CDGSH iron sulfur domain-containing protein 3, mitochondrial

Overview
NameCDGSH iron sulfur domain-containing protein 3, mitochondrial
Smed IDSMED30023489
Length (bp)666
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of CDGSH iron sulfur domain-containing protein 3, mitochondrial (SMED30023489) t-SNE clustered cells

Violin plots show distribution of expression levels for CDGSH iron sulfur domain-containing protein 3, mitochondrial (SMED30023489) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of CDGSH iron sulfur domain-containing protein 3, mitochondrial (SMED30023489) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for CDGSH iron sulfur domain-containing protein 3, mitochondrial (SMED30023489) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023489

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
epidermisSMED30023489h1SMcG0020948 dd_Smed_v4_935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023489h1SMcG0020948 dd_Smed_v4_935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023489h1SMcG0020948 dd_Smed_v4_935_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023489h1SMcG0020948 Contig46716uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023489h1SMcG0020948 Contig46716newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Category 3 cellSMED30023489h1SMcG0020948 dd_Smed_v6_935_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Human
Match: CISD3 (CDGSH iron sulfur domain 3 [Source:HGNC Symbol;Acc:HGNC:27578])

HSP 1 Score: 68.1662 bits (165), Expect = 3.655e-14
Identity = 31/72 (43.06%), Postives = 46/72 (63.89%), Query Frame = 1
Query:  247 DLKPGDKKYWCACGLSKNQPWCDGSH--KDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTH 456
            +L  G    WC CG SK QP+CDGSH  + TG++PL+F        ++ ET++ ++C CK ++  P+CDGTH
Sbjct:   50 ELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKF--------KAQETRMVALCTCKATQRPPYCDGTH 113          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Human
Match: CISD3 (CDGSH iron sulfur domain 3 [Source:HGNC Symbol;Acc:HGNC:27578])

HSP 1 Score: 68.1662 bits (165), Expect = 3.655e-14
Identity = 31/72 (43.06%), Postives = 46/72 (63.89%), Query Frame = 1
Query:  247 DLKPGDKKYWCACGLSKNQPWCDGSH--KDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTH 456
            +L  G    WC CG SK QP+CDGSH  + TG++PL+F        ++ ET++ ++C CK ++  P+CDGTH
Sbjct:   50 ELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKF--------KAQETRMVALCTCKATQRPPYCDGTH 113          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Celegans
Match: cisd-3.2 (CDGSH Iron Sulfur Domain protein homolog [Source:UniProtKB/TrEMBL;Acc:Q9BKQ9])

HSP 1 Score: 68.5514 bits (166), Expect = 1.894e-14
Identity = 36/85 (42.35%), Postives = 50/85 (58.82%), Query Frame = 1
Query:  220 AEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGIT---PLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKL 465
            A  KS +VK L+ G   +WC+CGLS  QP+CDG+HK  G+T   P+ F V         +T +Y MC CK +  +P CDG H+ +
Sbjct:   43 AGTKSNRVK-LEAGKTYHWCSCGLSITQPFCDGTHKTPGLTNVRPVSFQV--------EKTGIYPMCDCKQTGTRPICDGKHADV 118          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Celegans
Match: cisd-3.1 (CDGSH Iron Sulfur Domain protein homolog [Source:UniProtKB/TrEMBL;Acc:Q9U3A1])

HSP 1 Score: 56.225 bits (134), Expect = 7.277e-10
Identity = 31/68 (45.59%), Postives = 39/68 (57.35%), Query Frame = 1
Query:  262 DKKY-WCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYS--MCQCKHSKNKPFCDGTH 456
            DK Y WC+CG S +QP CDGSH    I  L     +LKP      K  +  +C CK + N+PFCDG+H
Sbjct:   84 DKVYAWCSCGYSGSQPLCDGSHNSIRIPDL-----KLKPVRFIPDKDMTVWLCNCKQTNNRPFCDGSH 146          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Fly
Match: CG3420 (gene:FBgn0033100 transcript:FBtr0332940)

HSP 1 Score: 56.9954 bits (136), Expect = 2.853e-10
Identity = 35/82 (42.68%), Postives = 46/82 (56.10%), Query Frame = 1
Query:  262 DKKY-WCACGLSKNQPWCDGSHKDTGI----TPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVK 492
            DK Y WC CG SK+QP CDG HK+  +     P+ F V   K G+      Y +C CK + ++PFCDGTH   +P +   VK
Sbjct:   65 DKTYSWCLCGKSKSQPLCDGMHKNEFLKIKQRPIRFKVE--KSGD------YWLCNCKQTTHRPFCDGTHK--QPHIQSAVK 136          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Fly
Match: CG3420 (gene:FBgn0033100 transcript:FBtr0086135)

HSP 1 Score: 56.9954 bits (136), Expect = 2.853e-10
Identity = 35/82 (42.68%), Postives = 46/82 (56.10%), Query Frame = 1
Query:  262 DKKY-WCACGLSKNQPWCDGSHKDTGI----TPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVK 492
            DK Y WC CG SK+QP CDG HK+  +     P+ F V   K G+      Y +C CK + ++PFCDGTH   +P +   VK
Sbjct:   65 DKTYSWCLCGKSKSQPLCDGMHKNEFLKIKQRPIRFKVE--KSGD------YWLCNCKQTTHRPFCDGTHK--QPHIQSAVK 136          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Xenopus
Match: lyrm2 (LYR motif containing 2 [Source:Xenbase;Acc:XB-GENE-5753220])

HSP 1 Score: 64.6994 bits (156), Expect = 3.330e-13
Identity = 34/72 (47.22%), Postives = 43/72 (59.72%), Query Frame = 1
Query:  247 DLKPGDKKYWCACGLSKNQPWCDGSHKDT--GITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTH 456
            +LK G    WC+CG SK QP+CDGSH+    G++PL F      P E  E     +C CK +KN P+CDGTH
Sbjct:   34 ELKAGKMYPWCSCGHSKKQPFCDGSHRQAAPGLSPLRFT-----PTEDQEV---WLCGCKQTKNPPYCDGTH 97          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Xenopus
Match: lyrm2 (LYR motif containing 2 [Source:Xenbase;Acc:XB-GENE-5753220])

HSP 1 Score: 64.3142 bits (155), Expect = 4.794e-13
Identity = 34/72 (47.22%), Postives = 43/72 (59.72%), Query Frame = 1
Query:  247 DLKPGDKKYWCACGLSKNQPWCDGSHKDT--GITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTH 456
            +LK G    WC+CG SK QP+CDGSH+    G++PL F      P E  E     +C CK +KN P+CDGTH
Sbjct:   34 ELKAGKMYPWCSCGHSKKQPFCDGSHRQAAPGLSPLRFT-----PTEDQEV---WLCGCKQTKNPPYCDGTH 97          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Mouse
Match: Cisd3 (CDGSH iron sulfur domain 3 [Source:MGI Symbol;Acc:MGI:101788])

HSP 1 Score: 70.0922 bits (170), Expect = 5.635e-15
Identity = 34/84 (40.48%), Postives = 52/84 (61.90%), Query Frame = 1
Query:  211 PACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSH--KDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTH 456
            P  A+   +++ +L  G    WC CG SKNQP+CDGSH  + TG++PL+F        ++ ET+  ++C CK ++  P+CDGTH
Sbjct:   46 PVVAQKTPIRL-ELVAGKTYRWCVCGRSKNQPFCDGSHFFQRTGLSPLKF--------KAQETRTVALCTCKATQRPPYCDGTH 120          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Mouse
Match: Cisd3 (CDGSH iron sulfur domain 3 [Source:MGI Symbol;Acc:MGI:101788])

HSP 1 Score: 69.3218 bits (168), Expect = 6.273e-15
Identity = 34/84 (40.48%), Postives = 52/84 (61.90%), Query Frame = 1
Query:  211 PACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSH--KDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTH 456
            P  A+   +++ +L  G    WC CG SKNQP+CDGSH  + TG++PL+F        ++ ET+  ++C CK ++  P+CDGTH
Sbjct:   27 PVVAQKTPIRL-ELVAGKTYRWCVCGRSKNQPFCDGSHFFQRTGLSPLKF--------KAQETRTVALCTCKATQRPPYCDGTH 101          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Mouse
Match: Cisd3 (CDGSH iron sulfur domain 3 [Source:MGI Symbol;Acc:MGI:101788])

HSP 1 Score: 69.707 bits (169), Expect = 9.073e-15
Identity = 34/84 (40.48%), Postives = 52/84 (61.90%), Query Frame = 1
Query:  211 PACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSH--KDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTH 456
            P  A+   +++ +L  G    WC CG SKNQP+CDGSH  + TG++PL+F        ++ ET+  ++C CK ++  P+CDGTH
Sbjct:   49 PVVAQKTPIRL-ELVAGKTYRWCVCGRSKNQPFCDGSHFFQRTGLSPLKF--------KAQETRTVALCTCKATQRPPYCDGTH 123          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. UniProt/SwissProt
Match: sp|B1AR13|CISD3_MOUSE (CDGSH iron-sulfur domain-containing protein 3, mitochondrial OS=Mus musculus OX=10090 GN=Cisd3 PE=1 SV=1)

HSP 1 Score: 69.707 bits (169), Expect = 6.347e-14
Identity = 34/84 (40.48%), Postives = 52/84 (61.90%), Query Frame = 1
Query:  211 PACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSH--KDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTH 456
            P  A+   +++ +L  G    WC CG SKNQP+CDGSH  + TG++PL+F        ++ ET+  ++C CK ++  P+CDGTH
Sbjct:   49 PVVAQKTPIRL-ELVAGKTYRWCVCGRSKNQPFCDGSHFFQRTGLSPLKF--------KAQETRTVALCTCKATQRPPYCDGTH 123          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. UniProt/SwissProt
Match: sp|P0C7P0|CISD3_HUMAN (CDGSH iron-sulfur domain-containing protein 3, mitochondrial OS=Homo sapiens OX=9606 GN=CISD3 PE=1 SV=1)

HSP 1 Score: 68.1662 bits (165), Expect = 1.755e-13
Identity = 31/72 (43.06%), Postives = 46/72 (63.89%), Query Frame = 1
Query:  247 DLKPGDKKYWCACGLSKNQPWCDGSH--KDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTH 456
            +L  G    WC CG SK QP+CDGSH  + TG++PL+F        ++ ET++ ++C CK ++  P+CDGTH
Sbjct:   50 ELVAGKTYRWCVCGRSKKQPFCDGSHFFQRTGLSPLKF--------KAQETRMVALCTCKATQRPPYCDGTH 113          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. TrEMBL
Match: T1FQH4 (Uncharacterized protein OS=Helobdella robusta OX=6412 GN=20211071 PE=4 SV=1)

HSP 1 Score: 121.324 bits (303), Expect = 1.711e-31
Identity = 61/121 (50.41%), Postives = 75/121 (61.98%), Query Frame = 1
Query:  205 LTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF 567
            L PA A +    V DLK G+ K WC CGLSK QPWCDGSHK TG + + + VPE       + K Y +CQCKH+K  P+CDGTH+ L   V +R K C  KG   K   KLCT CG++P+F
Sbjct:   10 LVPAVAMYAPATVTDLKKGEVKRWCVCGLSKKQPWCDGSHKGTGFSSMPWTVPE-------DQKEYYICQCKHTKTPPYCDGTHTNLPEGVKERQKNCPNKGTDHKPECKLCTKCGWLPEF 123          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. TrEMBL
Match: K1Q475 (CDGSH iron sulfur domain-containing protein 3, mitochondrial OS=Crassostrea gigas OX=29159 GN=CGI_10013188 PE=4 SV=1)

HSP 1 Score: 116.701 bits (291), Expect = 1.035e-29
Identity = 58/119 (48.74%), Postives = 72/119 (60.50%), Query Frame = 1
Query:  211 PACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF 567
            PA A +    V DLK GD + WCACGLSK QPWCDGSHK TGI PL + V       S E +++ +C CK++K+ PFCD TH+ L   V  R + C  +        KLCT CG+VPDF
Sbjct:   17 PAVAMYGPCTVSDLKQGDVRLWCACGLSKKQPWCDGSHKGTGIKPLRWKV-------SKEQRLFQICACKYTKDPPFCDATHTNLPCQVLQRQEACPWQQDSHNSNSKLCTGCGWVPDF 128          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. TrEMBL
Match: A0A2G8KB38 (Putative CDGSH iron-sulfur domain-containing protein 3, mitochondrial OS=Stichopus japonicus OX=307972 GN=BSL78_17897 PE=4 SV=1)

HSP 1 Score: 113.235 bits (282), Expect = 4.649e-28
Identity = 61/122 (50.00%), Postives = 76/122 (62.30%), Query Frame = 1
Query:  205 LTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEK-GHVEKGAKKLCTNCGFVPDF 567
            + PA   +    ++DL+PG +  WCACGLSK  PWCDGSHK TG   +++ VPE KP       VY +C C H+K+ PFCDGTH  L  IV  R K C +K GH +    KLCT CG+VPDF
Sbjct:   34 MWPAVHRYGPSNIRDLQPGKRMKWCACGLSKKMPWCDGSHKKTGFRSVKWHVPE-KP-----QTVYQICNCCHTKSPPFCDGTHVNLPLIVEARQKNCPKKDGHPD--CNKLCTGCGWVPDF 147          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. TrEMBL
Match: A0A433PDC2 (Uncharacterized protein OS=Endogone sp. FLAS-F59071 OX=2340872 GN=BC937DRAFT_92353 PE=4 SV=1)

HSP 1 Score: 109.768 bits (273), Expect = 4.412e-27
Identity = 57/121 (47.11%), Postives = 73/121 (60.33%), Query Frame = 1
Query:  205 LTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF 567
            L P  A F    +KDL+PG  K WC CGLSK QPWCDGSH  TGI PL++IVP        +T +YS+C CK++K  P+CD TH+ + P+   R +E     H     +KLCT CG+VP  
Sbjct:    7 LKPCVALFGPCSIKDLQPGQTKLWCRCGLSKKQPWCDGSHTGTGIQPLKWIVPGTLIDGKDQT-LYSICGCKYTKTPPYCDATHNDI-PVAYFRAQESCTVDH--SSVEKLCTKCGWVPQL 123          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. TrEMBL
Match: A0A3M6UXZ2 (Uncharacterized protein OS=Pocillopora damicornis OX=46731 GN=pdam_00000101 PE=4 SV=1)

HSP 1 Score: 109.383 bits (272), Expect = 1.051e-26
Identity = 57/121 (47.11%), Postives = 72/121 (59.50%), Query Frame = 1
Query:  205 LTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF 567
            L PA A +    V+DL+PG    WC CGLSK QPWCDG+HK TG   L++ VP+         ++YS+C CKH+KN P CD TH  L  +V  R K C +  H E    KLCT CG+VP +
Sbjct:   23 LCPAVAMYGPCNVEDLEPGKTMKWCTCGLSKKQPWCDGAHKKTGFKSLKWKVPD------HPQRIYSICNCKHTKNPPLCDATHVNLPAVVETRQKNC-DSAHDED--MKLCTGCGWVPKW 134          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Sea Lamprey
Match: ENSPMAT00000002612.1 (pep scaffold:Pmarinus_7.0:GL477054:222771:227854:1 gene:ENSPMAG00000002381.1 transcript:ENSPMAT00000002612.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 61.6178 bits (148), Expect = 1.515e-12
Identity = 34/87 (39.08%), Postives = 47/87 (54.02%), Query Frame = 1
Query:  214 ACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSH------KDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTH 456
            A   FK  +++  KPG +  WCACG S NQP+CDGSH       ++   P+ F VP        E+ +  +C CK +   PFCDG+H
Sbjct:   62 APVAFKPFRLEG-KPGKRHLWCACGFSGNQPFCDGSHFKARWKGESKKWPVLFKVP--------ESGIAWLCLCKQTGKPPFCDGSH 139          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Nematostella
Match: EDO44292 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RWC5])

HSP 1 Score: 103.605 bits (257), Expect = 2.422e-28
Identity = 56/121 (46.28%), Postives = 75/121 (61.98%), Query Frame = 1
Query:  205 LTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF 567
            L P  A +    V++L+PG  + WC CGLSK QPWCDG+HK TG   L++ VP+ KP      K+YS+C CKH+ + PFCDG+H +L      R K C ++ H E    KLCT CG+VP +
Sbjct:   21 LCPTVAMYGPYSVENLEPGKIRKWCTCGLSKKQPWCDGTHKGTGFKSLKWKVPD-KP-----QKLYSICGCKHTSSPPFCDGSHIELPSEFNARQKAC-QQMHSE--GIKLCTGCGWVPQW 132          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Nematostella
Match: EDO48925 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHW5])

HSP 1 Score: 65.4698 bits (158), Expect = 2.528e-14
Identity = 32/67 (47.76%), Postives = 41/67 (61.19%), Query Frame = 1
Query:  262 DKKY-WCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHS 459
            DK+Y WC CGLSK QP+CDGSHK +GI P  F   +  P       +  +C CK +   P+CDGTH+
Sbjct:    9 DKRYSWCRCGLSKKQPFCDGSHKGSGIAPERFRPTQDNP-------LAFLCGCKQTGTPPYCDGTHA 68          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Medaka
Match: ENSORLT00000040418.1 (CDGSH iron sulfur domain 3 [Source:NCBI gene;Acc:101168272])

HSP 1 Score: 62.7734 bits (151), Expect = 1.877e-12
Identity = 35/82 (42.68%), Postives = 46/82 (56.10%), Query Frame = 1
Query:  250 LKPGDKKYWCACGLSKNQPWCDGSH--KDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRV 489
            L  G +  WCACG SK QP+CDG+H  +   I+PL F           +  V+ +C CK +KN P+CDG+H  LK I  D V
Sbjct:   53 LSAGKRYAWCACGYSKKQPFCDGAHLKQAPSISPLRF-------SPDKDGTVF-LCACKQTKNAPYCDGSH--LKVIYRDAV 124          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Planmine SMEST
Match: SMESG000016828.1 (SMESG000016828.1)

HSP 1 Score: 283.108 bits (723), Expect = 2.231e-98
Identity = 137/137 (100.00%), Postives = 137/137 (100.00%), Query Frame = 1
Query:  157 SNNQNPIQLFRKMSTILTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF 567
            SNNQNPIQLFRKMSTILTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF
Sbjct:   15 SNNQNPIQLFRKMSTILTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF 151          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Planmine SMEST
Match: SMESG000016828.1 (SMESG000016828.1)

HSP 1 Score: 256.144 bits (653), Expect = 3.737e-88
Identity = 125/125 (100.00%), Postives = 125/125 (100.00%), Query Frame = 1
Query:  193 MSTILTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF 567
            MSTILTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF
Sbjct:    1 MSTILTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGITPLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVKECSEKGHVEKGAKKLCTNCGFVPDF 125          
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Planmine SMEST
Match: SMESG000012454.1 (SMESG000012454.1)

HSP 1 Score: 61.6178 bits (148), Expect = 8.355e-12
Identity = 33/76 (43.42%), Postives = 44/76 (57.89%), Query Frame = 1
Query:  247 DLKPGDKKYWCACGLSKNQPWCDGSHKDT-GITPLEFIVPE----LKPGESAETKVYSMCQCKHSKNKPFCDGTHS 459
            D KPG   +WC+CG SK QP+CDG+H+   G T   F+  +    +K      T V+  C CK + N PFCDG+HS
Sbjct:   77 DCKPGKVYWWCSCGTSKTQPFCDGNHRIILGSTSSYFVTQQKFNPIKTVFEKPTTVW-FCNCKQTNNPPFCDGSHS 151          
The following BLAST results are available for this feature:
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CISD33.655e-1443.06CDGSH iron sulfur domain 3 [Source:HGNC Symbol;Acc... [more]
CISD33.655e-1443.06CDGSH iron sulfur domain 3 [Source:HGNC Symbol;Acc... [more]
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 2
Match NameE-valueIdentityDescription
cisd-3.21.894e-1442.35CDGSH Iron Sulfur Domain protein homolog [Source:... [more]
cisd-3.17.277e-1045.59CDGSH Iron Sulfur Domain protein homolog [Source:... [more]
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG34202.853e-1042.68gene:FBgn0033100 transcript:FBtr0332940[more]
CG34202.853e-1042.68gene:FBgn0033100 transcript:FBtr0086135[more]
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 2
Match NameE-valueIdentityDescription
lyrm23.330e-1347.22LYR motif containing 2 [Source:Xenbase;Acc:XB-GENE... [more]
lyrm24.794e-1347.22LYR motif containing 2 [Source:Xenbase;Acc:XB-GENE... [more]
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 3
Match NameE-valueIdentityDescription
Cisd35.635e-1540.48CDGSH iron sulfur domain 3 [Source:MGI Symbol;Acc:... [more]
Cisd36.273e-1540.48CDGSH iron sulfur domain 3 [Source:MGI Symbol;Acc:... [more]
Cisd39.073e-1540.48CDGSH iron sulfur domain 3 [Source:MGI Symbol;Acc:... [more]
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 2
Match NameE-valueIdentityDescription
sp|B1AR13|CISD3_MOUSE6.347e-1440.48CDGSH iron-sulfur domain-containing protein 3, mit... [more]
sp|P0C7P0|CISD3_HUMAN1.755e-1343.06CDGSH iron-sulfur domain-containing protein 3, mit... [more]
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
T1FQH41.711e-3150.41Uncharacterized protein OS=Helobdella robusta OX=6... [more]
K1Q4751.035e-2948.74CDGSH iron sulfur domain-containing protein 3, mit... [more]
A0A2G8KB384.649e-2850.00Putative CDGSH iron-sulfur domain-containing prote... [more]
A0A433PDC24.412e-2747.11Uncharacterized protein OS=Endogone sp. FLAS-F5907... [more]
A0A3M6UXZ21.051e-2647.11Uncharacterized protein OS=Pocillopora damicornis ... [more]
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000002612.11.515e-1239.08pep scaffold:Pmarinus_7.0:GL477054:222771:227854:1... [more]
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 2
Match NameE-valueIdentityDescription
EDO442922.422e-2846.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO489252.528e-1447.76Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSORLT00000040418.11.877e-1242.68CDGSH iron sulfur domain 3 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of CDGSH iron sulfur domain-containing protein 3, mitochondrial vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000016828.12.231e-98100.00SMESG000016828.1[more]
SMESG000016828.13.737e-88100.00SMESG000016828.1[more]
SMESG000012454.18.355e-1243.42SMESG000012454.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023489 ID=SMED30023489|Name=CDGSH iron sulfur domain-containing protein 3, mitochondrial|organism=Schmidtea mediterranea sexual|type=transcript|length=666bp
TAATTCAATTTTGTTGTGGTATAAAAAAATCAAGGCACCTCTAATCATGT
TTCATTGGTTACTACGCCATTAGTAATATGTCTGAAAACGTTAATAGAGC
GTTCTATAAAAGTTCATAAATTATAGAAACTAATTTTTTTAACAGTTATT
GAAAACTCAAACAATCAAAATCCAATCCAGTTATTTCGAAAAATGAGCAC
AATTCTTACTCCAGCCTGTGCAGAATTTAAATCTGTGAAAGTTAAAGATT
TAAAACCCGGAGACAAAAAATATTGGTGCGCTTGTGGTCTTAGTAAAAAT
CAACCGTGGTGTGATGGATCTCATAAAGATACTGGAATCACTCCATTGGA
ATTTATTGTTCCTGAATTGAAACCCGGTGAGAGTGCTGAAACAAAAGTTT
ATTCAATGTGCCAATGTAAACATAGCAAGAATAAGCCATTTTGCGATGGA
ACTCATAGCAAATTGAAACCGATTGTTACTGATAGAGTTAAAGAATGCAG
TGAAAAGGGTCACGTTGAGAAAGGGGCAAAGAAATTGTGTACGAACTGCG
GATTTGTGCCGGACTTTTAATGTGTTTTTAAACATCAGGCCGATTTTAAT
AAATTAGTATATTTGTTATTGTTGTTAAGAAATTTGAAATAAATTAGTTC
TTGCTTAAAAAAAGAA
back to top

protein sequence of SMED30023489-orf-1

>SMED30023489-orf-1 ID=SMED30023489-orf-1|Name=SMED30023489-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=126bp
MSTILTPACAEFKSVKVKDLKPGDKKYWCACGLSKNQPWCDGSHKDTGIT
PLEFIVPELKPGESAETKVYSMCQCKHSKNKPFCDGTHSKLKPIVTDRVK
ECSEKGHVEKGAKKLCTNCGFVPDF*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000026gut
PLANA:0000035Category 3 cell
PLANA:0002032epidermal cell
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR042216FeS-contain_mitoNEET_C
IPR018967FeS-contain_CDGSH-typ
Vocabulary: cellular component
TermDefinition
GO:0043231intracellular membrane-bounded organelle
Vocabulary: molecular function
TermDefinition
GO:00515372 iron, 2 sulfur cluster binding
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR018967Iron sulphur-containing domain, CDGSH-typeSMARTSM00704znf_cdgshcoord: 60..94
e-value: 0.0015
score: 25.4
coord: 13..50
e-value: 6.5E-9
score: 45.6
IPR018967Iron sulphur-containing domain, CDGSH-typePFAMPF09360zf-CDGSHcoord: 64..88
e-value: 3.9E-11
score: 43.0
coord: 23..45
e-value: 1.0E-9
score: 38.4
IPR042216Iron sulphur domain-containing, mitoNEET, C-terminalGENE3DG3DSA:3.40.5.90coord: 63..105
e-value: 1.2E-11
score: 45.9
IPR042216Iron sulphur domain-containing, mitoNEET, C-terminalGENE3DG3DSA:3.40.5.90coord: 8..56
e-value: 5.1E-13
score: 50.3
NoneNo IPR availablePANTHERPTHR46491FAMILY NOT NAMEDcoord: 6..105
NoneNo IPR availablePANTHERPTHR46491:SF5coord: 6..105