Neuronal acetylcholine receptor subunit alpha-7

Overview
NameNeuronal acetylcholine receptor subunit alpha-7
Smed IDSMED30023488
Length (bp)2642
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Neuronal acetylcholine receptor subunit alpha-7 (SMED30023488) t-SNE clustered cells

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-7 (SMED30023488) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Neuronal acetylcholine receptor subunit alpha-7 (SMED30023488) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Neuronal acetylcholine receptor subunit alpha-7 (SMED30023488) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023488

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 9

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
head regionSMED30023488SMESG000080892.1 SMESG000080891.1 SmedASXL_015609SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
nervous systemSMED30023488SMESG000080892.1 SMESG000080891.1 dd_Smed_v4_11839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023488SMESG000080892.1 SMESG000080891.1 dd_Smed_v4_11839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023488SMESG000080892.1 SMESG000080891.1 dd_Smed_v4_11839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023488SMESG000080892.1 SMESG000080891.1 dd_Smed_v4_11839_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023488SMESG000080892.1 SMESG000080891.1 Contig49465uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023488SMESG000080892.1 SMESG000080891.1 Contig49465newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
head regionSMED30023488SMESG000080891.1 dd_Smed_v6_37345_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
head regionSMED30023488SMESG000080892.1 SMESG000080891.1 dd_Smed_v6_11839_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 253.832 bits (647), Expect = 2.923e-74
Identity = 139/338 (41.12%), Postives = 209/338 (61.83%), Query Frame = 2
Query:  542 RDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCV---LLMD 1546
            + G     E RL   L   Y +     RPV ++   V+VR+ L + Q++D+DEKNQ++T NVW + +W D  L+W+P ++ N++ +RVPS  IW PDIVLYN AD            + STG + W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++    +  V L+ Y ES EW IV   G  N K Y CC E YPD+T+   +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +   +P W++  +  +GCV   LLM+
Sbjct:   29 QGGSHTETEDRLFKHLFRGYNRWA---RPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTMPHWVRGAL--LGCVPRWLLMN 359          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Human
Match: CHRNA2 (cholinergic receptor nicotinic alpha 2 subunit [Source:HGNC Symbol;Acc:HGNC:1956])

HSP 1 Score: 252.677 bits (644), Expect = 1.309e-73
Identity = 139/338 (41.12%), Postives = 209/338 (61.83%), Query Frame = 2
Query:  542 RDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCV---LLMD 1546
            + G     E RL   L   Y +     RPV ++   V+VR+ L + Q++D+DEKNQ++T NVW + +W D  L+W+P ++ N++ +RVPS  IW PDIVLYN AD            + STG + W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++    +  V L+ Y ES EW IV   G  N K Y CC E YPD+T+   +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +   +P W++  +  +GCV   LLM+
Sbjct:   51 QGGSHTETEDRLFKHLFRGYNRWA---RPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWSDYKLRWNPTDFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFSTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QMEQTVDLKDYWESGEWAIVNATGTYNSKKYDCCAEIYPDVTYAFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHTMPHWVRGAL--LGCVPRWLLMN 381          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 251.906 bits (642), Expect = 1.368e-73
Identity = 131/318 (41.19%), Postives = 201/318 (63.21%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            +++L  +L+ +Y     + RPV +  Q + V +SL L+QI+D+DEKNQVLT N+W +  W D  L+W+ + Y  V  VR P  +IW PDI+LYN ADER     +  ++V+S+G   ++PP IFKSSC ID+  FPFD Q C LKFGSW+Y G  LD+Q      E  +  Y  + EW +V  PG R+E+FY CC EPYPD+TF + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   MI++ +S   +VIV+  +    +  ++P W + +++
Sbjct:   26 QRKLYKELVKNYNP---LERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQM----QEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILL 336          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Human
Match: AC243734.1 (cholinergic receptor nicotinic alpha 7 subunit [Source:NCBI gene;Acc:1139])

HSP 1 Score: 251.906 bits (642), Expect = 1.368e-73
Identity = 131/318 (41.19%), Postives = 201/318 (63.21%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            +++L  +L+ +Y     + RPV +  Q + V +SL L+QI+D+DEKNQVLT N+W +  W D  L+W+ + Y  V  VR P  +IW PDI+LYN ADER     +  ++V+S+G   ++PP IFKSSC ID+  FPFD Q C LKFGSW+Y G  LD+Q      E  +  Y  + EW +V  PG R+E+FY CC EPYPD+TF + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   MI++ +S   +VIV+  +    +  ++P W + +++
Sbjct:   26 QRKLYKELVKNYNP---LERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQM----QEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILL 336          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Human
Match: CHRNA7 (cholinergic receptor nicotinic alpha 7 subunit [Source:HGNC Symbol;Acc:HGNC:1960])

HSP 1 Score: 251.136 bits (640), Expect = 5.261e-73
Identity = 131/318 (41.19%), Postives = 201/318 (63.21%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            +++L  +L+ +Y     + RPV +  Q + V +SL L+QI+D+DEKNQVLT N+W +  W D  L+W+ + Y  V  VR P  +IW PDI+LYN ADER     +  ++V+S+G   ++PP IFKSSC ID+  FPFD Q C LKFGSW+Y G  LD+Q      E  +  Y  + EW +V  PG R+E+FY CC EPYPD+TF + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   MI++ +S   +VIV+  +    +  ++P W + +++
Sbjct:   55 QRKLYKELVKNYNP---LERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQM----QEADISGYIPNGEWDLVGIPGKRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILL 365          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Celegans
Match: acr-16 (Acetylcholine receptor subunit alpha-type acr-16 [Source:UniProtKB/Swiss-Prot;Acc:P48180])

HSP 1 Score: 244.588 bits (623), Expect = 2.188e-71
Identity = 127/318 (39.94%), Postives = 194/318 (61.01%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            E+RL  DL+ +Y     + RPV +  + V V   + L QI+D+DEKNQV+ +N W  Y W D  L WD A Y N++ VR P+ +IW PD++LYN  D          ++V STG + W+PP IFK SCKIDI  FPFD+Q C  KFGSWTYDG +LD+Q      ++S   Y  + EW +      RNEKFY CC EPYPD+ F+L +RR   ++ + L++PC+L + +TL+ F LPP++  K+ L + + ++    L ++++ +P  S +VP +G ++   MI++T ST  +V V+NL++R      +  W + +++
Sbjct:   23 ERRLYEDLMRNYNN---LERPVANHSEPVTVHLKVALQQIIDVDEKNQVVYVNAWLDYTWNDYNLVWDKAEYGNITDVRFPAGKIWKPDVLLYNSVDTNFDSTYQTNMIVYSTGLVHWVPPGIFKISCKIDIQWFPFDEQKCFFKFGSWTYDGYKLDLQPATGGFDIS--EYISNGEWALPLTTVERNEKFYDCCPEPYPDVHFYLHMRRRTLYYGFNLIMPCILTTLMTLLGFTLPPDAGEKITLQITVLLSICFFLSIVSEMSPPTSEAVPLLGIFFTCCMIVVTASTVFTVYVLNLHYRTPETHDMGPWTRNLLL 335          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Celegans
Match: acr-11 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:P91197])

HSP 1 Score: 231.491 bits (589), Expect = 4.583e-67
Identity = 114/324 (35.19%), Postives = 193/324 (59.57%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVP--SNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQF---LNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVK 1522
            E +L TDLL  Y     + RPV++S Q + V+  L L QILD+DEKNQ++++N W  Y W D  L+W+P  Y  +  +R P  S+ IW PD++LYN A E         ++   TG ++WIPP + K  C++D+T FPFD Q C +KFGSWT+ G  +D+Q     N    + L  Y  + EWQ+++    R   +Y CC EPYP + ++L +RR   ++ + L++P +L+S + ++ F  PP++  K+ L + I +A    L ++++ TP  S +VP IG ++   M++++ S   +++V+NL+FR  +   +   +++V+++
Sbjct:   26 ETKLFTDLLKGYNP---LERPVQNSSQPLEVKIKLFLQQILDVDEKNQIVSVNAWLSYTWFDHKLQWEPKKYGGIQDIRFPGSSDHIWKPDVLLYNSAAEDFDSTFKSNLLTYHTGTVVWIPPGVLKFVCQLDVTWFPFDDQVCEMKFGSWTFHGYAIDLQIDDDTNGTQSMDLSTYLVNGEWQVISTNAKRVVSYYKCCPEPYPTVNYYLHIRRRTLYYGFNLIIPSLLISLMAILGFMFPPDAGEKITLEVTILLAIVFFLSMVSEMTPPTSEAVPLIGVFFSCCMLVVSASVVFTIVVLNLHFRSADSHEMNPLVRRVLLE 346          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Celegans
Match: unc-38 (Acetylcholine receptor subunit alpha-type unc-38 [Source:UniProtKB/Swiss-Prot;Acc:Q23022])

HSP 1 Score: 226.098 bits (575), Expect = 1.386e-64
Identity = 135/342 (39.47%), Postives = 197/342 (57.60%), Query Frame = 2
Query:  563 DEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQF----LNNQSE----------------VSLEVYTESNEWQIVARPGIRNEKFYP-CCDE-PYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVK 1522
            D KRL  DL+ +Y +     RP     + + ++  L L QI+D+ E +Q++T +VW +  W+D  L WDP NY  V+ + VP   IW PDIVLYN AD       +    +  TGE+ W PPAIFKS C+ID+  FPFD+Q CHLKFGSWT+  + L ++     L  + E                + L  Y  S EW I++R   R  K YP CC +  Y D+T++L LRR P F+T  L+ PCV +S LT+++F+LP +S  K+ L ++I VA  +  LLL +  P+ S ++P IG Y    M+++T+S   +VI +NL+FR      +P+W+KKV +K
Sbjct:   26 DAKRLYDDLMVNYNRHR---RPSTSPNKPLTIKLKLRLSQIIDVHEIDQIMTCSVWLKQTWIDRKLSWDPVNYGGVNVLYVPYEMIWVPDIVLYNNADSNYNITISTKATLHYTGEVTWEPPAIFKSMCQIDVRWFPFDEQQCHLKFGSWTFSENLLSVELNEPSLRYEEEIDEKGIIDNVTVAEDGIDLSDYYPSVEWDIMSRVAKRRAKNYPSCCPQSAYIDVTYYLQLRRKPLFYTVNLVFPCVGISFLTILVFYLPSDSGEKVTLCISILVALTIFFLLLTEIIPATSITLPLIGKYLLFTMVMVTLSVVVTVISLNLHFRTPTTHLMPNWVKKVFLK 364          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Celegans
Match: acr-9 (AcetylCholine Receptor [Source:UniProtKB/TrEMBL;Acc:Q18556])

HSP 1 Score: 225.713 bits (574), Expect = 2.836e-64
Identity = 123/327 (37.61%), Postives = 197/327 (60.24%), Query Frame = 2
Query:  554 SLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVP--SNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSE------VSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKK 1510
            S +DE RL+ DL ++Y       RPV ++ + +VV   + L QILD+DEKNQV+T+  W  Y+W D  LKWDP+ Y  +  +R+P  +N IW PD++LYN ADE       V  VV  TG++L +PP I K SCKIDIT FPFD Q CHLKFGSWTY G+ +D++    + +      + ++ Y ++ EW ++A P       +   ++PYP + F+L ++R   ++   L++P  L+S +T++ F LPP++  K+ L + I ++    L ++AD TP  S +VP IG ++   M++++ S   +V+V+NL+ R      +  +L++
Sbjct:   24 SSADEYRLLADLRHNYDP---YERPVANASEPLVVSVKIYLQQILDVDEKNQVITLVAWIEYQWTDYKLKWDPSEYGGIKDIRIPGNANAIWKPDVLLYNSADENFDSTYPVNYVVSYTGDVLQVPPGILKLSCKIDITYFPFDDQICHLKFGSWTYSGNFIDLRINGPEGKNISDEGIDVQYYVQNGEWNLLAVPARHETNIFD--EQPYPSLFFYLIIQRRTLYYGLNLIIPSFLISLMTVLGFTLPPDAGEKITLEITILLSVCFFLSMVADMTPPTSEAVPLIGAFFSCCMLVVSASVVFTVLVLNLHNRKPETHEMSPFLRE 345          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Celegans
Match: unc-63 (Acetylcholine receptor subunit alpha-type unc-63 [Source:UniProtKB/Swiss-Prot;Acc:Q9N587])

HSP 1 Score: 224.942 bits (572), Expect = 3.208e-64
Identity = 132/343 (38.48%), Postives = 197/343 (57.43%), Query Frame = 2
Query:  563 DEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSE------------------------VSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            D  RL  DL+  Y K   + RPV ++ +T+VV + L+L Q+LD+ EKNQ++T NVW ++ WMD  L+WDP  Y  V  + VPS+ IW PD+VLYN AD   +        +   G + W PPAI+KS C+ID+  FPFD+Q C +KFGSWTY G ++D+Q  +   E                        + L  Y  S EW I+  PG R+ K YPCC+ P+ DIT+ + LRR   F+T  L+ P V +S LT ++F+LP +   K+ L ++I ++  +  LLL +  PS S  +P IG Y    M+L+T+S   +V+ +N+++R      +P W+K++ V
Sbjct:   26 DANRLFEDLIADYNK---LVRPVSENGETLVVTFKLKLSQLLDVHEKNQIMTTNVWLQHSWMDYKLRWDPVEYGGVEVLYVPSDTIWLPDVVLYNNADGNYQVTIMTKAKLTYNGTVEWAPPAIYKSMCQIDVEFFPFDRQQCEMKFGSWTYGGLEVDLQHRDKHLEKEIEEDVEGVDGPTKEIVWVVDRGIDLSDYYPSVEWDILNVPGKRHSKRYPCCESPFIDITYEIHLRRKTLFYTVNLIFPSVGISFLTALVFYLPSDGGEKISLCISILISLTVFFLLLVEIIPSTSLVIPLIGKYLLFTMVLVTLSVVVTVVTLNVHYRSPTTHTMPKWMKRLFV 365          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084639)

HSP 1 Score: 272.707 bits (696), Expect = 7.204e-81
Identity = 151/389 (38.82%), Postives = 239/389 (61.44%), Query Frame = 2
Query:  563 DEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFL------NNQSEVSLEV--YTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVK-IGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCK-KVGFKFGSDQNLNRSIDSPDVGHQM 1699
            D KRL  DLL++Y +   + RPV ++  TV+V+  L L Q++DL+ K+Q+LT NVW  ++W D   KWDP+ Y  V+++ VPS  IW PDIVLYN AD           ++  TG+++W PPAIFKSSC+ID+  FPFDQQ C +KFGSWTYDG Q+D++ +      +N+ E+ +++  Y  S EW I+  P  R+EK+YPCC EPYPDI F + LRR   F+T  L++PCV +S L++++F+LP +S  K+ L ++I ++  +  LL+++  PS S ++P +G Y    M+L+ +S   ++I++N+++R  +  ++  W++   +K +  +LLM        +    +  ++I Y  KF K K G     +  +N    SPD   +M
Sbjct:   44 DAKRLYDDLLSNYNR---LIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVP----KDLLRDLAANKINYGLKFSKTKFGQALMDEMQMNSGGSSPDSLRRM 425          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Fly
Match: nAChRalpha2 (gene:FBgn0000039 transcript:FBtr0084640)

HSP 1 Score: 272.707 bits (696), Expect = 7.204e-81
Identity = 151/389 (38.82%), Postives = 239/389 (61.44%), Query Frame = 2
Query:  563 DEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFL------NNQSEVSLEV--YTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVK-IGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCK-KVGFKFGSDQNLNRSIDSPDVGHQM 1699
            D KRL  DLL++Y +   + RPV ++  TV+V+  L L Q++DL+ K+Q+LT NVW  ++W D   KWDP+ Y  V+++ VPS  IW PDIVLYN AD           ++  TG+++W PPAIFKSSC+ID+  FPFDQQ C +KFGSWTYDG Q+D++ +      +N+ E+ +++  Y  S EW I+  P  R+EK+YPCC EPYPDI F + LRR   F+T  L++PCV +S L++++F+LP +S  K+ L ++I ++  +  LL+++  PS S ++P +G Y    M+L+ +S   ++I++N+++R  +  ++  W++   +K +  +LLM        +    +  ++I Y  KF K K G     +  +N    SPD   +M
Sbjct:   44 DAKRLYDDLLSNYNR---LIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVP----KDLLRDLAANKINYGLKFSKTKFGQALMDEMQMNSGGSSPDSLRRM 425          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0334916)

HSP 1 Score: 253.447 bits (646), Expect = 7.482e-74
Identity = 136/333 (40.84%), Postives = 209/333 (62.76%), Query Frame = 2
Query:  548 GFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSE-------VSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKI 1525
            G +  D KRL  DLL++Y +   + RPV ++   + V+  L L Q++D++ KNQ++T NVW   +W D  LKW+P +Y  V  + VPS  IW PDIVLYN AD   +       ++  TG+++W PPAI+KS C+ID+  FPFD+Q C +KFGSWTYDG  +D++ L   ++       + L+ Y  S EW I+  P +RNEKFY CC+EPY DI F L LRR   F+T  L++PCV +S L++++F+LP +S  K+ L ++I ++  +  LLLA+  P  S +VP +G Y    M+L+T+S   ++ V+N+ FR     R+  W++++ ++I
Sbjct:   19 GLANPDAKRLYDDLLSNYNR---LIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQRLFIQI 348          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Fly
Match: nAChRalpha1 (gene:FBgn0000036 transcript:FBtr0084619)

HSP 1 Score: 253.447 bits (646), Expect = 7.482e-74
Identity = 136/333 (40.84%), Postives = 209/333 (62.76%), Query Frame = 2
Query:  548 GFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSE-------VSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKI 1525
            G +  D KRL  DLL++Y +   + RPV ++   + V+  L L Q++D++ KNQ++T NVW   +W D  LKW+P +Y  V  + VPS  IW PDIVLYN AD   +       ++  TG+++W PPAI+KS C+ID+  FPFD+Q C +KFGSWTYDG  +D++ L   ++       + L+ Y  S EW I+  P +RNEKFY CC+EPY DI F L LRR   F+T  L++PCV +S L++++F+LP +S  K+ L ++I ++  +  LLLA+  P  S +VP +G Y    M+L+T+S   ++ V+N+ FR     R+  W++++ ++I
Sbjct:   19 GLANPDAKRLYDDLLSNYNR---LIRPVGNNSDRLTVKMGLRLSQLIDVNLKNQIMTTNVWVEQEWNDYKLKWNPDDYGGVDTLHVPSEHIWLPDIVLYNNADGNYEVTIMTKAILHHTGKVVWKPPAIYKSFCEIDVEYFPFDEQTCFMKFGSWTYDGYMVDLRHLKQTADSDNIEVGIDLQDYYISVEWDIMRVPAVRNEKFYSCCEEPYLDIVFNLTLRRKTLFYTVNLIIPCVGISFLSVLVFYLPSDSGEKISLCISILLSLTVFFLLLAEIIPPTSLTVPLLGKYLLFTMMLVTLSVVVTIAVLNVNFRSPVTHRMAPWVQRLFIQI 348          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Fly
Match: nAChRalpha4 (gene:FBgn0266347 transcript:FBtr0332872)

HSP 1 Score: 250.366 bits (638), Expect = 1.978e-73
Identity = 134/326 (41.10%), Postives = 202/326 (61.96%), Query Frame = 2
Query:  563 DEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQS-------EVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            D KRL  DLL++Y K   + RPV ++   + V   L+L Q++D++ KNQ++T N+W    W D  L+W+P  Y  V  + VPS+ IW PDIVLYN AD   +        + S G + W PPAI+KSSC+ID+  FPFD+Q C LKFGSWTYDG ++D++ ++ Q         V L  +  S EW I+  P +RNEKFY CCDEPY DITF + +RR   F+T  +++PC+ +S LT++ F+LP +S  K+ L ++I ++  +  LL+ +  P  S  VP +G Y    MIL+++S   +V+V+N++FR     ++  W+K+V +
Sbjct:   11 DAKRLYDDLLSNYNK---LVRPVVNTTDVLKVCIKLKLSQLIDVNLKNQIMTTNLWVEQSWYDYKLRWEPKEYGGVHMLHVPSDHIWRPDIVLYNNADGNFEVTLATKATIYSEGLVEWKPPAIYKSSCEIDVEYFPFDEQTCVLKFGSWTYDGFKVDLRHMDEQQGSNVVAVGVDLSEFYMSVEWDILEVPAVRNEKFYTCCDEPYLDITFNITMRRKTLFYTVNIIIPCMGISFLTVLTFYLPSDSGEKVTLSISILISLHVFFLLVVEIIPPTSLVVPLLGKYLIFAMILVSISICVTVVVLNVHFRSPQTHKMAPWVKRVFI 333          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Zebrafish
Match: chrna2b (cholinergic receptor, nicotinic, alpha 2b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-041001-99])

HSP 1 Score: 257.684 bits (657), Expect = 2.130e-75
Identity = 139/342 (40.64%), Postives = 211/342 (61.70%), Query Frame = 2
Query:  500 FLSTVLPNQTGNCQRDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKI 1525
             L T++      C++      DE  L   L + Y K     RPV ++   V+V++ L + Q++D+DEKNQ++T NVW + +W D  L+W P++Y NV+ +RVPS  IW PDIVLYN AD            +  TG++ W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++ + N   V L+ Y ES EW I+   G  N K Y CC E YPDIT+F  +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +  ++P W+  V + +
Sbjct:   15 LLCTIICESISCCEKTHSHAEDE--LFKKLFDGYNKWS---RPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIENT--VDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPCWVHSVFLDL 349          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Zebrafish
Match: FO907089.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101882451])

HSP 1 Score: 255.758 bits (652), Expect = 9.608e-75
Identity = 131/318 (41.19%), Postives = 205/318 (64.47%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            ++RL  DL+ +Y     + RPV +   ++ V +S  L+QI+D+DEKNQVLT N+W +  W D  L+W+ ++Y  V+ VR P + IW PDI+LYN ADER     +  ++V+S+G   ++PP IFKS+C ID+  FPFD Q C LKFGSWTY G  LD+Q +N      +  Y  + EW +V  PG RNEKFY CC EPYPD+TF + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   M+++ +S   +V+V+  ++   + +++P W + +++
Sbjct:   57 QRRLYRDLMKNYNP---LERPVYNDSHSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWTDYYLRWNMSDYPGVNTVRFPDSLIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWALDLQMIN----ADITGYIANGEWDLVEVPGRRNEKFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHYHDPDGAKMPKWTRVLLL 367          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 252.677 bits (644), Expect = 4.266e-74
Identity = 130/318 (40.88%), Postives = 202/318 (63.52%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            ++RL  DL+  Y     + RPV +   ++ V +S+ L+QI+D+DEKNQVLT N+W +  W D  L+W+ + Y  V+ VR P ++IW PDI+LYN ADER     +  ++V+S+G   ++PP IFKS+C ID+  FPFD Q C LKFGSWTY G  LD+Q +    +  +  Y  + EW +V  PG RNE+FY CC EPYPD+TF + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   M+++ +S   +V V+  ++      ++P W + V++
Sbjct:   27 QRRLYRDLMKDYNP---LERPVFNDTHSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDLQMI----DADITGYIANGEWDLVEVPGRRNERFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPEGGKMPKWTRVVLL 337          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Zebrafish
Match: chrna7 (cholinergic receptor, nicotinic, alpha 7 (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-3])

HSP 1 Score: 251.906 bits (642), Expect = 9.110e-74
Identity = 130/318 (40.88%), Postives = 202/318 (63.52%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            ++RL  DL+  Y     + RPV +   ++ V +S+ L+QI+D+DEKNQVLT N+W +  W D  L+W+ + Y  V+ VR P ++IW PDI+LYN ADER     +  ++V+S+G   ++PP IFKS+C ID+  FPFD Q C LKFGSWTY G  LD+Q +    +  +  Y  + EW +V  PG RNE+FY CC EPYPD+TF + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   M+++ +S   +V V+  ++      ++P W + V++
Sbjct:   26 QRRLYRDLMKDYNP---LERPVFNDTHSLTVYFSMSLMQIMDVDEKNQVLTTNIWLQLYWYDYYLQWNASEYPGVTNVRFPDSQIWKPDILLYNSADERFDATFHTNVLVNSSGACQYLPPGIFKSTCYIDVRWFPFDLQRCDLKFGSWTYGGWSLDLQMI----DADITGYIANGEWDLVEVPGRRNERFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPEGGKMPKWTRVVLL 336          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Zebrafish
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 250.366 bits (638), Expect = 4.460e-73
Identity = 138/346 (39.88%), Postives = 212/346 (61.27%), Query Frame = 2
Query:  485 LNNFIFLSTVLPNQTGNCQRDGF-SLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            LNN +++  ++ +       DG+     E +L   L   Y K     RPV++    V+V++ L + Q++D+DEKNQ++T NVW + +W D  L+W+P+ + NV+ +RVPS  IW PDIVLYN AD            +  TG++ W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++    +  V L+ Y ES EW I+   G  N K Y CC E YPDIT+F  +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +   +P W+  V +
Sbjct:   10 LNN-LWMLILIADHVQPVLSDGWIHAHAEDKLFHKLFIGYNKWS---RPVRNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPSEFDNVTSIRVPSEMIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVSWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QIEGTVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHSMPRWVHSVFL 349          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 252.677 bits (644), Expect = 4.102e-74
Identity = 135/318 (42.45%), Postives = 203/318 (63.84%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            E+RL   L   Y +     RPV ++   V+V++ L + Q++D+DEKNQ++T NVW + +W D  L+W+PA+Y NV+ +RVPS  IW PDIVLYN AD            +   G++ W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD + LD++ +  +  V L+ Y ES EW IV   G  N K Y CC E YPDIT++  +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +  ++P W++ V +
Sbjct:   32 EERLFKRLFTGYNRWS---RPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLESM--ERNVDLKDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVRSVFL 344          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Xenopus
Match: CHRNA2 (cholinergic receptor, nicotinic alpha 2 [Source:NCBI gene;Acc:100495873])

HSP 1 Score: 252.677 bits (644), Expect = 7.376e-74
Identity = 135/318 (42.45%), Postives = 203/318 (63.84%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            E+RL   L   Y +     RPV ++   V+V++ L + Q++D+DEKNQ++T NVW + +W D  L+W+PA+Y NV+ +RVPS  IW PDIVLYN AD            +   G++ W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD + LD++  + +  V L+ Y ES EW IV   G  N K Y CC E YPDIT++  +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +  ++P W++ V +
Sbjct:   32 EERLFKRLFTGYNRWS---RPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWNPADYDNVTSIRVPSEMIWIPDIVLYNNADGEFAITHMTKAHLFHNGKVKWVPPAIYKSSCSIDVTFFPFDQQSCKMKFGSWTYDKAWLDLE--SMERNVDLKDYWESGEWAIVNAVGKYNSKKYDCCTEIYPDITYYFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPLWVRSVFL 344          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 248.825 bits (634), Expect = 1.059e-72
Identity = 133/333 (39.94%), Postives = 210/333 (63.06%), Query Frame = 2
Query:  530 GNCQRDGFSLSD-EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKI 1525
             NC   GF  S+ E RL  DLL SY       RPV +    V++ + + + Q++ +DE NQ++  N+W R+ W D  LKW+P++Y  +  +R+P+++IW PDIVLYN A            VV  +G++ WIPPAIFKSSCKID+T FPFD Q C LKFGSWTYD +++++  +   S+++L+ + ES EW I+  PG ++E  Y CC E Y DIT+ L++RR P F+T  +++PC+L+S LT+++F+LP +   K+ L M++ ++  + LL++ +  PS S  +P IG Y    MI +T+S   +V V+N+++R      +P W+K+  + +
Sbjct:   12 SNCFLLGFFCSNVEHRLYEDLLKSYNPYI---RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIG--SKINLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHL 339          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Xenopus
Match: mppe1 (metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GENE-987928])

HSP 1 Score: 248.825 bits (634), Expect = 1.275e-72
Identity = 133/333 (39.94%), Postives = 210/333 (63.06%), Query Frame = 2
Query:  530 GNCQRDGFSLSD-EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKI 1525
             NC   GF  S+ E RL  DLL SY       RPV +    V++ + + + Q++ +DE NQ++  N+W R+ W D  LKW+P++Y  +  +R+P+++IW PDIVLYN A            VV  +G++ WIPPAIFKSSCKID+T FPFD Q C LKFGSWTYD +++++  +   S+++L+ + ES EW I+  PG ++E  Y CC E Y DIT+ L++RR P F+T  +++PC+L+S LT+++F+LP +   K+ L M++ ++  + LL++ +  PS S  +P IG Y    MI +T+S   +V V+N+++R      +P W+K+  + +
Sbjct:   18 SNCFLLGFFCSNVEHRLYEDLLKSYNPYI---RPVMNVSDPVILHFEVSMSQLVKVDEVNQIMETNLWLRHLWNDYKLKWNPSDYGGIEFLRIPASQIWRPDIVLYNNAVGAFHVDDKAKAVVRYSGDVTWIPPAIFKSSCKIDVTFFPFDYQNCSLKFGSWTYDKAKINLVMIG--SKINLKEFWESGEWVIINAPGYKHEIKYNCCVEIYQDITYSLYIRRLPLFYTIYIIIPCLLISCLTILVFYLPSDCGEKVTLCMSVLLSLTVFLLVITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPKTHTMPHWVKRFFLHL 345          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Xenopus
Match: CHRNA9 (cholinergic receptor, nicotinic alpha 9 [Source:NCBI gene;Acc:100493319])

HSP 1 Score: 248.44 bits (633), Expect = 1.292e-72
Identity = 145/386 (37.56%), Postives = 216/386 (55.96%), Query Frame = 2
Query:  569 KRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKKVG-FKFGSDQNLNRSIDSPDVGHQMINKKLDNS 1723
            + L  DL   Y  A    RPV+D+ + + V   + L QI D+DE+NQ+LT  +W R  W D  LKWD   Y  +  +R+PSN +W PDIVLYN AD+   E  N  +V+   G+I W  PAI KSSC +D++ FPFD Q C+L FGSWTY+G+Q+DI  +N      L  + E+ EW++   P ++N   Y CC EPYPDITF L L+R  +F+ + LL+PCV++S L  + F+LP +S  K+ LG+ + +A  +  L++A+S P  S SVP IG YY   M +IT ST  ++I++N++  G     +P W + VI+     +                 K +  Y+   C   G   F  D + N+ ++    GH  + K++  +
Sbjct:   39 QMLFRDLFEDYSNAL---RPVEDTDKALNVSLQITLSQIKDVDERNQILTAYLWIRLSWYDAYLKWDRDEYDGLDSIRIPSNMVWRPDIVLYNKADDEFSEPVNTNVVLRYDGKITWDSPAITKSSCVVDVSYFPFDNQQCNLTFGSWTYNGNQVDI--INTMDSGDLSDFVENVEWEMQGMPAVKNVITYGCCSEPYPDITFTLILKRRSSFYIFNLLIPCVMISFLAPLGFYLPADSGEKVSLGVTVLLALTVFQLMVAESMP-PSESVPLIGKYYIATMTMITASTALTIIIMNIHLCGPEAKPIPRWARIVILDYMSKIFFVYDVGENCTSPQNYEKEQEPYSSLGCPLSGSGNFSCDIDTNKKLNGHLGGHYALQKEISET 418          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 255.373 bits (651), Expect = 5.303e-75
Identity = 139/350 (39.71%), Postives = 211/350 (60.29%), Query Frame = 2
Query:  470 FVVFYLNNFIFLSTVLPNQTGNCQRDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            ++  YL   + +  VL  Q       G     E RL   L   Y +     RPV ++   V+VR+ L + Q++D+DEKNQ++T NVW + +W D  L+WDPA + N++ +RVPS  IW PDIVLYN AD            +  TG + W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++    +  V L+ Y ES EW I+   G  N K Y CC E YPD+T++  +RR P F+T  L++PC+L+S LT+++F+LP E   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +   +P+W++  ++
Sbjct:   11 WIHLYLWCLLLMPAVLAQQ-------GSHTHAEDRLFKHLFGGYNRWA---RPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALL 348          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Mouse
Match: Chrna2 (cholinergic receptor, nicotinic, alpha polypeptide 2 (neuronal) [Source:MGI Symbol;Acc:MGI:87886])

HSP 1 Score: 255.373 bits (651), Expect = 5.303e-75
Identity = 139/350 (39.71%), Postives = 211/350 (60.29%), Query Frame = 2
Query:  470 FVVFYLNNFIFLSTVLPNQTGNCQRDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            ++  YL   + +  VL  Q       G     E RL   L   Y +     RPV ++   V+VR+ L + Q++D+DEKNQ++T NVW + +W D  L+WDPA + N++ +RVPS  IW PDIVLYN AD            +  TG + W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++    +  V L+ Y ES EW I+   G  N K Y CC E YPD+T++  +RR P F+T  L++PC+L+S LT+++F+LP E   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +   +P+W++  ++
Sbjct:   11 WIHLYLWCLLLMPAVLAQQ-------GSHTHAEDRLFKHLFGGYNRWA---RPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALL 348          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Mouse
Match: Chrna10 (cholinergic receptor, nicotinic, alpha polypeptide 10 [Source:MGI Symbol;Acc:MGI:3609260])

HSP 1 Score: 251.136 bits (640), Expect = 4.228e-74
Identity = 134/317 (42.27%), Postives = 195/317 (61.51%), Query Frame = 2
Query:  569 KRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
             +L  DL  +Y  A    RPV D+ QT+ V   + L QI+D+DE+NQVLT+ +W R +W D  L WDP  Y ++  +R+PS+ +W PDIVLYN AD +     +  +VV   G + W  PAI +SSC++D++ FPFD Q C L FGSWT+ G QLD++     +  SL  + E+ EW+++  P  R    Y CC EPYPD+TF L LRR  A +   LLLPCV +S L  + F LP +S  K+ LG+ + +A  +  L+LA+S P A  SVP IG YY   M ++T ST  +++++NL++ G N   VP+W + +++
Sbjct:   31 HKLFRDLFANYTSAL---RPVADTDQTLNVTLEVTLSQIIDMDERNQVLTLYLWIRQEWTDAYLHWDPKAYGDLDAIRIPSSLVWRPDIVLYNKADTQPPASASTNVVVRHDGAVRWDAPAITRSSCRVDVSAFPFDAQRCGLTFGSWTHGGHQLDVR--PRGTSASLADFVENVEWRVLGMPARRRVLTYGCCSEPYPDVTFTLLLRRRAAAYVCNLLLPCVFISLLAPLAFHLPADSGEKVSLGVTVLLALTVFQLILAESMPPAE-SVPLIGKYYMATMTMVTFSTALTILIMNLHYCGPNAHPVPAWARVLLL 341          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Mouse
Match: Chrna7 (cholinergic receptor, nicotinic, alpha polypeptide 7 [Source:MGI Symbol;Acc:MGI:99779])

HSP 1 Score: 252.292 bits (643), Expect = 6.780e-74
Identity = 131/318 (41.19%), Postives = 201/318 (63.21%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            ++RL  +L+ +Y     + RPV +  Q + V +SL L+QI+D+DEKNQVLT N+W +  W D  L+W+ + Y  V  VR P  +IW PDI+LYN ADER     +  ++V+++G   ++PP IFKSSC ID+  FPFD Q C LKFGSW+Y G  LD+Q      E  +  Y  + EW ++  PG RNEKFY CC EPYPD+T+ + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   MI++ +S   +VIV+  +    +  ++P W + +++
Sbjct:   26 QRRLYKELVKNYNP---LERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNMSEYPGVKNVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNASGHCQYLPPGIFKSSCYIDVRWFPFDVQQCKLKFGSWSYGGWSLDLQM----QEADISSYIPNGEWDLMGIPGKRNEKFYECCKEPYPDVTYTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLRYHHHDPDGGKMPKWTRIILL 336          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Mouse
Match: Chrna3 (cholinergic receptor, nicotinic, alpha polypeptide 3 [Source:MGI Symbol;Acc:MGI:87887])

HSP 1 Score: 248.44 bits (633), Expect = 6.386e-73
Identity = 128/320 (40.00%), Postives = 205/320 (64.06%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKI 1525
            E RL   L   Y +   + RPV +    V++++ + + Q++ +DE NQ++  N+W +  W D  LKW P++Y  V  +RVP+ +IW PDIVLYN AD   +       ++  TGE+ WIPPAIFKSSCKID+T FPFD Q C +KFGSW+YD +++D+  +   S ++L+ Y ES EW I+  PG ++E  Y CC+E Y DIT+ L++RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LL++ ++ PS S  +P IG Y    MI +T+S   +V V+N+++R      +P+W+K V + +
Sbjct:   29 EHRLFQYLFEDYNE---IIRPVANVSHPVIIQFEVSMSQLVKVDEVNQIMETNLWLKQIWNDYKLKWKPSDYQGVEFMRVPAEKIWKPDIVLYNNADGDFQVDDKTKALLKYTGEVTWIPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWSYDKAKIDLVLIG--SSMNLKDYWESGEWAIIKAPGYKHEIKYNCCEEIYQDITYSLYIRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLCISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHYRTPTTHTMPTWVKAVFLNL 343          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. UniProt/SwissProt
Match: sp|P17644|ACH2_DROME (Acetylcholine receptor subunit alpha-like 2 OS=Drosophila melanogaster OX=7227 GN=nAChRalpha2 PE=2 SV=1)

HSP 1 Score: 272.707 bits (696), Expect = 7.222e-80
Identity = 151/389 (38.82%), Postives = 239/389 (61.44%), Query Frame = 2
Query:  563 DEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFL------NNQSEVSLEV--YTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVK-IGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCK-KVGFKFGSDQNLNRSIDSPDVGHQM 1699
            D KRL  DLL++Y +   + RPV ++  TV+V+  L L Q++DL+ K+Q+LT NVW  ++W D   KWDP+ Y  V+++ VPS  IW PDIVLYN AD           ++  TG+++W PPAIFKSSC+ID+  FPFDQQ C +KFGSWTYDG Q+D++ +      +N+ E+ +++  Y  S EW I+  P  R+EK+YPCC EPYPDI F + LRR   F+T  L++PCV +S L++++F+LP +S  K+ L ++I ++  +  LL+++  PS S ++P +G Y    M+L+ +S   ++I++N+++R  +  ++  W++   +K +  +LLM        +    +  ++I Y  KF K K G     +  +N    SPD   +M
Sbjct:   44 DAKRLYDDLLSNYNR---LIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFKWDPSEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAILHYTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHISQKNDKDNKVEIGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIIPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMLLVGLSVVITIIILNIHYRKPSTHKMRPWIRSFFIKRLPKLLLMRVP----KDLLRDLAANKINYGLKFSKTKFGQALMDEMQMNSGGSSPDSLRRM 425          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. UniProt/SwissProt
Match: sp|P23414|ACH1_SCHGR (Acetylcholine receptor subunit alpha-L1 OS=Schistocerca gregaria OX=7010 PE=2 SV=1)

HSP 1 Score: 271.937 bits (694), Expect = 8.069e-80
Identity = 141/335 (42.09%), Postives = 219/335 (65.37%), Query Frame = 2
Query:  563 DEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSE-------VSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV-KIGCVLLM 1543
            D KRL  DLL++Y +   + RPV ++  TV+V+  L L Q++DL+ K+Q+LT NVW  ++W D   +WDPA Y  V+++ VPS  IW PDIVLYN AD           V+  TG+++W PPAIFKSSC+ID+  FPFDQQ C +KFGSWTYDG Q+D++ +N + +       + L  Y  S EW I+  P  R+EK+YPCC EPYPDI F + LRR   F+T  L++PCV +S L++++F+LP +S  K+ L ++I ++  +  LL+++  PS S ++P +G Y    M+L+ +S   +++V+N+++R  +  ++  W++KV + ++  +LLM
Sbjct:   26 DAKRLYDDLLSNYNR---LIRPVSNNTDTVLVKLGLRLSQLIDLNLKDQILTTNVWLEHEWQDHKFRWDPAEYGGVTELYVPSEHIWLPDIVLYNNADGEYVVTTMTKAVLHHTGKVVWTPPAIFKSSCEIDVRYFPFDQQTCFMKFGSWTYDGDQIDLKHINQKYDDNKVKVGIDLREYYPSVEWDILGVPAERHEKYYPCCAEPYPDIFFNITLRRKTLFYTVNLIVPCVGISYLSVLVFYLPADSGEKIALCISILLSQTMFFLLISEIIPSTSLALPLLGKYLLFTMVLVGLSVVITIMVLNVHYRKPSTHKMAPWVRKVFIRRLPKLLLM 357          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. UniProt/SwissProt
Match: sp|P12389|ACHA2_RAT (Neuronal acetylcholine receptor subunit alpha-2 OS=Rattus norvegicus OX=10116 GN=Chrna2 PE=2 SV=2)

HSP 1 Score: 255.373 bits (651), Expect = 3.653e-74
Identity = 142/356 (39.89%), Postives = 213/356 (59.83%), Query Frame = 2
Query:  455 RDAMKFVV-FYLNNFIFLSTVLPNQTGNCQRDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
              A++F    YL   + +  VL  Q       G     E RL   L   Y +     RPV ++   V+VR+ L + Q++D+DEKNQ++T NVW + +W D  L+WDPA + NV+ +RVPS  IW PDIVLYN AD            +  TG + W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++    +  V L+ Y ES EW I+   G  N K Y CC E YPD+T++  +RR P F+T  L++PC+L+S LT+++F+LP E   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +   +P+W++  ++
Sbjct:    5 HSALQFWTHLYLWCLLLVPAVLTQQ-------GSHTHAEDRLFKHLFGGYNRWA---RPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNVTSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALL 348          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. UniProt/SwissProt
Match: sp|Q91X60|ACHA2_MOUSE (Neuronal acetylcholine receptor subunit alpha-2 OS=Mus musculus OX=10090 GN=Chrna2 PE=2 SV=1)

HSP 1 Score: 255.373 bits (651), Expect = 3.709e-74
Identity = 139/350 (39.71%), Postives = 211/350 (60.29%), Query Frame = 2
Query:  470 FVVFYLNNFIFLSTVLPNQTGNCQRDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            ++  YL   + +  VL  Q       G     E RL   L   Y +     RPV ++   V+VR+ L + Q++D+DEKNQ++T NVW + +W D  L+WDPA + N++ +RVPS  IW PDIVLYN AD            +  TG + W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++    +  V L+ Y ES EW I+   G  N K Y CC E YPD+T++  +RR P F+T  L++PC+L+S LT+++F+LP E   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +   +P+W++  ++
Sbjct:   11 WIHLYLWCLLLMPAVLAQQ-------GSHTHAEDRLFKHLFGGYNRWA---RPVPNTSDVVIVRFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWDPAEFGNITSLRVPSEMIWIPDIVLYNNADGEFAVTHMTKAHLFFTGTVHWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLE--QMERTVDLKDYWESGEWAIINATGTYNSKKYDCCAEIYPDVTYYFVIRRLPLFYTINLIIPCLLISCLTVLVFYLPSECGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHNMPNWVRVALL 348          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. UniProt/SwissProt
Match: sp|Q866A2|ACHA7_MACMU (Neuronal acetylcholine receptor subunit alpha-7 OS=Macaca mulatta OX=9544 GN=CHRNA7 PE=2 SV=1)

HSP 1 Score: 254.603 bits (649), Expect = 5.517e-74
Identity = 133/318 (41.82%), Postives = 201/318 (63.21%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            +++L  +L+ +Y     + RPV +  Q + V +SL L+QI+D+DEKNQVLT N+W +  W D  L+W+ + Y  V  VR P  +IW PDI+LYN ADER     +  ++V+S+G   ++PP IFKSSC ID+  FPFD Q C LKFGSW+Y G  LD+Q      E  +  Y  S EW +V  PG R+EKFY CC EPYPD+TF + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   MI++ +S   +VIV+  +    +  ++P W + +++
Sbjct:   26 QRKLYKELVKNYNP---LERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWTDHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPPGIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQM----QEADISGYIPSGEWDLVGIPGKRSEKFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPDGGKMPKWTRVILL 336          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. TrEMBL
Match: A0A1I8H633 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 545.428 bits (1404), Expect = 8.518e-178
Identity = 303/566 (53.53%), Postives = 387/566 (68.37%), Query Frame = 2
Query:  554 SLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKKVGFKFGSDQNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVSNPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNT-IEEVIRQ 2248
            +LSDEK LI  +L  YK AG+ GRPV+++   V V++ L LIQILDLDEKNQVLTI VW+R+ W D+LL+W+   Y+ VS+VR+P+ ++WTPDIVLYNYADERLKE R VMIV + TG ++WIPPAI+KS+C++DITNFPFDQQ CHLKFGSWTYDG +LDIQF  N+S +S + Y +SNEW IVA P  RN KFYPCC+EPYPD+TFFLFL+RNP FF YLL+LPCVLLSSLTLVIFWLPPESPAKM+LGMNIFVAFFLLLLLLA+STPSASTSVPYIGFYYCLNM+LIT+STF SVIVINLYFRGD ++R+P WLKK I  +  +L M     +   EK+R+I+SEIK+NR   KK   +    Q +  + D+      + +++  N V+ AS    I      +    +        +          L    N+      Y   D  ++     + +              N+  Q E + +  +Q++E+D+ +IR+SIR LM R+A  D   K A EWR VALVLDRIFFW +L  II +G  LL+P +P+ + IEE I +
Sbjct:  280 ALSDEKTLIKKILLDYKTAGVDGRPVQNTTDVVTVQFGLGLIQILDLDEKNQVLTIKVWSRFSWTDQLLQWNATQYNGVSEVRIPTRDVWTPDIVLYNYADERLKEQREVMIVTNHTGRVIWIPPAIYKSTCQVDITNFPFDQQSCHLKFGSWTYDGFKLDIQFYQNKSNISTDDYIQSNEWHIVALPATRNVKFYPCCNEPYPDLTFFLFLKRNPEFFAYLLVLPCVLLSSLTLVIFWLPPESPAKMLLGMNIFVAFFLLLLLLAESTPSASTSVPYIGFYYCLNMLLITLSTFLSVIVINLYFRGDKRNRLPGWLKKCIEFLAKMLCMRQVITKSETEKLRLIRSEIKHNRHHNKKKK-QGRRAQVVELAGDTGGGPTSLTSQRFQNYVDEASVRDSIAAAAAAA---ASGGGSGGFDFQQQQHQQQMLLSLGGNSAANHPGY--PDESLLFHPQFQQQQQ--QQQQQKQQQQNLLKQAEDSTIHLTQSMESDLREIRRSIRNLMMRLAQKDATQKVAREWRMVALVLDRIFFWCYLVIIITAGFTLLMPTSPAASRIEETIEE 837          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. TrEMBL
Match: A0A1I8H284 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 546.199 bits (1406), Expect = 6.613e-176
Identity = 305/570 (53.51%), Postives = 389/570 (68.25%), Query Frame = 2
Query:  545 DGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKKVGFKFG-SDQNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVSNPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNT-IEEVIRQ 2248
            +  +LSDEK LI  +L  YK AG+ GRPV+++   V V++ L LIQILDLDEKNQVLTI VW+R+ W D+LL+W+   Y+ VS+VR+P+ ++WTPDIVLYNYADERLKE R VMIV + TG ++WIPPAI+KS+C++DITNFPFDQQ CHLKFGSWTYDG +LDIQF  N+S +S + Y +SNEW IVA P  RN KFYPCC+EPYPD+TFFLFL+RNP FF YLL+LPCVLLSSLTLVIFWLPPESPAKM+LGMNIFVAFFLLLLLLA+STPSASTSVPYIGFYYCLNM+LIT+STF SVIVINLYFRGD ++R+P WLKK I  +  +L M     +   EK+R+I+SEIK+NR   KK   K G   Q +  + D+      + +++  N V+ AS    I      +    +        +          L    N+      Y   D  ++     + +              N+  Q E + +  +Q++E+D+ +IR+SIR LM R+A  D   K A EWR VALVLDRIFFW +L  II +G  LL+P +P+ + IEE I +
Sbjct:  463 ESIALSDEKTLIKKILLDYKTAGVDGRPVQNTTDVVTVQFGLGLIQILDLDEKNQVLTIKVWSRFSWTDQLLQWNATQYNGVSEVRIPTRDVWTPDIVLYNYADERLKEQREVMIVTNHTGRVIWIPPAIYKSTCQVDITNFPFDQQSCHLKFGSWTYDGFKLDIQFYQNKSNISTDDYIQSNEWHIVALPATRNVKFYPCCNEPYPDLTFFLFLKRNPEFFAYLLVLPCVLLSSLTLVIFWLPPESPAKMLLGMNIFVAFFLLLLLLAESTPSASTSVPYIGFYYCLNMLLITLSTFLSVIVINLYFRGDKRNRLPGWLKKCIEFLAKMLCMRQVITKSETEKLRLIRSEIKHNRHHNKKK--KQGRRAQVVELAGDTGGGPTSLTSQRFQNYVDEASVRDSIAAAAAAA---ASGGGSGGFDFQQQQHQQQMLLSLGGNSAANHPGY--PDESLLFHPQFQQQQQ--QQQQQQQQQQNLLKQAEDSTIHLTQSMESDLREIRRSIRNLMMRLAQKDATQKVAREWRMVALVLDRIFFWCYLVIIITAGFTLLMPTSPAASRIEETIEE 1023          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. TrEMBL
Match: A0A1I8G3D5 (Uncharacterized protein OS=Macrostomum lignano OX=282301 PE=3 SV=1)

HSP 1 Score: 481.871 bits (1239), Expect = 2.351e-158
Identity = 248/361 (68.70%), Postives = 298/361 (82.55%), Query Frame = 2
Query:  545 DGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKK 1627
            +  +LSDEK LI  +L  YK AG+ GRPV+++   V V++ L LIQILDLDEKNQVLTI VW+R+ W D+LL+W+   Y+ VS+VR+P+ ++WTPDIVLYNYADERLKE R VMIV + TG ++WIPPAI+KS+C++DITNFPFDQQ CHLKFGSWTYDG +LDIQF  N+S +S + Y +SNEW IVA P  RN KFYPCC+EPYPD+TFFLFL+RNP FF YLL+LPCVLLSSLTLVIFWLPPESPAKM+LGMNIFVAFFLLLLLLA+STPSASTSVPYIGFYYCLNM+LIT+STF SVIVINLYFRGD ++R+P WLKK I  +  +L M     +   EK+R+I+SEIK+NR   KK
Sbjct:   10 ESIALSDEKTLIKKILLDYKTAGVDGRPVQNTTDVVTVQFGLGLIQILDLDEKNQVLTIKVWSRFSWTDQLLQWNATQYNGVSEVRIPTRDVWTPDIVLYNYADERLKEQREVMIVTNHTGRVIWIPPAIYKSTCQVDITNFPFDQQSCHLKFGSWTYDGFKLDIQFYQNKSNISTDDYIQSNEWHIVALPATRNVKFYPCCNEPYPDLTFFLFLKRNPEFFAYLLVLPCVLLSSLTLVIFWLPPESPAKMLLGMNIFVAFFLLLLLLAESTPSASTSVPYIGFYYCLNMLLITLSTFLSVIVINLYFRGDKRNRLPGWLKKCIEFLAKMLCMRQVITKSETEKLRLIRSEIKHNRHHNKK 370          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. TrEMBL
Match: A0A267GKY0 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig005119g9 PE=3 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 7.686e-158
Identity = 251/369 (68.02%), Postives = 302/369 (81.84%), Query Frame = 2
Query:  524 QTGNC-QRDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKK 1627
            Q  +C Q +  +LSDEK LI  +L  YK AG+ GRPV+++   V V++ L LIQILDLDEKNQVLTI VW+R+ W D+LL+W+   Y+ VS+VR+P+ ++WTPDIVLYNYADERLKE R VMIV + TG ++WIPPAI+KS+C++DITNFPFDQQ CHLKFGSWTYDG +LDIQF  N+S +S + Y +SNEW IVA P  RN KFYPCC+EPYPD+TFFLFL+RNP FF YLL+LPCVLLSSLTLVIFWLPPESPAKM+LGMNIFVAFFLLLLLLA+STPSASTSVPYIGFYYCLNM+LIT+STF SVIVINLYFRGD ++R+P WLKK I  +  +L M     +   EK+R+I+SEIK+NR   KK
Sbjct:   70 QAAHCKQNESIALSDEKTLIKKILLDYKTAGVDGRPVQNTTDVVTVQFGLGLIQILDLDEKNQVLTIKVWSRFSWTDQLLQWNATQYNGVSEVRIPTRDVWTPDIVLYNYADERLKEQREVMIVTNHTGRVIWIPPAIYKSTCQVDITNFPFDQQSCHLKFGSWTYDGFKLDIQFYQNKSNISTDDYIQSNEWHIVALPATRNVKFYPCCNEPYPDLTFFLFLKRNPEFFAYLLVLPCVLLSSLTLVIFWLPPESPAKMLLGMNIFVAFFLLLLLLAESTPSASTSVPYIGFYYCLNMLLITLSTFLSVIVINLYFRGDKRNRLPGWLKKCIEFLAKMLCMRQVITKSETEKLRLIRSEIKHNRHHNKK 438          

HSP 2 Score: 92.4337 bits (228), Expect = 1.905e-15
Identity = 44/91 (48.35%), Postives = 62/91 (68.13%), Query Frame = 2
Query: 1979 NITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNT-IEEVIRQ 2248
            N+  Q E + +  +Q++E+D+ +IR+SIR LM R+A  D   K A EWR VALVLDRIFFW +L  II +G  LL+P +P+ + IEE I +
Sbjct:  548 NLLKQAEDSTIHLTQSMESDLREIRRSIRNLMMRLAQKDATQKVAREWRMVALVLDRIFFWCYLVIIITAGFTLLMPTSPAASRIEETIEE 638          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. TrEMBL
Match: A0A267GIR5 (Uncharacterized protein (Fragment) OS=Macrostomum lignano OX=282301 GN=BOX15_Mlig028506g1 PE=3 SV=1)

HSP 1 Score: 486.878 bits (1252), Expect = 9.126e-158
Identity = 251/369 (68.02%), Postives = 302/369 (81.84%), Query Frame = 2
Query:  524 QTGNC-QRDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKK 1627
            Q  +C Q +  +LSDEK LI  +L  YK AG+ GRPV+++   V V++ L LIQILDLDEKNQVLTI VW+R+ W D+LL+W+   Y+ VS+VR+P+ ++WTPDIVLYNYADERLKE R VMIV + TG ++WIPPAI+KS+C++DITNFPFDQQ CHLKFGSWTYDG +LDIQF  N+S +S + Y +SNEW IVA P  RN KFYPCC+EPYPD+TFFLFL+RNP FF YLL+LPCVLLSSLTLVIFWLPPESPAKM+LGMNIFVAFFLLLLLLA+STPSASTSVPYIGFYYCLNM+LIT+STF SVIVINLYFRGD ++R+P WLKK I  +  +L M     +   EK+R+I+SEIK+NR   KK
Sbjct:   70 QAAHCKQNESIALSDEKTLIKKILLDYKTAGVDGRPVQNTTDVVTVQFGLGLIQILDLDEKNQVLTIKVWSRFSWTDQLLQWNATQYNGVSEVRIPTRDVWTPDIVLYNYADERLKEQREVMIVTNHTGRVIWIPPAIYKSTCQVDITNFPFDQQSCHLKFGSWTYDGFKLDIQFYQNKSNISTDDYIQSNEWHIVALPATRNVKFYPCCNEPYPDLTFFLFLKRNPEFFAYLLVLPCVLLSSLTLVIFWLPPESPAKMLLGMNIFVAFFLLLLLLAESTPSASTSVPYIGFYYCLNMLLITLSTFLSVIVINLYFRGDKRNRLPGWLKKCIEFLAKMLCMRQVITKSETEKLRLIRSEIKHNRHHNKK 438          

HSP 2 Score: 92.4337 bits (228), Expect = 2.095e-15
Identity = 44/91 (48.35%), Postives = 62/91 (68.13%), Query Frame = 2
Query: 1979 NITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNT-IEEVIRQ 2248
            N+  Q E + +  +Q++E+D+ +IR+SIR LM R+A  D   K A EWR VALVLDRIFFW +L  II +G  LL+P +P+ + IEE I +
Sbjct:  548 NLLKQAEDSTIHLTQSMESDLREIRRSIRNLMMRLAQKDATQKVAREWRMVALVLDRIFFWCYLVIIITAGFTLLMPTSPAASRIEETIEE 638          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Cavefish
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 258.07 bits (658), Expect = 6.762e-76
Identity = 136/318 (42.77%), Postives = 205/318 (64.47%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            E +L   L + Y K     RPV++    V+V++ L + Q++D+DEKNQ++T NVW + +W D  L+W P++Y NV+ +RVPS  IW PDIVLYN AD            +  TG++LW+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++ + N   V L+ Y ES EW IV   G  N K Y CC E YPDIT+F  +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +  ++P W++ + +
Sbjct:   23 EDQLFKKLFSGYNKWS---RPVRNITDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVLWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIENT--VDLKDYWESGEWAIVNAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPGWVQSIFL 335          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 255.373 bits (651), Expect = 3.646e-75
Identity = 134/318 (42.14%), Postives = 203/318 (63.84%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            ++RL  DL+ +Y     + RPV +  Q++ V +S  L+QI+D+DEKNQVLT N+W +  W D  LKW+ ++Y  V+ VR P N+IW PDI+LYN ADER     +  +VV + G   ++PP IFKS+C ID+  FPFD Q C LKFGSWTY G  LD+Q +    E  +  Y  + EW +V   G RNEKFY CC EPYPD+TF + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   M+++ +S   +V V+  ++   +  ++P+W + V++
Sbjct:   26 QRRLYQDLMKNYNP---LERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMM----EADISGYIANGEWDLVEVQGQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLL 336          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Cavefish
Match: chrna7 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103030483])

HSP 1 Score: 254.218 bits (648), Expect = 6.494e-75
Identity = 134/318 (42.14%), Postives = 204/318 (64.15%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            ++RL  DL+ +Y     + RPV +  Q++ V +S  L+QI+D+DEKNQVLT N+W +  W D  LKW+ ++Y  V+ VR P N+IW PDI+LYN ADER     +  +VV + G   ++PP IFKS+C ID+  FPFD Q C LKFGSWTY G  LD+Q +    E  +  Y  + EW +V + G RNEKFY CC EPYPD+TF + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   M+++ +S   +V V+  ++   +  ++P+W + V++
Sbjct:   13 QRRLYQDLMKNYNP---LERPVFNDSQSLTVNFSFSLMQIMDVDEKNQVLTSNIWLQLYWYDHYLKWNLSDYPGVTNVRFPDNQIWKPDILLYNSADERFDATFHTNVVVSADGSCHYLPPGIFKSTCYIDVKWFPFDVQRCALKFGSWTYGGWSLDLQMM----EADISGYIANGEWDLVGK-GQRNEKFYDCCREPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVWVLQYHYHDPDGGKMPTWTRIVLL 322          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Cavefish
Match: ENSAMXT00000053066.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:103033738])

HSP 1 Score: 250.751 bits (639), Expect = 4.785e-74
Identity = 127/299 (42.47%), Postives = 195/299 (65.22%), Query Frame = 2
Query:  623 RPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            RPV +  Q++ V +S  L+QI+D+DEKNQVLT N+W +  W+D  L+W+  +Y  V+ VR P N+IW PDI+LYN ADER     +  ++V+S+G   ++PP IFKS+C ID+  FPFD Q C LKFGSWTY G  LD+Q +    +  +  Y  + EW +V  PG RNEKFY CC EPYPD+TF + +RR   ++   LL+PCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   M+++ +S   +V+V+  +    +  ++P W + +++
Sbjct:    9 RPVFNDSQSLTVHFSFSLMQIMDVDEKNQVLTTNIWLQLYWVDYYLQWNVTDYPGVANVRFPDNQIWRPDILLYNSADERFDATFHTNVLVNSSGYCQYLPPGIFKSTCYIDVRWFPFDVQRCDLKFGSWTYGGWSLDLQMM----DADITGYIANGEWDLVEVPGRRNEKFYDCCKEPYPDVTFTVVMRRRTLYYGLNLLIPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVLLL 303          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Cavefish
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:103031133])

HSP 1 Score: 251.521 bits (641), Expect = 7.167e-74
Identity = 135/320 (42.19%), Postives = 201/320 (62.81%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKI 1525
            E  L   L   Y K     RPV ++   V+V++ L + Q++D+DEKNQ++T NVW + +W D  L+W P++Y NV+ +RVPS  IW PDIVLYN AD            +  TG++ W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++ L  ++ V L+ Y ES EW I+   G  N K Y CC E YPDIT+F  +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R      +P W+  V + +
Sbjct:   53 EDELFKKLFIGYNKWS---RPVPNTSDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFYTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERL--ETMVDLKDYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIIITVFVLNVHHRSPGTHEMPHWVHAVFLDL 367          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Sea Lamprey
Match: chrna3 (cholinergic receptor, nicotinic, alpha 3 [Source:ZFIN;Acc:ZDB-GENE-070822-1])

HSP 1 Score: 239.195 bits (609), Expect = 4.997e-70
Identity = 120/316 (37.97%), Postives = 204/316 (64.56%), Query Frame = 2
Query:  572 RLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            RL   L  SY       RPV +    V+VR+ + + Q++ LDE NQ++  N+W ++ W D   +W+P  +  +  +RVPS++IW PDIVLYN AD   +       ++   G ++W+PPAIFKSSCKID+T FPFD Q C +KFGSWTYD +++D+  +   ++++L+ + ES EW I+  PG +++  Y CC++ YPDIT+ +++RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LL++ ++ PS S  +P IG Y    MI +T+S   ++ V+N+++R      +P+W+++V +
Sbjct:   10 RLYKTLFTSYNPYI---RPVFNVSDPVIVRFEVSMSQLVKLDEVNQIMATNLWLKHTWNDYKFQWNPGQFEGMEYIRVPSDKIWKPDIVLYNNADGDFQVEGKTKALLKYDGTVMWMPPAIFKSSCKIDVTYFPFDYQNCTMKFGSWTYDKAKIDLVLVG--TKINLKDFWESGEWVIIDVPGYKHDIKYNCCEQIYPDITYSVYVRRLPLFYTINLIIPCLLISFLTVLVFYLPSDCGEKVTLSISVLLSLTVFLLVITETIPSTSLVIPLIGEYLLFTMIFVTLSIVITIFVLNVHYRTPEAHTMPNWVRRVFL 320          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Sea Lamprey
Match: chrna2a (cholinergic receptor, nicotinic, alpha 2a (neuronal) [Source:ZFIN;Acc:ZDB-GENE-040108-2])

HSP 1 Score: 228.794 bits (582), Expect = 1.517e-65
Identity = 126/288 (43.75%), Postives = 182/288 (63.19%), Query Frame = 2
Query:  656 VRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            VRY+     + D DEKNQ++T NVW + +W D  L+WDPA Y NV+ +RVPS  IW PDIVLYN AD            +  TG + W PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D+  ++   +V L+ Y ES EW IV   G  N K Y CC + YPDIT+   +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R      +P W+++V +
Sbjct:    1 VRYAEFRTHLCDCDEKNQMMTTNVWLKQEWDDYKLQWDPAEYENVTSIRVPSELIWVPDIVLYNNADGDFAVTHMTKAHLFHTGRVRWKPPAIYKSSCSIDVTFFPFDQQNCTMKFGSWTYDKAKIDL--VSMARDVDLKDYWESGEWAIVHAVGTYNTKKYDCCPQVYPDITYSFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPATHAMPRWVRRVFL 286          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Sea Lamprey
Match: chrnb3b (cholinergic receptor, nicotinic, beta 3b (neuronal) [Source:ZFIN;Acc:ZDB-GENE-030102-4])

HSP 1 Score: 218.009 bits (554), Expect = 1.012e-62
Identity = 134/353 (37.96%), Postives = 210/353 (59.49%), Query Frame = 2
Query:  509 TVLPNQTGNCQRDGFSLSD-EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIV---ARPGIR--NEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSR-VPSWLKKVIV----KIGCV 1534
            + +P+     Q    SL++ E RL+  +L  Y+K     RPV     TV V++ L + Q++D+DEKNQ++T NVW + +W+D  L+W+P +Y  ++ +RVP++ IW PDIVLY+ AD R +       VV   G I W PPAI+KSSC ID+T FPFDQQ C +KFGSWTYDG+ +D+  +N  S+V    Y ++ EW+ +      G+R    +FYP        IT+   +RR P F+T  L++PC+ LS LT+ +F+LP +   K+ L  ++ V+  + LL++ +  PS+S  +P IG Y    MI +T+S   +V VIN++ R  +    +  W++++ +    KI C+
Sbjct:   17 STIPDHAA--QVPSLSLAELEDRLLKRMLKDYQKWV---RPVDKLSDTVEVKFGLGIAQLVDVDEKNQLMTTNVWLKQEWVDINLRWNPDDYGGINSIRVPASSIWLPDIVLYDNADGRFEGSIVTKAVVKHDGRIKWTPPAIYKSSCTIDVTFFPFDQQNCSMKFGSWTYDGTLVDLIMVN--SDVDRGEYFDNGEWEFLNATGNKGVRLDGHRFYPY-------ITYSFVIRRLPLFYTLFLIVPCLGLSFLTVFVFYLPSDEGEKISLCTSVLVSLTVFLLVIEEIIPSSSKVIPLIGEYLLFIMIFVTLSIIITVFVINVHHRSSSTHHPMAPWVRQLFLHKLPKILCM 355          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000008550.1 (pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene:ENSPMAG00000007717.1 transcript:ENSPMAT00000008550.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 186.808 bits (473), Expect = 5.870e-52
Identity = 100/248 (40.32%), Postives = 155/248 (62.50%), Query Frame = 2
Query:  776 NYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
             +  V  +R   ++IWTPDI+LYN ADER     +  ++V+ TG    +PP + KS+C ID+  FPFD Q C LKFGSWT+DG  +D+Q L    E     Y  + EW +V  PG RNE +Y CC EPYPD+T+ L +RR   ++   LL+PCVL+S+L+L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP IG Y+   MI++  S   +VIV+  +    +  ++P W++ +++
Sbjct:    2 EHPGVKNLRFQPHQIWTPDILLYNSADERFDATFHTNVLVNYTGNCQHLPPGMLKSTCYIDVRWFPFDVQKCDLKFGSWTHDGWLIDLQML----EADTSGYIANGEWDLVEIPGKRNELYYDCCQEPYPDVTYTLTIRRRTLYYGLNLLVPCVLISALSLLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIGQYFASTMIIVAFSVVVTVIVLQYHHHNPDGKKMPQWVRVILL 245          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Sea Lamprey
Match: chrnb1l (cholinergic receptor, nicotinic, beta 1 (muscle) like [Source:ZFIN;Acc:ZDB-GENE-060811-1])

HSP 1 Score: 175.252 bits (443), Expect = 2.008e-47
Identity = 108/336 (32.14%), Postives = 177/336 (52.68%), Query Frame = 2
Query:  536 CQRDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLE-------VYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVK 1522
            C      L  E+ L+ DL    +   +V RP + +   V VR  + L Q++ L      +T++      W D  L WDP NY N+  +R+    +W PDI L N  D        V ++VD TG + W+PP+I++SSC + +  FPFD Q C + F S+TYD S++++++  ++    +         +  S EWQI  +P  +N       D  Y DITF+L + R P F+   +++PC+L++   +  F+LPP++  KM L +++ +A  + LLLLAD  P  S  VP I  Y    M+++T     +VIV+NL+FR      +P W++++ + 
Sbjct:   14 CSAGVRGLEAEENLLKDLFVVQQYKTLV-RPARTATGRVTVRLGMTLSQLISLPACQPDMTLSRLISLSWEDPRLSWDPRNYDNLRSIRLSPKRVWLPDIALSNNNDGNFDFGLYVHVLVDYTGAVRWVPPSIYRSSCGMQVKYFPFDWQNCSMVFQSFTYDTSEINLEYALDEHRQEIRHIIIDESTFPVSGEWQIKHKPSRKNTNPR---DPLYQDITFYLIMERKPLFYIINIVVPCILITICAVFTFYLPPDAGEKMGLCISVLLALTVFLLLLADKVPETSLGVPVIVNYLMFTMVIVTACVILTVIVLNLHFRSPATHIMPYWVRRIFIH 345          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Nematostella
Match: EDO47969 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RKU6])

HSP 1 Score: 229.565 bits (584), Expect = 3.271e-68
Identity = 122/335 (36.42%), Postives = 201/335 (60.00%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYAD-------ERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRV---PSWLKKVIVKIGCVLL 1540
            E+RLI+DLL  Y +     RPV +S  T+ V + +E++QI++++ +NQ++  NVW R +W +ELL W P+NY  V  VR+ +  +W PDIVLY+ AD       E+ K H    +++   G   W  PA F+S+CKID+T FPFD+Q C++KFGSWTY  + +DIQ   + + V    Y +S EW +++    R  + Y CC EP  D+T  + +RR P F+ + L+ PC+++ ++ L+ F+LPPES  ++ L + + +A  + L L+A++ P  S S+P +G +Y   M  I +S   +  V+N++ R    + V   P W+  ++++   V+L
Sbjct:    1 EQRLISDLLQGYSRNA---RPVLNSNHTLKVFFGMEIVQIVNVENRNQIIQTNVWIRQRWDNELLTWHPSNYEGVQTVRLDAKSVWIPDIVLYDSADSVFSGGHEKYKTH----VIISKDGSSAWFSPASFRSTCKIDVTYFPFDEQTCYMKFGSWTYTIADVDIQ--ASPAPVKSSKYLKSAEWDLMSATTSRKSQIYACCPEPISDVTIAMTIRRKPLFYAFNLITPCMIMLTMILLGFFLPPESGERITLSITVLLAMAVFLQLVAETLPRNSESIPLLGRFYITIMTEIAVSLMATCWVLNIHHRNSGTTLVVEMPKWVDVIVLRWLAVVL 326          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Nematostella
Match: EDO40862 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S622])

HSP 1 Score: 214.927 bits (546), Expect = 2.730e-63
Identity = 117/301 (38.87%), Postives = 188/301 (62.46%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLK--EHR-NVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVIN 1459
            E+RL+ DL  +Y K     RP  +S    +V +  +L QI+DL +  Q+L I ++   +W + +L WDP +Y  V ++ V   E+W PDIV+YN A++ L    H+    +V+ + G  +W+ PA+F ++C++D+  FPFD+Q C LKFGSWT+D S+LD++   N S  + ++YTE  EWQ+V     RN K+Y CC +PY DI++ + +RR   F++  L+LP +L++S+ LV F LPPES  +M LG+ + +A  + L  +  + PS S S P +G +Y + M LI++S  C+ I++N
Sbjct:    1 EQRLLRDLFQNYSK---YARPSIESDAPAIVTFRAKLKQIVDLKDNEQLLKIILYNYMQWENPILTWDPRDYGGVQEINVAPEEVWVPDIVIYNSAEDVLGGLTHKYKTDVVIQANGTNIWLAPAMFLTTCQLDVRYFPFDEQKCLLKFGSWTHDSSRLDMRTQTNGS--NKDIYTEHGEWQLVGVEQKRNVKYYDCCPKPYVDISYTVHIRRKSLFYSLYLILPALLITSMVLVGFHLPPESGERMQLGITVLLAMIVFLQFVYQNLPSTSDSAPLLGKFYIVMMFLISLSLGCTCIILN 296          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Nematostella
Match: EDO42054 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S2J7])

HSP 1 Score: 219.164 bits (557), Expect = 7.249e-63
Identity = 120/336 (35.71%), Postives = 200/336 (59.52%), Query Frame = 2
Query:  521 NQTGNCQRDGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLK---EHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            +++   +R     + EKRL+ DL  +Y       RPV +    V V +SL LIQI+ ++ K+Q++T++VW R KW + +L W+ + Y  +  V +   ++W PDI+LYN ADE      E     ++  S G   W  PA F S+C I++  FPFD Q C LKFGSWTY G++L +   ++ +++S   Y  + EW ++A P   N  FY CC  P+ D+T +L ++R P ++ + L++PC L+++LTL+ F+LPPES  K+ LG+ + +A  + LLL+A++ PS S  +P +G Y+   M +  +S   + +++N + R  + S +P W+K +I+
Sbjct:   23 SESSRKRRGASRETAEKRLLADLFRNYDSEV---RPVFNDSDKVNVEFSLSLIQIIAVNSKSQLVTVSVWIRQKWTNPMLAWNTSKYGGIESVNLNPAKVWIPDIILYNNADETYAGGLEKYKTSVIASSDGTQEWNSPASFTSTCNINVRYFPFDSQNCSLKFGSWTYVGNRLTMTSTSDSADLS--KYVNNGEWHLLAMPAKLNRVFYNCCKYPFYDVTLYLEIQRKPLYYVFNLIIPCALIATLTLIKFFLPPESGEKVGLGITVLLAMTVFLLLVAETLPSTSDHIPLLGQYFVATMFVTAISLVATCLILNFFHRNPSTSPMPHWVKVIIL 353          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Nematostella
Match: EDO44896 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RUG1])

HSP 1 Score: 220.32 bits (560), Expect = 7.310e-63
Identity = 118/320 (36.88%), Postives = 192/320 (60.00%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQT-VVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLK---EHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFR--GDNKSRVPSWLK 1507
            E  L+ DLL  Y K      PV    +T  +V + LEL+Q++++D+KNQ++T NVW R +W + LLKWDP  Y  +++VR+ +++IW PDIVLYN AD       E     ++++  G   W  PA F+S+C+ID+T FPFDQQ C +KFGSWT++   LDI    ++S +    Y +S EW ++A    RN ++Y CC  P+ D+T     RR P F+ + L++PC++++ + L+ F LPPES  ++ L + + +A  + L L A++ P  S +VP +G +Y   M+ + +S   +  V++++ +  G     VP W++
Sbjct:   12 EHTLLGDLLKGYNKDA---HPVPILNKTQYMVTFGLELVQLVNVDDKNQIITTNVWVRQRWTNLLLKWDPDKYGGITRVRIDASKIWIPDIVLYNSADSEFSGGLEKYKTRVILNHDGVNAWYSPASFRSTCQIDVTFFPFDQQTCFMKFGSWTFEVVDLDI--FADKSPLHSSQYMKSAEWDLIAASKKRNVEYYACCTYPFSDVTVTWVFRRKPLFYVFNLIVPCLIITGMVLLGFMLPPESGERITLSITVLLAMAVFLQLAAENLPRNSDNVPVLGIFYITVMVEVALSLIATCYVLHIHHKNSGIAVVPVPHWVQ 326          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Nematostella
Match: EDO32052 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SW62])

HSP 1 Score: 210.69 bits (535), Expect = 7.188e-62
Identity = 112/282 (39.72%), Postives = 170/282 (60.28%), Query Frame = 2
Query:  620 GRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYAD---ERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVI 1456
             RPV      VVV+  L L QI+D+DEKNQ+LT NVW R  W D LL W+P ++  V  + V  N +W PDI+LYN  D   E L +  +  +++ S G   W+ PAI K+ CK+D+  FPFD Q C LKFGSWT+DG ++DIQ L   + V ++ Y+E+ EW +   PG R+ K Y CC EPYP +TF L +RR   F+ Y ++LP  +++ L+L  F+LPP S  ++   + + ++  + ++++ ++ P  S  VP +  ++  +MI I  S   + +VI
Sbjct:    9 ARPVLHVKDPVVVKMGLMLKQIIDVDEKNQILTTNVWIRLYWKDHLLNWNPEDFGGVKSINVEPNNVWKPDILLYNPTDLRVESLYKKIDTKVILSSDGSAAWLSPAIIKTECKVDVRLFPFDVQYCDLKFGSWTHDGLKIDIQ-LRKTTGVDIDDYSENREWFLKDAPGRRDVKLYNCCPEPYPTVTFTLVIRRRAMFYVYNMVLPTGMIALLSLFSFYLPPNSGERVSFVITVLLSMSVYMIMVTENMPQ-SADVPLVSKFFMASMIQIAFSLAATCVVI 288          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Medaka
Match: ENSORLT00000038695.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 260.381 bits (664), Expect = 1.056e-76
Identity = 135/319 (42.32%), Postives = 207/319 (64.89%), Query Frame = 2
Query:  563 DEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            +++RL +DL+++Y     + RPV +  Q++ V + L L+QI+D+DEKNQVLT N+W R  W D  L+W+ ++Y  V+ VR P + IW PDI+LYN ADER     +  I+V+S+G   ++PP IFKS+C ID+  FPFD Q C LKFGSWTY G  LD++ L    E  +  Y  + EW +V  PG RNE+FY CCDEPY DITF + +RR   ++   LLLPCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   M+++ +S   +V+V+  +    +  ++P W + +++
Sbjct:   49 NQRRLYSDLMSTYNP---LERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKML----EADVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILL 360          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Medaka
Match: ENSORLT00000046008.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 259.996 bits (663), Expect = 1.176e-76
Identity = 135/319 (42.32%), Postives = 207/319 (64.89%), Query Frame = 2
Query:  563 DEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            +++RL +DL+++Y     + RPV +  Q++ V + L L+QI+D+DEKNQVLT N+W R  W D  L+W+ ++Y  V+ VR P + IW PDI+LYN ADER     +  I+V+S+G   ++PP IFKS+C ID+  FPFD Q C LKFGSWTY G  LD++ L    E  +  Y  + EW +V  PG RNE+FY CCDEPY DITF + +RR   ++   LLLPCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   M+++ +S   +V+V+  +    +  ++P W + +++
Sbjct:   46 NQRRLYSDLMSTYNP---LERPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKML----EADVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILL 357          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Medaka
Match: ENSORLT00000033785.1 (neuronal acetylcholine receptor subunit alpha-7-like [Source:NCBI gene;Acc:101166204])

HSP 1 Score: 253.447 bits (646), Expect = 1.006e-74
Identity = 130/299 (43.48%), Postives = 194/299 (64.88%), Query Frame = 2
Query:  623 RPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIV 1519
            RPV +  Q++ V + L L+QI+D+DEKNQVLT N+W R  W D  L+W+ ++Y  V+ VR P + IW PDI+LYN ADER     +  I+V+S+G   ++PP IFKS+C ID+  FPFD Q C LKFGSWTY G  LD++ L    E  +  Y  + EW +V  PG RNE+FY CCDEPY DITF + +RR   ++   LLLPCVL+S+L L++F LP +S  K+ LG+ + ++  + +LL+A+  P+ S SVP I  Y+   M+++ +S   +V+V+  +    +  ++P W + +++
Sbjct:    9 RPVYNDSQSLTVHFGLSLLQIMDVDEKNQVLTTNIWLRLYWNDHYLQWNSSDYPGVTNVRFPDHLIWKPDILLYNSADERFDATFHTNILVNSSGTCSYLPPGIFKSTCYIDVRWFPFDVQRCELKFGSWTYGGWSLDLKML----EADVSGYIANGEWDLVEVPGQRNERFYECCDEPYLDITFTVVMRRRTLYYGLNLLLPCVLISTLALLVFLLPADSGEKISLGITVLLSLTVFMLLVAEIMPATSDSVPLIAEYFATTMVIVGLSVIATVLVLQYHHHDPDGGKMPKWTRVILL 303          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 252.677 bits (644), Expect = 7.948e-74
Identity = 135/320 (42.19%), Postives = 201/320 (62.81%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKI 1525
            E+ L   L   Y K     RPV +    V+V++ L + Q++D+DEKNQ++T NVW + +W D  L+W P++Y NV+ +RVPS  IW PDIVLYN AD            +  TG++ W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++ + N   V L  Y ES EW I+   G  N K Y CC E YPDIT+F  +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +  ++P W+  V + +
Sbjct:   44 EEELFQTLFTGYNKWS---RPVPNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIENT--VDLNNYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPRWVHTVFLDL 358          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Medaka
Match: chrna2b (neuronal acetylcholine receptor subunit alpha-2 [Source:NCBI gene;Acc:101155076])

HSP 1 Score: 252.677 bits (644), Expect = 7.948e-74
Identity = 135/320 (42.19%), Postives = 201/320 (62.81%), Query Frame = 2
Query:  566 EKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKI 1525
            E+ L   L   Y K     RPV +    V+V++ L + Q++D+DEKNQ++T NVW + +W D  L+W P++Y NV+ +RVPS  IW PDIVLYN AD            +  TG++ W+PPAI+KSSC ID+T FPFDQQ C +KFGSWTYD +++D++ + N   V L  Y ES EW I+   G  N K Y CC E YPDIT+F  +RR P F+T  L++PC+L+S LT+++F+LP +   K+ L +++ ++  + LLL+ +  PS S  +P IG Y    MI +T+S   +V V+N++ R  +  ++P W+  V + +
Sbjct:   44 EEELFQTLFTGYNKWS---RPVPNISDVVIVKFGLSIAQLIDVDEKNQMMTTNVWLKQEWNDYKLRWKPSDYDNVTSIRVPSELIWVPDIVLYNNADGEFAVTHMTKAHLFHTGKVRWVPPAIYKSSCSIDVTFFPFDQQNCKMKFGSWTYDKAKIDLERIENT--VDLNNYWESGEWAIINAVGTYNTKKYDCCHEIYPDITYFFIIRRLPLFYTINLIIPCLLISCLTVLVFYLPSDCGEKITLCISVLLSLTVFLLLITEIIPSTSLVIPLIGEYLLFTMIFVTLSIVITVFVLNVHHRSPSTHKMPRWVHTVFLDL 358          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Planmine SMEST
Match: SMESG000080892.1 (SMESG000080892.1)

HSP 1 Score: 555.058 bits (1429), Expect = 0.000e+0
Identity = 289/290 (99.66%), Postives = 289/290 (99.66%), Query Frame = 2
Query: 1412 MILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKKVGFKFGSDQNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVSNPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNTIEEVIRQNTPISVPKNKT 2281
            MILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSNIRENNEK RIIKSEIKYNRKFCKKVGFKFGSDQNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVSNPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNTIEEVIRQNTPISVPKNKT
Sbjct:    1 MILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSNIRENNEKSRIIKSEIKYNRKFCKKVGFKFGSDQNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVSNPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNTIEEVIRQNTPISVPKNKT 290          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Planmine SMEST
Match: SMESG000080892.1 (SMESG000080892.1)

HSP 1 Score: 545.814 bits (1405), Expect = 0.000e+0
Identity = 284/285 (99.65%), Postives = 284/285 (99.65%), Query Frame = 2
Query: 1427 MSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKKVGFKFGSDQNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVSNPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNTIEEVIRQNTPISVPKNKT 2281
            MSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSNIRENNEK RIIKSEIKYNRKFCKKVGFKFGSDQNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVSNPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNTIEEVIRQNTPISVPKNKT
Sbjct:    1 MSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSNIRENNEKSRIIKSEIKYNRKFCKKVGFKFGSDQNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVSNPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNTIEEVIRQNTPISVPKNKT 285          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 463.381 bits (1191), Expect = 1.340e-153
Identity = 271/574 (47.21%), Postives = 373/574 (64.98%), Query Frame = 2
Query:  545 DGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKKVGFKFGSD--QNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVS----NPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNTIEEVIRQ 2248
            D  S+S EK+LIT +L  YKK G +GRPV++   TVVV+Y L LIQI+ LDEKNQ+LT+NVWA+Y W+DE+L W+P N+SNV +VR+P ++IWTPDIVLYNYADERL E R+VM+ V+  G I+W+PPAIFKS+C IDI+NFPFD Q C+LKFGSWTY G +LDIQ   N SE+ +  YTESNEW I+ +P  R        +   PD+TFFL L+RN A+  YLL++PCVLLS LTLVIFWLPPESPAKM+LGMNIFVAF LLL LLA++TPSASTSVP++G+YYCLNMILIT+STF S+IVINLYFR D +  +P WL+K +     +L M       ++EK+ +IKSEIK +R   K+   K  ++  + +   I SP   H+  + K+   +   SGS          P+Q  N+    + Y+ ++ +     NP   Y+                   T   + +    N               +  IL     LE ++++IRK+++ LM ++A+ D  N+ A EWR VA+VLDR+FFW++   +I+SGL+LLLP+    ++++++ +
Sbjct:   15 DYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPI-SPRARHK--SSKMAMEMQNLSGSSSNYQTRFQYPRQ--NTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSSTTKKQTQQKKSN---------------QSAIL-----LEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEE 563          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 462.996 bits (1190), Expect = 1.770e-153
Identity = 271/574 (47.21%), Postives = 373/574 (64.98%), Query Frame = 2
Query:  545 DGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKKVGFKFGSD--QNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVS----NPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNTIEEVIRQ 2248
            D  S+S EK+LIT +L  YKK G +GRPV++   TVVV+Y L LIQI+ LDEKNQ+LT+NVWA+Y W+DE+L W+P N+SNV +VR+P ++IWTPDIVLYNYADERL E R+VM+ V+  G I+W+PPAIFKS+C IDI+NFPFD Q C+LKFGSWTY G +LDIQ   N SE+ +  YTESNEW I+ +P  R        +   PD+TFFL L+RN A+  YLL++PCVLLS LTLVIFWLPPESPAKM+LGMNIFVAF LLL LLA++TPSASTSVP++G+YYCLNMILIT+STF S+IVINLYFR D +  +P WL+K +     +L M       ++EK+ +IKSEIK +R   K+   K  ++  + +   I SP   H+  + K+   +   SGS          P+Q  N+    + Y+ ++ +     NP   Y+                   T   + +    N               +  IL     LE ++++IRK+++ LM ++A+ D  N+ A EWR VA+VLDR+FFW++   +I+SGL+LLLP+    ++++++ +
Sbjct:    8 DYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPI-SPRARHK--SSKMAMEMQNLSGSSSNYQTRFQYPRQ--NTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSSTTKKQTQQKKSN---------------QSAIL-----LEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEE 556          
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Planmine SMEST
Match: SMESG000069967.1 (SMESG000069967.1)

HSP 1 Score: 462.996 bits (1190), Expect = 2.811e-153
Identity = 271/574 (47.21%), Postives = 373/574 (64.98%), Query Frame = 2
Query:  545 DGFSLSDEKRLITDLLNSYKKAGIVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLKWDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEILWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSEVSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFTYXXXXXXXXXXXXXXXIFWLPPESPAKMVLGMNIFVAFFXXXXXXADSTPSASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKVIVKIGCVLLMDTSXXXXXXXXXXXXXSEIKYNRKFCKKVGFKFGSD--QNLNRSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLKYSVNNKVS----NPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINANNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRASEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNTIEEVIRQ 2248
            D  S+S EK+LIT +L  YKK G +GRPV++   TVVV+Y L LIQI+ LDEKNQ+LT+NVWA+Y W+DE+L W+P N+SNV +VR+P ++IWTPDIVLYNYADERL E R+VM+ V+  G I+W+PPAIFKS+C IDI+NFPFD Q C+LKFGSWTY G +LDIQ   N SE+ +  YTESNEW I+ +P  R        +   PD+TFFL L+RN A+  YLL++PCVLLS LTLVIFWLPPESPAKM+LGMNIFVAF LLL LLA++TPSASTSVP++G+YYCLNMILIT+STF S+IVINLYFR D +  +P WL+K +     +L M       ++EK+ +IKSEIK +R   K+   K  ++  + +   I SP   H+  + K+   +   SGS          P+Q  N+    + Y+ ++ +     NP   Y+                   T   + +    N               +  IL     LE ++++IRK+++ LM ++A+ D  N+ A EWR VA+VLDR+FFW++   +I+SGL+LLLP+    ++++++ +
Sbjct:   22 DYASMSGEKKLITKMLKDYKKKGKIGRPVRNVQDTVVVKYGLALIQIMSLDEKNQILTVNVWAKYTWVDEMLIWNPKNFSNVEEVRMPPDKIWTPDIVLYNYADERLIEKRDVMVSVNYIGRIIWMPPAIFKSTCGIDISNFPFDFQSCYLKFGSWTYKGDKLDIQLYENFSEIDIIDYTESNEWLILHKPARRFVLKNMKDNTSQPDLTFFLILKRNSAYHAYLLVVPCVLLSLLTLVIFWLPPESPAKMILGMNIFVAFSLLLRLLAETTPSASTSVPFLGYYYCLNMILITLSTFLSIIVINLYFRCDKRRNLPDWLRKGVNATSKILGMKQVISSASSEKLHLIKSEIKNSRNHIKRQQEKETTESRETIPTPI-SPRARHK--SSKMAMEMQNLSGSSSNYQTRFQYPRQ--NTDVTDIPYTAHSDIPRNSFNPGYSYEYRYSNAPPPAAPASPLPSSTTKKQTQQKKSN---------------QSAIL-----LEKNLSEIRKALKNLMTKIAEKDRGNRIAKEWRMVAMVLDRLFFWVYFVIVILSGLILLLPRGLPKSMDQILEE 570          
The following BLAST results are available for this feature:
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA22.923e-7441.12cholinergic receptor nicotinic alpha 2 subunit [So... [more]
CHRNA21.309e-7341.12cholinergic receptor nicotinic alpha 2 subunit [So... [more]
CHRNA71.368e-7341.19cholinergic receptor nicotinic alpha 7 subunit [So... [more]
AC243734.11.368e-7341.19cholinergic receptor nicotinic alpha 7 subunit [So... [more]
CHRNA75.261e-7341.19cholinergic receptor nicotinic alpha 7 subunit [So... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
acr-162.188e-7139.94Acetylcholine receptor subunit alpha-type acr-16 ... [more]
acr-114.583e-6735.19AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
unc-381.386e-6439.47Acetylcholine receptor subunit alpha-type unc-38 ... [more]
acr-92.836e-6437.61AcetylCholine Receptor [Source:UniProtKB/TrEMBL;A... [more]
unc-633.208e-6438.48Acetylcholine receptor subunit alpha-type unc-63 ... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
nAChRalpha27.204e-8138.82gene:FBgn0000039 transcript:FBtr0084639[more]
nAChRalpha27.204e-8138.82gene:FBgn0000039 transcript:FBtr0084640[more]
nAChRalpha17.482e-7440.84gene:FBgn0000036 transcript:FBtr0334916[more]
nAChRalpha17.482e-7440.84gene:FBgn0000036 transcript:FBtr0084619[more]
nAChRalpha41.978e-7341.10gene:FBgn0266347 transcript:FBtr0332872[more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna2b2.130e-7540.64cholinergic receptor, nicotinic, alpha 2b (neurona... [more]
FO907089.19.608e-7541.19neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna74.266e-7440.88cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
chrna79.110e-7440.88cholinergic receptor, nicotinic, alpha 7 (neuronal... [more]
chrna2a4.460e-7339.88cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
CHRNA24.102e-7442.45cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
CHRNA27.376e-7442.45cholinergic receptor, nicotinic alpha 2 [Source:NC... [more]
mppe11.059e-7239.94metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
mppe11.275e-7239.94metallophosphoesterase 1 [Source:Xenbase;Acc:XB-GE... [more]
CHRNA91.292e-7237.56cholinergic receptor, nicotinic alpha 9 [Source:NC... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Chrna25.303e-7539.71cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna25.303e-7539.71cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna104.228e-7442.27cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna76.780e-7441.19cholinergic receptor, nicotinic, alpha polypeptide... [more]
Chrna36.386e-7340.00cholinergic receptor, nicotinic, alpha polypeptide... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P17644|ACH2_DROME7.222e-8038.82Acetylcholine receptor subunit alpha-like 2 OS=Dro... [more]
sp|P23414|ACH1_SCHGR8.069e-8042.09Acetylcholine receptor subunit alpha-L1 OS=Schisto... [more]
sp|P12389|ACHA2_RAT3.653e-7439.89Neuronal acetylcholine receptor subunit alpha-2 OS... [more]
sp|Q91X60|ACHA2_MOUSE3.709e-7439.71Neuronal acetylcholine receptor subunit alpha-2 OS... [more]
sp|Q866A2|ACHA7_MACMU5.517e-7441.82Neuronal acetylcholine receptor subunit alpha-7 OS... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1I8H6338.518e-17853.53Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8H2846.613e-17653.51Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A1I8G3D52.351e-15868.70Uncharacterized protein OS=Macrostomum lignano OX=... [more]
A0A267GKY07.686e-15868.02Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
A0A267GIR59.126e-15868.02Uncharacterized protein (Fragment) OS=Macrostomum ... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna2a6.762e-7642.77cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrna73.646e-7542.14neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna76.494e-7542.14neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSAMXT00000053066.14.785e-7442.47neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna2b7.167e-7442.19neuronal acetylcholine receptor subunit alpha-2 [S... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
chrna34.997e-7037.97cholinergic receptor, nicotinic, alpha 3 [Source:Z... [more]
chrna2a1.517e-6543.75cholinergic receptor, nicotinic, alpha 2a (neurona... [more]
chrnb3b1.012e-6237.96cholinergic receptor, nicotinic, beta 3b (neuronal... [more]
ENSPMAT00000008550.15.870e-5240.32pep scaffold:Pmarinus_7.0:GL476601:34:38373:1 gene... [more]
chrnb1l2.008e-4732.14cholinergic receptor, nicotinic, beta 1 (muscle) l... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO479693.271e-6836.42Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO408622.730e-6338.87Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO420547.249e-6335.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO448967.310e-6336.88Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO320527.188e-6239.72Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ENSORLT00000038695.11.056e-7642.32neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000046008.11.176e-7642.32neuronal acetylcholine receptor subunit alpha-7-li... [more]
ENSORLT00000033785.11.006e-7443.48neuronal acetylcholine receptor subunit alpha-7-li... [more]
chrna2b7.948e-7442.19neuronal acetylcholine receptor subunit alpha-2 [S... [more]
chrna2b7.948e-7442.19neuronal acetylcholine receptor subunit alpha-2 [S... [more]
back to top
BLAST of Neuronal acetylcholine receptor subunit alpha-7 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000080892.10.000e+099.66SMESG000080892.1[more]
SMESG000080892.10.000e+099.65SMESG000080892.1[more]
SMESG000069967.11.340e-15347.21SMESG000069967.1[more]
SMESG000069967.11.770e-15347.21SMESG000069967.1[more]
SMESG000069967.12.811e-15347.21SMESG000069967.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023488 ID=SMED30023488|Name=Neuronal acetylcholine receptor subunit alpha-7|organism=Schmidtea mediterranea sexual|type=transcript|length=2642bp
ATTTTCTCCGGGATTTTCATAGACAAACTAGCATTATTATCAAAGACACA
TTGGAGATTTCACATAGGCTTATGACTGGTGAAACGTGTGTTCATCTATC
TTCGAGCTAATGTAAAGTACATATTCTCTTTTTTTTGAGTAGGAAATAAC
TTCTAGCGATTTATTTTATTCTATAATCCTGCTTGTGAAACAGATAAATC
GCGTCTGTGACATAGTACGTCCTTGAATCAATTACTAAAACGTAGAGACA
ATGATAAAATTATCATTATTATTAATAAAATTATTATTATTATCTTCATC
ATATTCAAATTCCAAACAACTGTTTTATTCCAATCCAGAGTTCAATTGAA
AATAATAAAGCCGTTTGGAGAATTTTTATATATTTATTTATTTATATTTC
CTGTGAAATTCGTCAACATTGATCAGAATATTATAATCAGCTCATTCGGA
TCGTCGTGATGCTATGAAATTTGTTGTATTTTATTTAAACAATTTTATCT
TTCTTTCTACCGTTTTACCTAACCAAACCGGCAACTGCCAAAGAGATGGA
TTTAGTTTGTCCGATGAAAAAAGGTTGATCACCGATCTGCTGAACAGTTA
CAAAAAAGCTGGAATAGTTGGCCGACCAGTCAAAGACAGCTTTCAGACCG
TTGTAGTTAGATATAGTTTGGAACTCATTCAAATTCTTGATCTAGATGAG
AAAAACCAAGTTCTTACCATTAATGTTTGGGCACGTTATAAATGGATGGA
TGAATTACTGAAATGGGATCCTGCAAATTATTCAAATGTTTCAAAAGTCA
GAGTTCCATCAAATGAAATATGGACGCCAGATATTGTTCTTTATAATTAT
GCCGATGAAAGATTGAAAGAACATCGAAATGTGATGATTGTTGTAGATTC
AACTGGTGAAATTTTATGGATACCCCCCGCTATTTTCAAAAGTAGTTGTA
AAATAGATATCACAAATTTCCCTTTTGACCAACAAGGATGTCACTTGAAA
TTTGGCTCATGGACATATGATGGTAGTCAACTGGACATTCAGTTCCTTAA
CAATCAGTCTGAAGTAAGCCTCGAAGTGTACACAGAAAGCAATGAATGGC
AAATTGTAGCTCGACCGGGGATTCGAAATGAAAAATTTTATCCATGCTGT
GATGAACCGTATCCGGATATTACTTTTTTTTTGTTTCTAAGAAGAAATCC
GGCGTTTTTCACTTATCTTCTTCTATTACCTTGTGTCCTTCTATCCAGCT
TGACGCTGGTCATATTTTGGCTTCCACCAGAATCTCCAGCAAAAATGGTT
TTGGGAATGAATATATTTGTAGCATTCTTCCTTTTGCTATTACTATTGGC
TGATTCAACACCATCCGCATCTACAAGTGTTCCATATATTGGTTTTTATT
ACTGTCTCAATATGATATTGATTACGATGTCAACCTTTTGCTCAGTGATA
GTCATTAATTTATATTTTCGTGGTGACAATAAAAGCAGAGTACCATCTTG
GTTAAAAAAAGTGATTGTAAAAATCGGTTGTGTTTTATTGATGGACACTT
CTAACATTCGAGAAAACAATGAAAAAATCAGAATAATCAAATCGGAGATC
AAGTACAACAGAAAGTTTTGTAAAAAAGTTGGATTTAAATTCGGATCAGA
TCAGAATCTTAATAGATCAATTGACAGTCCGGACGTTGGTCATCAAATGA
TTAATAAAAAACTAGACAACTCCGTAAATTATGCCTCAGGTTCAGGAGAA
ATCAATACACAATTTCTCAATTCTCCAAAACAGGAAAATAATTCTCGAAG
AAACTCTTTGAAATATTCTGTAAATAATAAAGTATCGAATCCTTACCTGT
TTTACGATACGAACAACAAGGTTGGAAGCATAAAATATTGTCTTGAAGAC
AATAAAATTATAATAACTCAAGCCGACGAAAATGAAGGAAATTATGGAAA
TCACATCAACGCTAACAATGTCTCTTCGAATATAACTCCTCAATTAGAAA
GAACAATTTTGAAATTCTCTCAAACATTGGAAAACGACGTAGCGGACATT
CGGAAAAGCATCAGAACTCTGATGAACCGGATGGCCGATATTGACAATGC
CAACAAACGAGCCAGTGAGTGGCGGACTGTGGCTTTGGTTCTAGATCGGA
TCTTTTTCTGGATGTTTCTCAGTACAATTATCGTGTCTGGCTTGGTTCTT
TTGCTGCCGAAAAATCCCAGCAACACCATTGAAGAGGTCATCAGACAAAA
CACACCGATCAGTGTTCCGAAAAATAAAACATAAATTACAGAAAACTCGA
CTCAGGTTTGCGTGCCAAAGAAAATCATGTAGAATTGTTAGATGCGGCCA
CCATTAGTGCATTTAACTCAAGAGCCTAGAAGTACTAGAATTTTTCTACA
TATTTCACATTTTTTATTAGAATCCTTTGAAATTATGATCTATTTAGAAA
CGTCTTCAAACGAAAAATAAAAACACATTTTGCTCATTATTATGCGGTTG
TGAAAATTTGTACAATTTTCCTGGTTGTGATTGTAGATTTAGACGGATAA
AACTTGCATAATTTTATTAGATTAAATGTTTTCTTTTGTAATTGTACATT
TGATTTCTTTTTTAACCAATGTAATTTGTTACTTCCGGTCCG
back to top

protein sequence of SMED30023488-orf-1

>SMED30023488-orf-1 ID=SMED30023488-orf-1|Name=SMED30023488-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=607bp
MKFVVFYLNNFIFLSTVLPNQTGNCQRDGFSLSDEKRLITDLLNSYKKAG
IVGRPVKDSFQTVVVRYSLELIQILDLDEKNQVLTINVWARYKWMDELLK
WDPANYSNVSKVRVPSNEIWTPDIVLYNYADERLKEHRNVMIVVDSTGEI
LWIPPAIFKSSCKIDITNFPFDQQGCHLKFGSWTYDGSQLDIQFLNNQSE
VSLEVYTESNEWQIVARPGIRNEKFYPCCDEPYPDITFFLFLRRNPAFFT
YLLLLPCVLLSSLTLVIFWLPPESPAKMVLGMNIFVAFFLLLLLLADSTP
SASTSVPYIGFYYCLNMILITMSTFCSVIVINLYFRGDNKSRVPSWLKKV
IVKIGCVLLMDTSNIRENNEKIRIIKSEIKYNRKFCKKVGFKFGSDQNLN
RSIDSPDVGHQMINKKLDNSVNYASGSGEINTQFLNSPKQENNSRRNSLK
YSVNNKVSNPYLFYDTNNKVGSIKYCLEDNKIIITQADENEGNYGNHINA
NNVSSNITPQLERTILKFSQTLENDVADIRKSIRTLMNRMADIDNANKRA
SEWRTVALVLDRIFFWMFLSTIIVSGLVLLLPKNPSNTIEEVIRQNTPIS
VPKNKT*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0004888transmembrane signaling receptor activity
GO:0004889acetylcholine-activated cation-selective channel activity
GO:0005216ion channel activity
GO:0005230extracellular ligand-gated ion channel activity
GO:0022848acetylcholine-gated cation-selective channel activity
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR036734Neur_chan_lig-bd_sf
IPR036719Neuro-gated_channel_TM_sf
IPR006201Neur_channel
IPR002394Nicotinic_acetylcholine_rcpt
IPR027361Acetylcholine_rcpt_TM
IPR006202Neur_chan_lig-bd
IPR006029Neurotrans-gated_channel_TM
IPR018000Neurotransmitter_ion_chnl_CS
Vocabulary: biological process
TermDefinition
GO:0006811ion transport
GO:0006810transport
GO:0034220ion transmembrane transport
GO:0060078regulation of postsynaptic membrane potential
GO:0060079excitatory postsynaptic potential
Vocabulary: cellular component
TermDefinition
GO:0016021integral component of membrane
GO:0045211postsynaptic membrane
GO:0016020membrane
GO:0005886plasma membrane
GO:0030054cell junction
GO:0045202synapse
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 519..539
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 250..380
e-value: 1.4E-29
score: 104.9
NoneNo IPR availableGENE3DG3DSA:1.20.58.390coord: 513..590
e-value: 1.6E-6
score: 29.9
NoneNo IPR availablePANTHERPTHR18945:SF757NEURONAL ACETYLCHOLINE RECEPTOR SUBUNIT ALPHA-2coord: 33..584
NoneNo IPR availableCDDcd19033LGIC_ECD_nAChR_proto-likecoord: 63..245
e-value: 1.04938E-117
score: 345.425
NoneNo IPR availableCDDcd19051LGIC_TM_cationcoord: 264..360
e-value: 3.82971E-24
score: 95.5072
NoneNo IPR availableSIGNALP_EUKSignalP-noTMSignalP-noTMcoord: 1..19
score: 0.552
NoneNo IPR availableTMHMMTMhelixcoord: 311..333
NoneNo IPR availableTMHMMTMhelixcoord: 248..270
NoneNo IPR availableTMHMMTMhelixcoord: 558..580
NoneNo IPR availableTMHMMTMhelixcoord: 279..296
IPR006201Neurotransmitter-gated ion-channelPRINTSPR00252NRIONCHANNELcoord: 85..101
score: 38.28
coord: 118..129
score: 50.6
coord: 162..176
score: 51.61
coord: 240..252
score: 28.89
IPR006201Neurotransmitter-gated ion-channelTIGRFAMTIGR00860TIGR00860coord: 28..580
e-value: 2.3E-85
score: 285.0
IPR006201Neurotransmitter-gated ion-channelPANTHERPTHR18945NEUROTRANSMITTER GATED ION CHANNELcoord: 33..584
IPR002394Nicotinic acetylcholine receptorPRINTSPR00254NICOTINICRcoord: 142..160
score: 50.35
coord: 72..88
score: 46.54
coord: 106..120
score: 40.52
coord: 124..136
score: 45.81
IPR006202Neurotransmitter-gated ion-channel ligand-binding domainPFAMPF02931Neur_chan_LBDcoord: 35..246
e-value: 1.7E-68
score: 230.3
IPR006029Neurotransmitter-gated ion-channel transmembrane domainPFAMPF02932Neur_chan_membcoord: 253..579
e-value: 6.3E-35
score: 121.4
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilyGENE3DG3DSA:2.70.170.10coord: 32..249
e-value: 2.5E-82
score: 277.5
IPR036734Neurotransmitter-gated ion-channel ligand-binding domain superfamilySUPERFAMILYSSF63712Nicotinic receptor ligand binding domain-likecoord: 34..246
IPR018000Neurotransmitter-gated ion-channel, conserved sitePROSITEPS00236NEUROTR_ION_CHANNELcoord: 162..176
IPR036719Neurotransmitter-gated ion-channel transmembrane domain superfamilySUPERFAMILYSSF90112Neurotransmitter-gated ion-channel transmembrane porecoord: 246..581