67 (85.07%), Postives = 62/67 (92.54%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SNKRLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:   14 SNKRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK 80          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Medaka
Match: vamp3 (vesicle-associated membrane protein 3 (cellubrevin) [Source:ZFIN;Acc:ZDB-GENE-040625-45])

HSP 1 Score: 118.627 bits (296), Expect = 3.882e-33
Identity = 57/67 (85.07%), Postives = 62/67 (92.54%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SNKRLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLKRK+W KN K
Sbjct:   14 SNKRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNCK 80          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Medaka
Match: vamp2 (vesicle associated membrane protein 2 [Source:NCBI gene;Acc:101159693])

HSP 1 Score: 117.087 bits (292), Expect = 2.442e-32
Identity = 60/87 (68.97%), Postives = 67/87 (77.01%), Query Frame = 3
Query:   78 SVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            S P   P  E     P +  SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE SA KLK K+W KN K
Sbjct:    7 SDPDTAPAPEGGSQAPPNLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKNKYWWKNAK 93          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Medaka
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:101164413])

HSP 1 Score: 118.242 bits (295), Expect = 2.773e-32
Identity = 55/67 (82.09%), Postives = 62/67 (92.54%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE+SA KLK K+W KN K
Sbjct:   31 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCK 97          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Medaka
Match: vamp1 (vesicle-associated membrane protein 2-like [Source:NCBI gene;Acc:101164413])

HSP 1 Score: 115.546 bits (288), Expect = 1.092e-31
Identity = 55/67 (82.09%), Postives = 62/67 (92.54%), Query Frame = 3
Query:  138 SNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            SN+RLQQTQAQVDE+VDIM+ NVDKVLERDQKLSELD+RA+ALQAGASQFE+SA KLK K+W KN K
Sbjct:   31 SNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFESSAAKLKNKYWWKNCK 97          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Planmine SMEST
Match: SMESG000057424.1 (SMESG000057424.1)

HSP 1 Score: 189.504 bits (480), Expect = 1.627e-60
Identity = 93/93 (100.00%), Postives = 93/93 (100.00%), Query Frame = 3
Query:   60 MAANSQSVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            MAANSQSVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK
Sbjct:    1 MAANSQSVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 93          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Planmine SMEST
Match: SMESG000066166.1 (SMESG000066166.1)

HSP 1 Score: 133.65 bits (335), Expect = 2.886e-38
Identity = 63/77 (81.82%), Postives = 68/77 (88.31%), Query Frame = 3
Query:  108 TAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            T G+PP S   NKRLQQTQAQVDE+VDIM+ NVDKVLERD KLSELDNRA+ALQAGASQFEASAGKLKRKFW +N K
Sbjct:   18 TPGIPPPSGPVNKRLQQTQAQVDEVVDIMRVNVDKVLERDHKLSELDNRADALQAGASQFEASAGKLKRKFWWRNCK 94          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Planmine SMEST
Match: SMESG000033532.1 (SMESG000033532.1)

HSP 1 Score: 121.709 bits (304), Expect = 4.003e-34
Identity = 60/89 (67.42%), Postives = 73/89 (82.02%), Query Frame = 3
Query:   72 SQSVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            +  +PG PP+   A +P S N   KRLQQTQA+++E+VDIM+ NVDKVLERDQKLSELDNRA+ALQAGASQFE SAG+LK KFW +N+K
Sbjct:    9 TNGIPGSPPI---ATVPSSGN---KRLQQTQAKINEVVDIMRMNVDKVLERDQKLSELDNRADALQAGASQFEESAGRLKSKFWWRNVK 91          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Planmine SMEST
Match: SMESG000010550.1 (SMESG000010550.1)

HSP 1 Score: 86.2705 bits (212), Expect = 2.142e-20
Identity = 38/64 (59.38%), Postives = 50/64 (78.12%), Query Frame = 3
Query:  147 RLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            RLQQTQ QVD++ ++M+ N+ K LERD KLSE+D RA  LQ GA QF+ +A K++RKFW KN+K
Sbjct:   34 RLQQTQMQVDQVTNVMRENMAKALERDAKLSEMDERAAELQMGAQQFQTTAHKVQRKFWWKNIK 97          
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Planmine SMEST
Match: SMESG000033382.1 (SMESG000033382.1)

HSP 1 Score: 61.6178 bits (148), Expect = 8.085e-12
Identity = 28/66 (42.42%), Postives = 43/66 (65.15%), Query Frame = 3
Query:  141 NKRLQQTQAQVDEIVDIMKSNVDKVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLK 338
            N++L + Q  VD++   M+ N+ KV+ER+  LS + N+AE L   +S +   A K+KRKFW KN+K
Sbjct:   16 NEKLTKLQTDVDDLTKSMQENIQKVMERNDNLSAISNQAEVLHQSSSLYVTQAAKVKRKFWWKNMK 81          
The following BLAST results are available for this feature:
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
VAMP21.590e-3385.07vesicle associated membrane protein 2 [Source:HGNC... [more]
VAMP21.979e-3385.07vesicle associated membrane protein 2 [Source:HGNC... [more]
VAMP23.128e-3385.07vesicle associated membrane protein 2 [Source:HGNC... [more]
AC129492.34.799e-3385.07novel protein[more]
VAMP31.709e-3276.71vesicle associated membrane protein 3 [Source:HGNC... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snb-14.483e-2979.10Synaptobrevin-1 [Source:UniProtKB/Swiss-Prot;Acc:... [more]
snb-21.376e-2250.68SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Ac... [more]
snb-21.376e-2250.68SyNaptoBrevin related [Source:UniProtKB/TrEMBL;Ac... [more]
vamp-71.580e-936.92VAMP (Vesicle Associated Membrane Protein) homolog... [more]
vamp-83.852e-836.99VAMP (Vesicle Associated Membrane Protein) homolog... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nSyb1.747e-3272.84gene:FBgn0013342 transcript:FBtr0331462[more]
nSyb2.268e-3272.84gene:FBgn0013342 transcript:FBtr0306578[more]
nSyb2.268e-3272.84gene:FBgn0013342 transcript:FBtr0302310[more]
nSyb6.564e-3272.84gene:FBgn0013342 transcript:FBtr0072815[more]
nSyb6.564e-3272.84gene:FBgn0013342 transcript:FBtr0300893[more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp22.036e-3470.11vesicle-associated membrane protein 2 [Source:ZFIN... [more]
vamp31.033e-3371.26vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp31.033e-3371.26vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp31.304e-3371.26vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp12.848e-3270.24vesicle-associated membrane protein 1 [Source:ZFIN... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
idh11.021e-3167.86isocitrate dehydrogenase 1 (NADP+) [Source:Xenbase... [more]
vamp33.804e-3166.67vesicle associated membrane protein 3 [Source:NCBI... [more]
vamp35.937e-3166.67vesicle associated membrane protein 3 [Source:NCBI... [more]
vamp47.277e-1133.33vesicle associated membrane protein 4 [Source:NCBI... [more]
vamp49.090e-1133.33vesicle associated membrane protein 4 [Source:NCBI... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Vamp21.092e-3385.07vesicle-associated membrane protein 2 [Source:MGI ... [more]
Vamp38.470e-3372.50vesicle-associated membrane protein 3 [Source:MGI ... [more]
Vamp23.051e-3283.82vesicle-associated membrane protein 2 [Source:MGI ... [more]
Vamp15.759e-3280.88vesicle-associated membrane protein 1 [Source:MGI ... [more]
Vamp17.061e-3280.88vesicle-associated membrane protein 1 [Source:MGI ... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P63045|VAMP2_RAT7.638e-3385.07Vesicle-associated membrane protein 2 OS=Rattus no... [more]
sp|P63044|VAMP2_MOUSE7.638e-3385.07Vesicle-associated membrane protein 2 OS=Mus muscu... [more]
sp|Q9N0Y0|VAMP2_MACMU7.638e-3385.07Vesicle-associated membrane protein 2 OS=Macaca mu... [more]
sp|P63027|VAMP2_HUMAN7.638e-3385.07Vesicle-associated membrane protein 2 OS=Homo sapi... [more]
sp|P63026|VAMP2_BOVIN8.141e-3385.07Vesicle-associated membrane protein 2 OS=Bos tauru... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1D5PLR58.246e-3578.57V-SNARE coiled-coil homology domain-containing pro... [more]
A0A2I0LW242.789e-3477.38Vesicle-associated membrane protein 2 OS=Columba l... [more]
H0Z4K75.599e-3483.12V-SNARE coiled-coil homology domain-containing pro... [more]
M7B8551.235e-3375.29Vesicle-associated membrane protein 1 (Fragment) O... [more]
U3I9313.780e-3367.01V-SNARE coiled-coil homology domain-containing pro... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp11.635e-3467.02vesicle-associated membrane protein 2-like [Source... [more]
vamp11.635e-3467.02vesicle-associated membrane protein 2-like [Source... [more]
vamp11.635e-3467.02vesicle-associated membrane protein 2-like [Source... [more]
vamp11.635e-3467.02vesicle-associated membrane protein 2-like [Source... [more]
vamp12.378e-3467.02vesicle-associated membrane protein 2-like [Source... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000008529.18.909e-3382.09pep scaffold:Pmarinus_7.0:GL484641:5659:9131:-1 ge... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO423833.422e-3182.09Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO443961.958e-1034.57Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO437384.624e-834.92Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
vamp33.882e-3385.07vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp33.882e-3385.07vesicle-associated membrane protein 3 (cellubrevin... [more]
vamp22.442e-3268.97vesicle associated membrane protein 2 [Source:NCBI... [more]
vamp12.773e-3282.09vesicle-associated membrane protein 2-like [Source... [more]
vamp11.092e-3182.09vesicle-associated membrane protein 2-like [Source... [more]
back to top
BLAST of V-SNARE coiled-coil homology domain-containing protein vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000057424.11.627e-60100.00SMESG000057424.1[more]
SMESG000066166.12.886e-3881.82SMESG000066166.1[more]
SMESG000033532.14.003e-3467.42SMESG000033532.1[more]
SMESG000010550.12.142e-2059.38SMESG000010550.1[more]
SMESG000033382.18.085e-1242.42SMESG000033382.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023495 ID=SMED30023495|Name=V-SNARE coiled-coil homology domain-containing protein|organism=Schmidtea mediterranea sexual|type=transcript|length=977bp
TTTATAAATAATTTAATTCAATATTTATTTGAGATTTCATTTTTTTATAA
CCTAGAAATATGGCTGCTAATTCTCAATCTGTTCCTGGTGGACCTCCAGT
TGGTGAAACAGCAGGCCTGCCTCCAAGTAGTAATGTATCAAATAAAAGAC
TTCAACAGACTCAAGCTCAGGTCGATGAAATTGTCGACATTATGAAATCT
AATGTTGACAAAGTGTTAGAAAGAGATCAAAAGCTTTCAGAACTTGATAA
CAGAGCAGAAGCGTTGCAAGCTGGTGCATCGCAATTTGAGGCGAGTGCCG
GTAAATTGAAGCGAAAATTTTGGTTAAAAAATCTGAAGATGATGATAATC
ATGGGATCCATCGTGGCGATCATTGTCATAATAATCATAGTTTCTGTTGT
CAATAAATGATACCTGGAGACCAAGAAAATATTAATGACTTTTTTTAGTA
GAATAGAGTAGAATGAAAGTTTGCATTTCCAATCGAACTAGATAATAAAA
AACAATAATTGTGTATTATTCTGGTTATTTATATATAATCAGGTAGCAGA
TTATGTTTATTAATTGTACGTTTTGTGTATGGCATGGGATTTATTGTTTA
CCGAATTGTACTGATATATTCAATAGTTTCTTTATTTGCTTACATATATG
TCAAATCTATGTAGAATTTCAGGGCTCCTTTTCTTGTTGTAAGTATGCAG
TCTGTATTCAATCCGTTATGTAATAGCATGGCCACTATGATTTATATTAT
TATTAGATATATTCTTCCATATTTAGATATTTCGGAATTCATGGAAGTAC
TCGTTGAAATGCTATTTCAATCTCTTTTTTTTCATTATGAATTGTATGGA
TTATTTTATTGTACTCTTTATTCAATGATAACATCCCTTATTTTCCCAGA
AATTTTCCTATCATGGGGAGGGTGACAAAAATAGAACGAAAATTTTTATC
GTCATATGAGAGATTAGTATTCTTTAT
back to top

protein sequence of SMED30023495-orf-1

>SMED30023495-orf-1 ID=SMED30023495-orf-1|Name=SMED30023495-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=117bp
MAANSQSVPGGPPVGETAGLPPSSNVSNKRLQQTQAQVDEIVDIMKSNVD
KVLERDQKLSELDNRAEALQAGASQFEASAGKLKRKFWLKNLKMMIIMGS
IVAIIVIIIIVSVVNK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000025nervous system
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR016444Synaptobrevin/VAMP
IPR042855V_SNARE_CC
IPR001388Synaptobrevin
Vocabulary: biological process
TermDefinition
GO:0016192vesicle-mediated transport
GO:0017156calcium ion regulated exocytosis
GO:0017157regulation of exocytosis
GO:0032869cellular response to insulin stimulus
GO:0043001Golgi to plasma membrane protein transport
GO:0060291long-term synaptic potentiation
GO:0060627regulation of vesicle-mediated transport
GO:0061025membrane fusion
GO:0090316positive regulation of intracellular protein transport
GO:0098967exocytic insertion of neurotransmitter receptor to postsynaptic membrane
GO:1902259regulation of delayed rectifier potassium channel activity
GO:0006461protein complex assembly
GO:0006906vesicle fusion
GO:0009749response to glucose
GO:0015031protein transport
GO:0016079synaptic vesicle exocytosis
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0030054cell junction
GO:0030136clathrin-coated vesicle
GO:0030141secretory granule
GO:0030285integral component of synaptic vesicle membrane
GO:0030672synaptic vesicle membrane
GO:0031201SNARE complex
GO:0031410cytoplasmic vesicle
GO:0031982vesicle
GO:0042589zymogen granule membrane
GO:0043005neuron projection
GO:0043195terminal bouton
GO:0043229intracellular organelle
GO:0043231intracellular membrane-bounded organelle
GO:0044306neuron projection terminus
GO:0045202synapse
GO:0048471perinuclear region of cytoplasm
GO:0070032synaptobrevin 2-SNAP-25-syntaxin-1a-complexin I complex
GO:0070033synaptobrevin 2-SNAP-25-syntaxin-1a-complexin II complex
GO:0070044synaptobrevin 2-SNAP-25-syntaxin-1a complex
GO:0000322storage vacuole
GO:0005802trans-Golgi network
GO:0005886plasma membrane
GO:0008021synaptic vesicle
GO:0016020membrane
Vocabulary: molecular function
TermDefinition
GO:0017022myosin binding
GO:0017075syntaxin-1 binding
GO:0019905syntaxin binding
GO:0032403protein complex binding
GO:0042802identical protein binding
GO:0044325ion channel binding
GO:0048306calcium-dependent protein binding
GO:0000149SNARE binding
GO:0005484SNAP receptor activity
GO:0005515protein binding
GO:0005516calmodulin binding
GO:0005543phospholipid binding
GO:0008022protein C-terminus binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR001388SynaptobrevinPRINTSPR00219SYNAPTOBREVNcoord: 35..54
score: 64.32
coord: 55..74
score: 61.08
coord: 91..110
score: 49.46
IPR001388SynaptobrevinPFAMPF00957Synaptobrevincoord: 27..114
e-value: 2.9E-33
score: 113.5
IPR001388SynaptobrevinPROSITEPS00417SYNAPTOBREVINcoord: 48..67
IPR016444Synaptobrevin/Vesicle-associated membrane proteinPIRSFPIRSF005409VAMP-5_synaptobrevincoord: 4..116
e-value: 2.4E-39
score: 131.4
IPR016444Synaptobrevin/Vesicle-associated membrane proteinPANTHERPTHR45701FAMILY NOT NAMEDcoord: 8..112
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 1..114
e-value: 8.4E-46
score: 156.6
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 1..33
NoneNo IPR availablePANTHERPTHR45701:SF5VESICLE-ASSOCIATED MEMBRANE PROTEIN 2coord: 8..112
NoneNo IPR availableCDDcd15870R-SNARE_VAMP2coord: 29..91
e-value: 1.3053E-37
score: 119.412
NoneNo IPR availableSUPERFAMILYSSF58038SNARE fusion complexcoord: 25..91
NoneNo IPR availableTMHMMTMhelixcoord: 92..114
IPR042855v-SNARE, coiled-coil homology domainPROSITEPS50892V_SNAREcoord: 30..90
score: 17.649