Protein LSM14 homolog B-A

Overview
NameProtein LSM14 homolog B-A
Smed IDSMED30023487
Length (bp)1926
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein LSM14 homolog B-A (SMED30023487) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein LSM14 homolog B-A (SMED30023487) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein LSM14 homolog B-A (SMED30023487) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein LSM14 homolog B-A (SMED30023487) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023487

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 13

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023487SMESG000014632.1 Contig1943GPL15192PMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30023487SMESG000014632.1 dd_Smed_v4_1125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023487SMESG000014632.1 dd_Smed_v4_1125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023487SMESG000014632.1 dd_Smed_v4_1125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023487SMESG000014632.1 dd_Smed_v4_1125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023487SMESG000014632.1 dd_Smed_v4_1125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023487SMESG000014632.1 dd_Smed_v4_1125_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023487SMESG000014632.1 Contig43709uc_Smed_v2PMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023487SMESG000014632.1 Contig43709newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
Smed sexual biotypeSMED30023487SMESG000014632.1 Contig32785newmark_estsPMID:29674431
Fincher et al., 2018
FACS sorted cell population adult hermaphrodite single-cell RNA-sequencing evidence
neoblastSMED30023487SMESG000014632.1 dd_Smed_v6_1125_0dd_Smed_v6PMID:29674432
Plass et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023487SMESG000014632.1 dd_Smed_v4_1125_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30023487SMESG000014632.1 dd_Smed_v4_1125_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein LSM14 homolog B-A vs. Ensembl Human
Match: LSM14A (LSM14A mRNA processing body assembly factor [Source:HGNC Symbol;Acc:HGNC:24489])

HSP 1 Score: 134.806 bits (338), Expect = 6.296e-37
Identity = 66/95 (69.47%), Postives = 76/95 (80.00%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETS 393
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AIV++  S
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSRWS 99          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Human
Match: LSM14A (LSM14A mRNA processing body assembly factor [Source:HGNC Symbol;Acc:HGNC:24489])

HSP 1 Score: 134.806 bits (338), Expect = 6.296e-37
Identity = 66/95 (69.47%), Postives = 76/95 (80.00%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETS 393
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AIV++  S
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSRWS 99          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Human
Match: LSM14B (LSM family member 14B [Source:HGNC Symbol;Acc:HGNC:15887])

HSP 1 Score: 134.806 bits (338), Expect = 2.342e-35
Identity = 63/92 (68.48%), Postives = 74/92 (80.43%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRA 384
            + ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR  PPR+EIYEYIIFRGSDI+D+ VCEP K    L +D AIV++
Sbjct:    7 TPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQS 98          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Human
Match: LSM14A (LSM14A mRNA processing body assembly factor [Source:HGNC Symbol;Acc:HGNC:24489])

HSP 1 Score: 137.117 bits (344), Expect = 2.980e-35
Identity = 65/89 (73.03%), Postives = 73/89 (82.02%), Query Frame = 1
Query:  115 FIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVR 381
            +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AIV+
Sbjct:    2 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 90          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Human
Match: LSM14A (LSM14A mRNA processing body assembly factor [Source:HGNC Symbol;Acc:HGNC:24489])

HSP 1 Score: 136.732 bits (343), Expect = 7.250e-35
Identity = 65/89 (73.03%), Postives = 73/89 (82.02%), Query Frame = 1
Query:  115 FIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVR 381
            +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AIV+
Sbjct:    2 YIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 90          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Celegans
Match: car-1 (Cytokinesis, Apoptosis, RNA-associated [Source:UniProtKB/TrEMBL;Acc:Q9XW17])

HSP 1 Score: 106.686 bits (265), Expect = 5.949e-25
Identity = 51/94 (54.26%), Postives = 68/94 (72.34%), Query Frame = 1
Query:  106 MSSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSL---LSEDSAIV 378
             + +IG KISLISK  IRYEGILYT+D  +ST+AL+KV+SFGTE R     +  RD++YEYIIF+ SDI+DL VC+  K +++   L  D AI+
Sbjct:    4 QTPYIGSKISLISKLDIRYEGILYTVDTNDSTIALAKVRSFGTEKRPTANPVAARDDVYEYIIFKASDIKDLIVCDTPKMANIGGGLPYDPAII 97          

HSP 2 Score: 54.299 bits (129), Expect = 1.232e-7
Identity = 33/95 (34.74%), Postives = 53/95 (55.79%), Query Frame = 1
Query: 1084 FKEDYDFETANA----IIAKELAALHVSQXXXXXXXXXXXXXXGQLSDNSEAGYYDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFG 1356
            F+ D+DFE AN     ++   L  L++  + +            ++ +  +A +YDK  SFFDNIS E +++A GK+ R  + K+ER+ N ETFG
Sbjct:  186 FESDFDFEKANEKFQEVLVDNLEKLNIEDKAEP-----------EVEEKKDAAFYDKKTSFFDNISCESLEKAEGKTGRP-DWKKERETNQETFG 268          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332638)

HSP 1 Score: 105.916 bits (263), Expect = 1.786e-23
Identity = 57/111 (51.35%), Postives = 74/111 (66.67%), Query Frame = 1
Query:  118 IGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGV-----MSSGM 435
            +G KISLISKA IRYEG LYT+DP+E T+ALS V+SFGTEDR     I P+ +IY+YI+FRGSDI+D+ V   +  +     D AI++A+     N PP +     M SGM
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVV--NNHTLPHHNDPAIMQAQLQ---NGPPQMPQHFPMPSGM 113          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332640)

HSP 1 Score: 105.916 bits (263), Expect = 1.856e-23
Identity = 57/111 (51.35%), Postives = 74/111 (66.67%), Query Frame = 1
Query:  118 IGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGV-----MSSGM 435
            +G KISLISKA IRYEG LYT+DP+E T+ALS V+SFGTEDR     I P+ +IY+YI+FRGSDI+D+ V   +  +     D AI++A+     N PP +     M SGM
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVV--NNHTLPHHNDPAIMQAQLQ---NGPPQMPQHFPMPSGM 113          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332639)

HSP 1 Score: 105.916 bits (263), Expect = 2.048e-23
Identity = 57/111 (51.35%), Postives = 74/111 (66.67%), Query Frame = 1
Query:  118 IGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGV-----MSSGM 435
            +G KISLISKA IRYEG LYT+DP+E T+ALS V+SFGTEDR     I P+ +IY+YI+FRGSDI+D+ V   +  +     D AI++A+     N PP +     M SGM
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVV--NNHTLPHHNDPAIMQAQLQ---NGPPQMPQHFPMPSGM 113          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0332635)

HSP 1 Score: 105.916 bits (263), Expect = 2.060e-23
Identity = 57/111 (51.35%), Postives = 74/111 (66.67%), Query Frame = 1
Query:  118 IGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGV-----MSSGM 435
            +G KISLISKA IRYEG LYT+DP+E T+ALS V+SFGTEDR     I P+ +IY+YI+FRGSDI+D+ V   +  +     D AI++A+     N PP +     M SGM
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVV--NNHTLPHHNDPAIMQAQLQ---NGPPQMPQHFPMPSGM 113          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Fly
Match: tral (gene:FBgn0041775 transcript:FBtr0075959)

HSP 1 Score: 105.916 bits (263), Expect = 2.060e-23
Identity = 57/111 (51.35%), Postives = 74/111 (66.67%), Query Frame = 1
Query:  118 IGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGV-----MSSGM 435
            +G KISLISKA IRYEG LYT+DP+E T+ALS V+SFGTEDR     I P+ +IY+YI+FRGSDI+D+ V   +  +     D AI++A+     N PP +     M SGM
Sbjct:    8 LGSKISLISKADIRYEGRLYTVDPQECTIALSSVRSFGTEDRDTQFQIAPQSQIYDYILFRGSDIKDIRVV--NNHTLPHHNDPAIMQAQLQ---NGPPQMPQHFPMPSGM 113          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Zebrafish
Match: lsm14aa (LSM14A mRNA processing body assembly factor a [Source:ZFIN;Acc:ZDB-GENE-040426-1567])

HSP 1 Score: 136.732 bits (343), Expect = 7.935e-36
Identity = 69/108 (63.89%), Postives = 79/108 (73.15%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGVMSSG 432
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR I PRDE +EYIIFRGSDI+DL VCEP K +  L +D AIV++    S   PP    SG
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPTCSLPQDPAIVQSSLG-SSTAPPSSFQSG 111          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Zebrafish
Match: lsm14ab (LSM14A mRNA processing body assembly factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2462])

HSP 1 Score: 139.428 bits (350), Expect = 5.182e-35
Identity = 68/107 (63.55%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAE-TSISGNLPPGVMS 426
            + +IG KISLISKA IRYEG+LYTID   STVAL+KVKSFGTEDR  DR IPPRD+++EYIIFRGSDI+DL VCEP K +  L +D AIV++   S +G   P   S
Sbjct:    5 TPYIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPIPPRDDVFEYIIFRGSDIKDLTVCEPPKPTCNLPQDPAIVQSSLASTAGPTAPSFQS 111          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Zebrafish
Match: lsm14ab (LSM14A mRNA processing body assembly factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2462])

HSP 1 Score: 139.043 bits (349), Expect = 5.598e-35
Identity = 68/107 (63.55%), Postives = 81/107 (75.70%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAE-TSISGNLPPGVMS 426
            + +IG KISLISKA IRYEG+LYTID   STVAL+KVKSFGTEDR  DR IPPRD+++EYIIFRGSDI+DL VCEP K +  L +D AIV++   S +G   P   S
Sbjct:    5 TPYIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPIPPRDDVFEYIIFRGSDIKDLTVCEPPKPTCNLPQDPAIVQSSLASTAGPTAPSFQS 111          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Zebrafish
Match: lsm14aa (LSM14A mRNA processing body assembly factor a [Source:ZFIN;Acc:ZDB-GENE-040426-1567])

HSP 1 Score: 136.732 bits (343), Expect = 3.386e-34
Identity = 69/108 (63.89%), Postives = 79/108 (73.15%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGVMSSG 432
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR I PRDE +EYIIFRGSDI+DL VCEP K +  L +D AIV++    S   PP    SG
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPTCSLPQDPAIVQSSLG-SSTAPPSSFQSG 111          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Zebrafish
Match: lsm14aa (LSM14A mRNA processing body assembly factor a [Source:ZFIN;Acc:ZDB-GENE-040426-1567])

HSP 1 Score: 121.324 bits (303), Expect = 1.716e-32
Identity = 59/80 (73.75%), Postives = 66/80 (82.50%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKES 348
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR I PRDE +EYIIFRGSDI+DL VCEP K +
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIAPRDETFEYIIFRGSDIKDLTVCEPPKPT 84          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Xenopus
Match: rps15 (ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-5832673])

HSP 1 Score: 138.658 bits (348), Expect = 6.714e-35
Identity = 65/91 (71.43%), Postives = 74/91 (81.32%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVR 381
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AIV+
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Xenopus
Match: lsm14b (LSM family member 14B [Source:NCBI gene;Acc:595068])

HSP 1 Score: 137.502 bits (345), Expect = 9.051e-35
Identity = 64/92 (69.57%), Postives = 75/92 (81.52%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRA 384
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR  PPR+E+YEYIIFRGSDI+D+ VCEP K S  L +D AIV++
Sbjct:    5 TPYIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKASHALPQDPAIVQS 96          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Xenopus
Match: lsm14b (LSM family member 14B [Source:NCBI gene;Acc:595068])

HSP 1 Score: 135.576 bits (340), Expect = 1.486e-34
Identity = 64/92 (69.57%), Postives = 75/92 (81.52%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRA 384
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR  PPR+E+YEYIIFRGSDI+D+ VCEP K S  L +D AIV++
Sbjct:    5 TPYIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKASHALPQDPAIVQS 96          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Xenopus
Match: rps15 (ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-5832673])

HSP 1 Score: 138.272 bits (347), Expect = 2.095e-34
Identity = 65/91 (71.43%), Postives = 74/91 (81.32%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVR 381
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AIV+
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Xenopus
Match: rps15 (ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-5832673])

HSP 1 Score: 137.887 bits (346), Expect = 3.098e-34
Identity = 65/91 (71.43%), Postives = 74/91 (81.32%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVR 381
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AIV+
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Mouse
Match: Lsm14a (LSM14A mRNA processing body assembly factor [Source:MGI Symbol;Acc:MGI:1914320])

HSP 1 Score: 135.191 bits (339), Expect = 4.663e-35
Identity = 64/89 (71.91%), Postives = 72/89 (80.90%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAI 375
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AI
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAI 93          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Mouse
Match: Lsm14b (LSM family member 14B [Source:MGI Symbol;Acc:MGI:3040677])

HSP 1 Score: 137.117 bits (344), Expect = 9.064e-35
Identity = 63/92 (68.48%), Postives = 74/92 (80.43%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRA 384
            + ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR  PPR+EIYEYIIFRGSDI+D+ VCEP K    L +D AIV++
Sbjct:    7 TPYLGSKISLISKAQIRYEGILYTIDTDNSTVALAKVRSFGTEDRPTDRPAPPREEIYEYIIFRGSDIKDITVCEPPKAQHTLPQDPAIVQS 98          

HSP 2 Score: 49.6766 bits (117), Expect = 9.219e-6
Identity = 25/44 (56.82%), Postives = 31/44 (70.45%), Query Frame = 1
Query: 1231 YYDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFGMA 1362
            YYDK+KSFFDNISSE+       S R+    EERK+N ETFG++
Sbjct:  311 YYDKSKSFFDNISSELK-----TSSRRTTWAEERKLNTETFGVS 349          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Mouse
Match: Lsm14a (LSM14A mRNA processing body assembly factor [Source:MGI Symbol;Acc:MGI:1914320])

HSP 1 Score: 135.961 bits (341), Expect = 6.902e-34
Identity = 64/89 (71.91%), Postives = 72/89 (80.90%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAI 375
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AI
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAI 93          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Mouse
Match: Lsm14a (LSM14A mRNA processing body assembly factor [Source:MGI Symbol;Acc:MGI:1914320])

HSP 1 Score: 88.1965 bits (217), Expect = 9.083e-20
Identity = 38/54 (70.37%), Postives = 43/54 (79.63%), Query Frame = 1
Query:  214 KVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAI 375
            KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AI
Sbjct:    4 KVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAI 57          
BLAST of Protein LSM14 homolog B-A vs. UniProt/SwissProt
Match: sp|Q498K9|L14BB_XENLA (Protein LSM14 homolog B-B OS=Xenopus laevis OX=8355 GN=lsm14b-b PE=1 SV=1)

HSP 1 Score: 139.813 bits (351), Expect = 7.151e-35
Identity = 67/104 (64.42%), Postives = 80/104 (76.92%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGV 420
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR  PPR+E+YEYIIFRGSDI+D+ VCEP K S  LS+D AIV++    + +  P V
Sbjct:    5 TPYIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKASHALSQDPAIVQSSLGSAASYQPSV 108          
BLAST of Protein LSM14 homolog B-A vs. UniProt/SwissProt
Match: sp|Q566L7|LS14B_XENTR (Protein LSM14 homolog B OS=Xenopus tropicalis OX=8364 GN=lsm14b PE=2 SV=1)

HSP 1 Score: 137.117 bits (344), Expect = 6.169e-34
Identity = 64/92 (69.57%), Postives = 75/92 (81.52%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRA 384
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR  PPR+E+YEYIIFRGSDI+D+ VCEP K S  L +D AIV++
Sbjct:    5 TPYIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKASHALPQDPAIVQS 96          
BLAST of Protein LSM14 homolog B-A vs. UniProt/SwissProt
Match: sp|Q68FI1|L14BA_XENLA (Protein LSM14 homolog B-A OS=Xenopus laevis OX=8355 GN=lsm14b-a PE=1 SV=1)

HSP 1 Score: 137.887 bits (346), Expect = 6.280e-34
Identity = 64/92 (69.57%), Postives = 75/92 (81.52%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRA 384
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR  PPR+E+YEYIIFRGSDI+D+ VCEP K S  L +D AIV++
Sbjct:    5 TPYIGSKISLISKAQIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPAPPREEVYEYIIFRGSDIKDITVCEPPKASHALPQDPAIVQS 96          
BLAST of Protein LSM14 homolog B-A vs. UniProt/SwissProt
Match: sp|Q6NVR8|LS14A_XENTR (Protein LSM14 homolog A OS=Xenopus tropicalis OX=8364 GN=lsm14a PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 7.008e-34
Identity = 65/91 (71.43%), Postives = 74/91 (81.32%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVR 381
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AIV+
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-A vs. UniProt/SwissProt
Match: sp|Q5R4R4|LS14A_PONAB (Protein LSM14 homolog A OS=Pongo abelii OX=9601 GN=LSM14A PE=2 SV=1)

HSP 1 Score: 138.658 bits (348), Expect = 7.271e-34
Identity = 65/91 (71.43%), Postives = 74/91 (81.32%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVR 381
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K    L +D AIV+
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQ 95          
BLAST of Protein LSM14 homolog B-A vs. TrEMBL
Match: A0A2T7NGN1 (Uncharacterized protein OS=Pomacea canaliculata OX=400727 GN=C0Q70_18470 PE=4 SV=1)

HSP 1 Score: 150.599 bits (379), Expect = 1.137e-35
Identity = 71/109 (65.14%), Postives = 85/109 (77.98%), Query Frame = 1
Query:  115 FIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSL--LSEDSAIVRAETSISGNLPPGVMSSGM 435
            ++G KISLISKA IRYEGILYTIDP ESTVAL+KV+SFGTEDR  DR +PPRDEI+EYIIFRGSDI+DL+VCEP K+  +  L +D AIV++     G  PP   +S M
Sbjct:    7 YLGSKISLISKAEIRYEGILYTIDPNESTVALAKVRSFGTEDRPTDRPVPPRDEIFEYIIFRGSDIKDLHVCEPPKQQPMGGLPQDPAIVKSSQQSGG--PPSFQTSSM 113          
BLAST of Protein LSM14 homolog B-A vs. TrEMBL
Match: A0A4W5LII5 (LSM14 domain-containing protein OS=Hucho hucho OX=62062 PE=4 SV=1)

HSP 1 Score: 139.043 bits (349), Expect = 8.196e-35
Identity = 67/92 (72.83%), Postives = 76/92 (82.61%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRA 384
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDEI+EYIIFRGSDI+DL VCEP K +  L +D AIV+A
Sbjct:   43 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEIFEYIIFRGSDIKDLTVCEPPKPTCSLPQDPAIVQA 134          
BLAST of Protein LSM14 homolog B-A vs. TrEMBL
Match: A0A3Q2DFP5 (LSM14A mRNA processing body assembly factor b OS=Cyprinodon variegatus OX=28743 PE=4 SV=1)

HSP 1 Score: 147.902 bits (372), Expect = 8.301e-35
Identity = 78/153 (50.98%), Postives = 97/153 (63.40%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAET-SISGNLPPGVMSSGMHHIDNAWPSNNRMQTSEKPIMINNSKSVANSIEAQQNSTAQST 564
            + +IG KISLISKA IRYEG+LYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K +S L +D AIV++   S S    P    +G +   +  P     Q    PI      S       Q++S A+S+
Sbjct:    6 TPYIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKATSTLPQDPAIVQSSIGSTSAGAAPSFQGAGPYAPFSRAPVPPYSQFGGTPIGSQQFGSAGGRTSPQRDSLAKSS 158          
BLAST of Protein LSM14 homolog B-A vs. TrEMBL
Match: A0A3B3U3G2 (LSM14 domain-containing protein OS=Poecilia latipinna OX=48699 PE=4 SV=1)

HSP 1 Score: 141.354 bits (355), Expect = 1.605e-34
Identity = 74/131 (56.49%), Postives = 92/131 (70.23%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSIS-GNLPPGVMSSGMHHIDNAWPSNNRMQTSEKPIM 498
            + ++G KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRD+I+EYIIFRGSDI+DL VCEP K +  L +D AIV+    +S  + P    SSG + + N  P+    Q S  P++
Sbjct:    5 TPYLGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDDIFEYIIFRGSDIKDLTVCEPPKPTCSLPQDPAIVQVFLFLSAASAPTPFQSSGSYGLFNRAPAPAYNQFSTSPLV 135          
BLAST of Protein LSM14 homolog B-A vs. TrEMBL
Match: A0A3Q3E3R7 (LSM14A mRNA processing body assembly factor b OS=Labrus bergylta OX=56723 PE=4 SV=1)

HSP 1 Score: 147.132 bits (370), Expect = 1.657e-34
Identity = 69/102 (67.65%), Postives = 81/102 (79.41%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPP 414
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPRDE++EYIIFRGSDI+DL VCEP K +S L +D AIV++    S + PP
Sbjct:    6 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKATSTLPQDPAIVQSSLGTSNSAPP 107          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Cavefish
Match: lsm14ab (LSM14A mRNA processing body assembly factor [Source:NCBI gene;Acc:103042286])

HSP 1 Score: 135.576 bits (340), Expect = 7.527e-34
Identity = 65/102 (63.73%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPP 414
            + +IG KISLISKA IRYEG+LYTID   STVAL+KVKSFGTEDR  DR + PRD+++EYIIFRGSDI+DL VCEP K +  L +D AIV  ++S+  + PP
Sbjct:    5 TPYIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPVAPRDDVFEYIIFRGSDIKDLTVCEPPKPNCSLPQDPAIV--QSSLGSSAPP 104          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Cavefish
Match: lsm14ab (LSM14A mRNA processing body assembly factor [Source:NCBI gene;Acc:103042286])

HSP 1 Score: 135.961 bits (341), Expect = 8.793e-34
Identity = 65/102 (63.73%), Postives = 80/102 (78.43%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPP 414
            + +IG KISLISKA IRYEG+LYTID   STVAL+KVKSFGTEDR  DR + PRD+++EYIIFRGSDI+DL VCEP K +  L +D AIV  ++S+  + PP
Sbjct:    5 TPYIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPVAPRDDVFEYIIFRGSDIKDLTVCEPPKPNCSLPQDPAIV--QSSLGSSAPP 104          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Cavefish
Match: lsm14ab (LSM14A mRNA processing body assembly factor [Source:NCBI gene;Acc:103042286])

HSP 1 Score: 135.576 bits (340), Expect = 1.249e-33
Identity = 65/100 (65.00%), Postives = 79/100 (79.00%), Query Frame = 1
Query:  115 FIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPP 414
            +IG KISLISKA IRYEG+LYTID   STVAL+KVKSFGTEDR  DR + PRD+++EYIIFRGSDI+DL VCEP K +  L +D AIV  ++S+  + PP
Sbjct:    7 YIGSKISLISKAEIRYEGVLYTIDTENSTVALAKVKSFGTEDRPTDRPVAPRDDVFEYIIFRGSDIKDLTVCEPPKPNCSLPQDPAIV--QSSLGSSAPP 104          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Cavefish
Match: lsm14aa (protein LSM14 homolog A-like [Source:NCBI gene;Acc:103031607])

HSP 1 Score: 130.568 bits (327), Expect = 4.180e-32
Identity = 65/91 (71.43%), Postives = 73/91 (80.22%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVR 381
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR I PRDE YEYIIFRGSDI+DL VCEP K +  L +D AIV+
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPILPRDETYEYIIFRGSDIKDLTVCEPPKPT--LPQDPAIVQ 93          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Cavefish
Match: lsm14aa (protein LSM14 homolog A-like [Source:NCBI gene;Acc:103031607])

HSP 1 Score: 129.798 bits (325), Expect = 9.399e-32
Identity = 65/91 (71.43%), Postives = 73/91 (80.22%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVR 381
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR I PRDE YEYIIFRGSDI+DL VCEP K +  L +D AIV+
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPILPRDETYEYIIFRGSDIKDLTVCEPPKPT--LPQDPAIVQ 93          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Sea Lamprey
Match: ENSPMAT00000005960.1 (pep scaffold:Pmarinus_7.0:GL480662:10110:19118:-1 gene:ENSPMAG00000005377.1 transcript:ENSPMAT00000005960.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 121.709 bits (304), Expect = 9.969e-30
Identity = 59/92 (64.13%), Postives = 72/92 (78.26%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRA 384
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  +R + PRDEI+EYI+FRGSDI+D+ V EP K      +D AIV++
Sbjct:    5 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTERPVAPRDEIFEYIVFRGSDIKDITVREPPKPQR-TPQDPAIVQS 95          

HSP 2 Score: 50.0618 bits (118), Expect = 1.261e-6
Identity = 39/102 (38.24%), Postives = 53/102 (51.96%), Query Frame = 1
Query: 1084 FKEDYDFETANAIIAKE-LAALHVSQXXXXXXXXXXXXXXGQ--------LSDNSEAGYYDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFGMA 1362
            F+ D+DFE+ANA   KE L      + K        +  +G+         S   ++ YYDKTKSFFDNIS E   R      R+    EER++NVETFG++
Sbjct:  301 FEGDFDFESANAQFNKEELEKEFQDKLKLKDDRGGEKVVNGEDKESGAETQSHEDDSAYYDKTKSFFDNISRESDPRE-----RRSTWAEERRMNVETFGVS 397          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Yeast
Match: SCD6 (Repressor of translation initiation; binds eIF4G through its RGG domain and inhibits recruitment of the preinitiation complex; also contains an Lsm domain; may have a role in RNA processing; overproduction suppresses null mutation in clathrin heavy chain gene CHC1; forms cytoplasmic foci upon DNA replication stress [Source:SGD;Acc:S000006333])

HSP 1 Score: 62.003 bits (149), Expect = 7.724e-11
Identity = 33/78 (42.31%), Postives = 46/78 (58.97%), Query Frame = 1
Query:  106 MSSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRK--MDRVIPPRDEIYEYIIFRGSDIQDLNVCE 333
            MS +IG  ISLIS    RY G+L  ID  + TV L +V+ FGTE RK      I P   +Y  + F GS+++DL++ +
Sbjct:    1 MSQYIGKTISLISVTDNRYVGLLEDIDSEKGTVTLKEVRCFGTEGRKNWGPEEIYPNPTVYNSVKFNGSEVKDLSILD 78          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Nematostella
Match: EDO49317 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RHB0])

HSP 1 Score: 101.293 bits (251), Expect = 4.798e-26
Identity = 48/71 (67.61%), Postives = 58/71 (81.69%), Query Frame = 1
Query:  115 FIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNV 327
            +IG  I+L+SKA IRY G LY ID +ESTV L+ V+SFGTE RK+D  IPPR+EIYEYI+FRG DI+DLNV
Sbjct:    7 YIGSIINLVSKAEIRYVGTLYAIDTKESTVTLANVRSFGTEGRKVDVEIPPRNEIYEYIVFRGQDIKDLNV 77          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Medaka
Match: ENSORLT00000039753.1 (pep primary_assembly:ASM223467v1:3:30569759:30570647:-1 gene:ENSORLG00000028980.1 transcript:ENSORLT00000039753.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 135.576 bits (340), Expect = 2.470e-37
Identity = 65/92 (70.65%), Postives = 76/92 (82.61%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRA 384
            + +IG KISLISKA IRYEGILYTID   STVAL+KV+SFGTEDR  DR IPPR+E++EYIIFRGSDI+DL VCEP K +S L +D AIV+ 
Sbjct:    6 TPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPREEVFEYIIFRGSDIKDLTVCEPPKATSSLPQDPAIVQV 97          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Medaka
Match: lsm14b (protein LSM14 homolog B-B [Source:NCBI gene;Acc:101155509])

HSP 1 Score: 126.331 bits (316), Expect = 2.329e-31
Identity = 60/92 (65.22%), Postives = 72/92 (78.26%), Query Frame = 1
Query:  109 SSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRA 384
            + +IG KISLISKA IRYEGIL ++D   STVAL+KVKS+GTEDR  DR +PP+DEIYEYIIFRGSDI+D+ V EP K    L  D AIV++
Sbjct:    7 TPYIGSKISLISKAQIRYEGILSSVDTERSTVALAKVKSYGTEDRHTDRPVPPKDEIYEYIIFRGSDIKDITVSEPPKPHMGLPRDPAIVQS 98          

HSP 2 Score: 51.9878 bits (123), Expect = 1.208e-6
Identity = 33/99 (33.33%), Postives = 49/99 (49.49%), Query Frame = 1
Query: 1084 FKEDYDFETANAIIAKELAALHVSQXXXXXXXXXXXXXXGQLSDNSEAG-------YYDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFGM 1359
            F  D+DFETANA    +L    + ++ +           G++ DN +         YYDK K FFDNI S++  R       +    EE+K+N+ETFG+
Sbjct:  250 FDSDFDFETANAQFKDDLTKEVIVEKVES----------GEVQDNQDVQEETLTEKYYDKAKCFFDNIPSDVKPR-------RTTWAEEKKLNIETFGV 331          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Medaka
Match: LSM14B (protein LSM14 homolog A [Source:NCBI gene;Acc:101155350])

HSP 1 Score: 122.865 bits (307), Expect = 4.649e-30
Identity = 58/99 (58.59%), Postives = 72/99 (72.73%), Query Frame = 1
Query:  115 FIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSK-ESSLLSEDSAIVRAETSISGNL 408
            +IGCKI LISKA  RYEGILYTID   STV L+KVK FGTE R  DR +PP++E+YEYI FRGSDI D+ +CEP+    S L  D AI+ + ++I  N+
Sbjct:    7 YIGCKIGLISKAQNRYEGILYTIDKINSTVVLAKVKCFGTEGRPADRPLPPKNEVYEYITFRGSDIMDIGLCEPAAYHHSSLPSDPAIIHSSSAIPSNV 105          
BLAST of Protein LSM14 homolog B-A vs. Ensembl Medaka
Match: lsm14ab (LSM14A mRNA processing body assembly factor b [Source:ZFIN;Acc:ZDB-GENE-040426-2462])

HSP 1 Score: 49.6766 bits (117), Expect = 2.522e-6
Identity = 43/97 (44.33%), Postives = 56/97 (57.73%), Query Frame = 1
Query: 1084 FKEDYDFETANAI-----IAKELAALHVSQXXXXXXXXXXXXXXGQLSDNSEAGYYDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFGM 1359
            F+ED+DFETANA      I KEL      Q K  +K  E   E+ +  +N+   YYDKTKSFFDN+S E  D  +    R+    EER++N ETFG+
Sbjct:   86 FEEDFDFETANAQFHKDEIDKEL------QTKLKLKASEVTAEEEEAVNNT--CYYDKTKSFFDNLSCE--DTRD----RRPTWAEERRMNAETFGL 168          
BLAST of Protein LSM14 homolog B-A vs. Planmine SMEST
Match: SMESG000014632.1 (SMESG000014632.1)

HSP 1 Score: 832.402 bits (2149), Expect = 0.000e+0
Identity = 484/486 (99.59%), Postives = 485/486 (99.79%), Query Frame = 1
Query:  106 MSSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGVMSSGMHHIDNAWPSNNRMQTSEKPIMINNSKSVANSIEAQQNSTAQSTIGSNRFXXXXXXXXXXXXXXXXXXXXXXXPDVNNDETRYEYRPKGKMEKPQKYSEKYSSNYHEYDYNYDSNYKYQGNSYRVSCDYGPSRDYYHLKQTGXXXXXXXXXXXXXSMDANKLRGFESSENARDYSYAQYYDYKPRNGHEKYSSNYDNNPKSKKKSSRENETSKKDESFKEDYDFETANAIIAKELAALHVSQXXXXXXXXXXXXXXGQLSDNSEAGYYDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFGMAEANRNLGRNSSKWNRNNRHYSKAXXXXXXXXXXXXXXXXTDSYKREPAYKTNSRGGGYNSSRRPVLA 1563
            MSSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGVMSSGMHHIDNAWPSNNRMQTSEKPIMINNSKSVANSIE QQNSTAQSTIGSNRFNQISNDNSKKQQQQQFRKNDTQKPDVNNDETRYEYRPKGKMEKPQKYSEKYSSNYHEYDYNYDSNYKYQGNSYRVSCDYGPSRDYYHLKQTGRYRNDYRRDNYYNSMDANKLRGFESSENARDYSYAQYYDYKPRNGHEKYSSNYDNNPKSKKKSSRENETSKKDESFKEDYDFETANAIIAKELAALHVSQEKKDVKDDECEKEDGQLSDNSEAGYYDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFGMAEANRNLGRNSSKWNRNNRHYSKASRGGGGGSYRGNGGGGTDSYKREPAYKT+SRGGGYNSSRRPVLA
Sbjct:    1 MSSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGVMSSGMHHIDNAWPSNNRMQTSEKPIMINNSKSVANSIEVQQNSTAQSTIGSNRFNQISNDNSKKQQQQQFRKNDTQKPDVNNDETRYEYRPKGKMEKPQKYSEKYSSNYHEYDYNYDSNYKYQGNSYRVSCDYGPSRDYYHLKQTGRYRNDYRRDNYYNSMDANKLRGFESSENARDYSYAQYYDYKPRNGHEKYSSNYDNNPKSKKKSSRENETSKKDESFKEDYDFETANAIIAKELAALHVSQEKKDVKDDECEKEDGQLSDNSEAGYYDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFGMAEANRNLGRNSSKWNRNNRHYSKASRGGGGGSYRGNGGGGTDSYKREPAYKTSSRGGGYNSSRRPVLA 486          
BLAST of Protein LSM14 homolog B-A vs. Planmine SMEST
Match: SMESG000033950.1 (SMESG000033950.1)

HSP 1 Score: 153.295 bits (386), Expect = 2.477e-40
Identity = 80/118 (67.80%), Postives = 90/118 (76.27%), Query Frame = 1
Query:  106 MSSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGNLPPGVMSSGMHHIDNAWP 459
            M++F+G KISLISKAGIRYEGILYTIDP ESTVALSKVKSFGTEDR  +R I PRDE+YEYIIFRGSDI+DL+VC    E+SL SEDSAIV+  +    N PP V     H ID   P
Sbjct:    1 MANFLGKKISLISKAGIRYEGILYTIDPTESTVALSKVKSFGTEDRPSERFISPRDEVYEYIIFRGSDIRDLHVC----ENSLYSEDSAIVKIMSPNFTNQPPHV-PLPQHGIDVGVP 113          

HSP 2 Score: 67.0106 bits (162), Expect = 1.535e-11
Identity = 43/105 (40.95%), Postives = 60/105 (57.14%), Query Frame = 1
Query: 1078 ESFKEDYDFETANAIIAKELAALHVSQXXXXXXXXXXXXXXGQLSDNSEAG------------YYDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFG 1356
            E  K+D+DFE++NAI+A+ELA ++VS +  +          G LS++ E              YYDK+KSFFDNISSE  +R N +      R+ ER+ N ETFG
Sbjct:  264 EPIKDDFDFESSNAILAEELANINVSNDDNNRV--------GNLSESKEPSDQNLADYVEEKLYYDKSKSFFDNISSETSERTNSE------RRNERRSNTETFG 354          
BLAST of Protein LSM14 homolog B-A vs. Planmine SMEST
Match: SMESG000020999.1 (SMESG000020999.1)

HSP 1 Score: 144.821 bits (364), Expect = 8.445e-37
Identity = 69/101 (68.32%), Postives = 81/101 (80.20%), Query Frame = 1
Query:  112 SFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCE-PSKESSLLSEDSAIVRAETSISGNLP 411
            +F+GCKISLIS+AGIRYEGILYTID   STVALSKVKSFGTEDR  +  +PPRDEIYEYIIFRGSDIQDL+VCE P K   ++++D AI+     I+G  P
Sbjct:    5 AFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAIL----EITGKPP 101          

HSP 2 Score: 62.3882 bits (150), Expect = 5.618e-10
Identity = 28/48 (58.33%), Postives = 37/48 (77.08%), Query Frame = 1
Query: 1234 YDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFGMAEANRN 1377
            YD++KSF+DNISS+  DRA GK +R +N ++ERK+NVETFG    N N
Sbjct:  387 YDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNN 434          
BLAST of Protein LSM14 homolog B-A vs. Planmine SMEST
Match: SMESG000020999.1 (SMESG000020999.1)

HSP 1 Score: 144.436 bits (363), Expect = 4.769e-36
Identity = 69/101 (68.32%), Postives = 81/101 (80.20%), Query Frame = 1
Query:  112 SFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDRVIPPRDEIYEYIIFRGSDIQDLNVCE-PSKESSLLSEDSAIVRAETSISGNLP 411
            +F+GCKISLIS+AGIRYEGILYTID   STVALSKVKSFGTEDR  +  +PPRDEIYEYIIFRGSDIQDL+VCE P K   ++++D AI+     I+G  P
Sbjct:  150 AFLGCKISLISRAGIRYEGILYTIDANNSTVALSKVKSFGTEDRYAETPVPPRDEIYEYIIFRGSDIQDLHVCEAPKKHPQIMAQDPAIL----EITGKPP 246          

HSP 2 Score: 62.3882 bits (150), Expect = 7.578e-10
Identity = 28/48 (58.33%), Postives = 37/48 (77.08%), Query Frame = 1
Query: 1234 YDKTKSFFDNISSEMMDRANGKSVRQLNRKEERKINVETFGMAEANRN 1377
            YD++KSF+DNISS+  DRA GK +R +N ++ERK+NVETFG    N N
Sbjct:  532 YDRSKSFYDNISSQATDRAKGKMIRAINWRDERKLNVETFGFNIPNNN 579          
The following BLAST results are available for this feature:
BLAST of Protein LSM14 homolog B-A vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
LSM14A6.296e-3769.47LSM14A mRNA processing body assembly factor [Sourc... [more]
LSM14A6.296e-3769.47LSM14A mRNA processing body assembly factor [Sourc... [more]
LSM14B2.342e-3568.48LSM family member 14B [Source:HGNC Symbol;Acc:HGNC... [more]
LSM14A2.980e-3573.03LSM14A mRNA processing body assembly factor [Sourc... [more]
LSM14A7.250e-3573.03LSM14A mRNA processing body assembly factor [Sourc... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
car-15.949e-2554.26Cytokinesis, Apoptosis, RNA-associated [Source:Un... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
tral1.786e-2351.35gene:FBgn0041775 transcript:FBtr0332638[more]
tral1.856e-2351.35gene:FBgn0041775 transcript:FBtr0332640[more]
tral2.048e-2351.35gene:FBgn0041775 transcript:FBtr0332639[more]
tral2.060e-2351.35gene:FBgn0041775 transcript:FBtr0332635[more]
tral2.060e-2351.35gene:FBgn0041775 transcript:FBtr0075959[more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lsm14aa7.935e-3663.89LSM14A mRNA processing body assembly factor a [Sou... [more]
lsm14ab5.182e-3563.55LSM14A mRNA processing body assembly factor b [Sou... [more]
lsm14ab5.598e-3563.55LSM14A mRNA processing body assembly factor b [Sou... [more]
lsm14aa3.386e-3463.89LSM14A mRNA processing body assembly factor a [Sou... [more]
lsm14aa1.716e-3273.75LSM14A mRNA processing body assembly factor a [Sou... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rps156.714e-3571.43ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-... [more]
lsm14b9.051e-3569.57LSM family member 14B [Source:NCBI gene;Acc:595068... [more]
lsm14b1.486e-3469.57LSM family member 14B [Source:NCBI gene;Acc:595068... [more]
rps152.095e-3471.43ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-... [more]
rps153.098e-3471.43ribosomal protein S15 [Source:Xenbase;Acc:XB-GENE-... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Lsm14a4.663e-3571.91LSM14A mRNA processing body assembly factor [Sourc... [more]
Lsm14b9.064e-3568.48LSM family member 14B [Source:MGI Symbol;Acc:MGI:3... [more]
Lsm14a6.902e-3471.91LSM14A mRNA processing body assembly factor [Sourc... [more]
Lsm14a9.083e-2070.37LSM14A mRNA processing body assembly factor [Sourc... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q498K9|L14BB_XENLA7.151e-3564.42Protein LSM14 homolog B-B OS=Xenopus laevis OX=835... [more]
sp|Q566L7|LS14B_XENTR6.169e-3469.57Protein LSM14 homolog B OS=Xenopus tropicalis OX=8... [more]
sp|Q68FI1|L14BA_XENLA6.280e-3469.57Protein LSM14 homolog B-A OS=Xenopus laevis OX=835... [more]
sp|Q6NVR8|LS14A_XENTR7.008e-3471.43Protein LSM14 homolog A OS=Xenopus tropicalis OX=8... [more]
sp|Q5R4R4|LS14A_PONAB7.271e-3471.43Protein LSM14 homolog A OS=Pongo abelii OX=9601 GN... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A2T7NGN11.137e-3565.14Uncharacterized protein OS=Pomacea canaliculata OX... [more]
A0A4W5LII58.196e-3572.83LSM14 domain-containing protein OS=Hucho hucho OX=... [more]
A0A3Q2DFP58.301e-3550.98LSM14A mRNA processing body assembly factor b OS=C... [more]
A0A3B3U3G21.605e-3456.49LSM14 domain-containing protein OS=Poecilia latipi... [more]
A0A3Q3E3R71.657e-3467.65LSM14A mRNA processing body assembly factor b OS=L... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
lsm14ab7.527e-3463.73LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14ab8.793e-3463.73LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14ab1.249e-3365.00LSM14A mRNA processing body assembly factor [Sourc... [more]
lsm14aa4.180e-3271.43protein LSM14 homolog A-like [Source:NCBI gene;Acc... [more]
lsm14aa9.399e-3271.43protein LSM14 homolog A-like [Source:NCBI gene;Acc... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
ENSPMAT00000005960.19.969e-3064.13pep scaffold:Pmarinus_7.0:GL480662:10110:19118:-1 ... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 1
Match NameE-valueIdentityDescription
SCD67.724e-1142.31Repressor of translation initiation; binds eIF4G t... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO493174.798e-2667.61Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSORLT00000039753.12.470e-3770.65pep primary_assembly:ASM223467v1:3:30569759:305706... [more]
lsm14b2.329e-3165.22protein LSM14 homolog B-B [Source:NCBI gene;Acc:10... [more]
LSM14B4.649e-3058.59protein LSM14 homolog A [Source:NCBI gene;Acc:1011... [more]
lsm14ab2.522e-644.33LSM14A mRNA processing body assembly factor b [Sou... [more]
back to top
BLAST of Protein LSM14 homolog B-A vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000014632.10.000e+099.59SMESG000014632.1[more]
SMESG000033950.12.477e-4067.80SMESG000033950.1[more]
SMESG000020999.18.445e-3768.32SMESG000020999.1[more]
SMESG000020999.14.769e-3668.32SMESG000020999.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023487 ID=SMED30023487|Name=Protein LSM14 homolog B-A|organism=Schmidtea mediterranea sexual|type=transcript|length=1926bp
ATCTATATAAATCTTATATGACACTAATTTCAGCTTTAGGTGATTGTTTA
AATGGTCGATTTCGATTAAAAAATCTTCCATATTTAAATTTTTAGTTGTC
GATAAATGTCCAGTTTTATAGGTTGTAAAATAAGCCTCATATCGAAAGCT
GGTATCAGATATGAGGGTATTTTATATACTATTGATCCCCGAGAATCTAC
TGTCGCTTTGAGCAAAGTCAAGTCTTTCGGTACCGAAGATAGAAAAATGG
ACCGAGTTATTCCTCCACGAGATGAAATATATGAGTATATAATTTTTCGT
GGAAGTGATATTCAAGATTTGAATGTTTGTGAACCAAGTAAAGAATCATC
TTTATTAAGTGAAGATTCAGCAATTGTAAGAGCAGAAACAAGTATTTCAG
GAAATCTTCCTCCTGGTGTTATGTCATCAGGAATGCATCACATCGATAAT
GCTTGGCCGTCTAATAATCGAATGCAAACTTCAGAAAAGCCAATAATGAT
TAATAATTCAAAATCTGTAGCCAATTCAATTGAAGCTCAACAGAATTCAA
CAGCTCAATCAACGATAGGCTCCAATCGTTTTAACCAAATCAGCAATGAT
AATTCAAAAAAGCAACAGCAACAGCAATTTCGTAAAAATGATACTCAAAA
GCCCGATGTAAATAACGACGAAACGAGATACGAATATCGGCCGAAAGGCA
AAATGGAAAAACCCCAAAAATATTCCGAGAAATATAGTTCTAATTATCAC
GAATATGATTATAATTACGACTCAAATTATAAATATCAAGGCAACAGTTA
CCGTGTCTCGTGTGATTATGGGCCTTCGCGAGATTATTACCACCTGAAAC
AGACGGGGAGATATCGCAATGATTACCGACGAGATAATTATTACAACAGC
ATGGACGCAAATAAATTGCGAGGATTTGAGTCGTCAGAAAATGCCCGCGA
CTATTCCTATGCCCAATATTACGACTACAAACCGCGAAATGGCCACGAAA
AGTACAGCAGCAATTACGACAATAATCCGAAAAGTAAAAAGAAATCCTCC
CGGGAAAACGAGACGTCCAAGAAAGATGAGAGCTTCAAGGAGGATTATGA
TTTCGAGACTGCAAATGCTATCATAGCCAAAGAATTAGCTGCTTTACACG
TTTCTCAGGAGAAAAAAGATGTCAAAGATGACGAGTGTGAGAAAGAAGAT
GGACAATTGTCGGATAATTCTGAAGCTGGATATTATGACAAAACGAAATC
ATTTTTTGATAACATCAGTTCTGAAATGATGGACAGAGCGAACGGGAAAA
GCGTGCGCCAATTGAATCGCAAGGAAGAGCGCAAAATCAATGTAGAAACA
TTTGGTATGGCAGAAGCCAATCGCAACCTGGGTCGAAACTCATCGAAATG
GAATCGTAACAATCGGCACTATTCCAAAGCGTCCCGAGGAGGAGGAGGGG
GATCGTATCGAGGCAATGGCGGTGGCGGCACCGACAGTTACAAGAGGGAA
CCAGCATATAAAACAAACAGTAGGGGCGGTGGCTACAACTCATCTCGACG
GCCAGTGCTCGCGGACGGACCGGGCCGCGGTGGCGATGATTATTGATAAT
AAATATTATTACTATATCATTATTACTCGTTTGAATCTGTTATAAAATAT
TATTATTATTATAATAAAGATTATTGTACATGCGTGTGTAATACTGCCGC
AGCCGCCCGGTACCGCAATACTGTGTCTGTTTGTCTATCTGTCAGTTTGT
TTGGTTGGTTGGTTGGTTGTCGTATTTTCCGCCTGCTTGTCATTTCGCCA
CCGCCGCCGCAGTCGTCAGGTGTGTAACTAATGCATAGCTTTTGTTGATT
TTTGTTTCATTGTTAATTGAGATCCGTTCTGATTATGATATTTTGTTCAA
ATAAATTTTCAAGGATTTAAAAAAAA
back to top

protein sequence of SMED30023487-orf-1

>SMED30023487-orf-1 ID=SMED30023487-orf-1|Name=SMED30023487-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=497bp
MSSFIGCKISLISKAGIRYEGILYTIDPRESTVALSKVKSFGTEDRKMDR
VIPPRDEIYEYIIFRGSDIQDLNVCEPSKESSLLSEDSAIVRAETSISGN
LPPGVMSSGMHHIDNAWPSNNRMQTSEKPIMINNSKSVANSIEAQQNSTA
QSTIGSNRFNQISNDNSKKQQQQQFRKNDTQKPDVNNDETRYEYRPKGKM
EKPQKYSEKYSSNYHEYDYNYDSNYKYQGNSYRVSCDYGPSRDYYHLKQT
GRYRNDYRRDNYYNSMDANKLRGFESSENARDYSYAQYYDYKPRNGHEKY
SSNYDNNPKSKKKSSRENETSKKDESFKEDYDFETANAIIAKELAALHVS
QEKKDVKDDECEKEDGQLSDNSEAGYYDKTKSFFDNISSEMMDRANGKSV
RQLNRKEERKINVETFGMAEANRNLGRNSSKWNRNNRHYSKASRGGGGGS
YRGNGGGGTDSYKREPAYKTNSRGGGYNSSRRPVLADGPGRGGDDY*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: cellular component
TermDefinition
GO:1990904ribonucleoprotein complex
GO:0030529intracellular ribonucleoprotein complex
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000014zeta neoblast
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0000429neoblast
Vocabulary: INTERPRO
TermDefinition
IPR025609Lsm14-like_N
IPR019050FDF_dom
IPR025762DFDF
IPR025761FFD_box
IPR010920LSM_dom_sf
Vocabulary: biological process
TermDefinition
GO:0006417regulation of translation
GO:0007275multicellular organism development
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR025609Lsm14-like, N-terminalSMARTSM01271LSM14_2coord: 1..95
e-value: 1.1E-47
score: 174.4
IPR025609Lsm14-like, N-terminalPFAMPF12701LSM14coord: 4..76
e-value: 3.4E-31
score: 107.2
IPR025609Lsm14-like, N-terminalCDDcd01736LSm14_Ncoord: 1..74
e-value: 1.41028E-38
score: 133.097
IPR019050FDF domainSMARTSM01199FDF_2coord: 325..420
e-value: 7.5E-14
score: 62.0
IPR019050FDF domainPFAMPF09532FDFcoord: 327..418
e-value: 2.2E-8
score: 34.9
NoneNo IPR availableGENE3DG3DSA:2.30.30.100coord: 1..81
e-value: 6.1E-36
score: 124.1
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 425..440
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 294..325
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 164..180
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 181..208
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 351..369
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 351..374
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 164..208
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 425..496
NoneNo IPR availablePANTHERPTHR13586SCD6 PROTEIN-RELATEDcoord: 1..478
NoneNo IPR availablePANTHERPTHR13586:SF0TRAILER HITCH, ISOFORM Hcoord: 1..478
IPR025762DFDF domainPROSITEPS51512DFDFcoord: 319..355
score: 9.341
IPR025761FFD boxPROSITEPS51513FFDcoord: 375..391
score: 14.874
IPR010920LSM domain superfamilySUPERFAMILYSSF50182Sm-like ribonucleoproteinscoord: 3..78