Methyltransferase-like protein 17

Overview
NameMethyltransferase-like protein 17
Smed IDSMED30023484
Length (bp)1599
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Methyltransferase-like protein 17 (SMED30023484) t-SNE clustered cells

Violin plots show distribution of expression levels for Methyltransferase-like protein 17 (SMED30023484) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Methyltransferase-like protein 17 (SMED30023484) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Methyltransferase-like protein 17 (SMED30023484) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023484

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 2

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
pharynxSMED30023484h1SMcG0013502 dd_Smed_v4_4718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023484h1SMcG0013502 dd_Smed_v4_4718_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Methyltransferase-like protein 17 vs. Ensembl Human
Match: METTL17 (methyltransferase like 17 [Source:HGNC Symbol;Acc:HGNC:19280])

HSP 1 Score: 194.126 bits (492), Expect = 2.704e-55
Identity = 133/431 (30.86%), Postives = 203/431 (47.10%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITE-KTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTEN---EEKPAKIFSPCPHSMACPK-SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIIS--YKTSGKVH-DLCQLDGSANRYFMET--ENRSLKRFIRKCEPGDFMPV 1405
            R HP  L+LP ++LP  L       L  +       +    +     LW R L  E + LQ   R+L ++            L N D      L  T +     +    RK+      Y   +    + Y+E LS +Y+ ARL   FAA  + F+EIR R P F P    DFGSG GS  WAA+S+W   +++++  VD S  +L ++E LLK G+       +PG+  R +L  S  +Q+D+V+S +SL ++      R E++  LW KTG F+V +E GTKAG   +++ARD ++   E    + +P  +F+PCPH + CP+ +  ACSF   +  +  +    + K+E  S V+L++G   + +         +PRI     K    VH  LC  DG      +      R L R  R    GD +PV
Sbjct:   50 RQHPGILKLPHVRLPQALANGAQLLLLGSAG---PTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKK-----------FLENPD------LSQTEEKLRGAVLHALRKTT-----YHWQE----LSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFGSGTGSVTWAAHSIW-GQSLREYMCVDRSAAMLVLAEKLLKGGSESGE-PYIPGVFFRQFLPVSPKVQFDVVVSAFSLSELP-SKADRTEVVQTLWRKTGHFLVLVENGTKAGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSWN-KKPKEEKFSMVILARGSPEEAH--------RWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRHGRDLYRCARVSSWGDLLPV 439          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Human
Match: METTL17 (methyltransferase like 17 [Source:HGNC Symbol;Acc:HGNC:19280])

HSP 1 Score: 188.348 bits (477), Expect = 2.887e-53
Identity = 131/439 (29.84%), Postives = 204/439 (46.47%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITE-KTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTEN---EEKPAKIFSPCPHSMACPK-SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIIS--YKTSGKVH-DLCQLDGSANRYFMET--ENRSLKRFIRKCEPGDFMPVTEKTQADS 1429
            R HP  L+LP ++LP  L       L  +       +    +     LW R L  E + LQ   R+L ++            L N D      L  T +     +    RK+      Y   +    + Y+E LS +Y+ ARL   FAA  + F+EIR R P F P    DFGSG GS  WAA+S+W   +++++  VD S  +L ++E LLK G+       +PG+  R +L  S  +Q+D+V+S +SL ++      R E++  LW KTG F+V +E GTKAG   +++ARD ++   E    + +P  +F+PCPH + CP+ +  ACSF   +  +  +    + K+E  S V+L++G   + +         +PRI     K    VH  LC  DG      +       S    +    P  F P T +  ++S
Sbjct:   50 RQHPGILKLPHVRLPQALANGAQLLLLGSAG---PTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKK-----------FLENPD------LSQTEEKLRGAVLHALRKTT-----YHWQE----LSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFGSGTGSVTWAAHSIW-GQSLREYMCVDRSAAMLVLAEKLLKGGSESGE-PYIPGVFFRQFLPVSPKVQFDVVVSAFSLSELP-SKADRTEVVQTLWRKTGHFLVLVENGTKAGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSWN-KKPKEEKFSMVILARGSPEEAH--------RWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRHGSSWGDLLPVLTPSAFPPSTAQDPSES 447          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Human
Match: METTL17 (methyltransferase like 17 [Source:HGNC Symbol;Acc:HGNC:19280])

HSP 1 Score: 185.652 bits (470), Expect = 6.039e-52
Identity = 125/400 (31.25%), Postives = 193/400 (48.25%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITE-KTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTEN---EEKPAKIFSPCPHSMACPK-SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIIS--YKTSGKVH-DLCQLDG 1318
            R HP  L+LP ++LP  L       L  +       +    +     LW R L  E + LQ   R+L ++            L N D      L  T +     +    RK+      Y   +    + Y+E LS +Y+ ARL   FAA  + F+EIR R P F P    DFGSG GS  WAA+S+W   +++++  VD S  +L ++E LLK G+       +PG+  R +L  S  +Q+D+V+S +SL ++      R E++  LW KTG F+V +E GTKAG   +++ARD ++   E    + +P  +F+PCPH + CP+ +  ACSF   +  +  +    + K+E  S V+L++G   + +         +PRI     K    VH  LC  DG
Sbjct:   50 RQHPGILKLPHVRLPQALANGAQLLLLGSAG---PTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKK-----------FLENPD------LSQTEEKLRGAVLHALRKTT-----YHWQE----LSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFGSGTGSVTWAAHSIW-GQSLREYMCVDRSAAMLVLAEKLLKGGSESGE-PYIPGVFFRQFLPVSPKVQFDVVVSAFSLSELP-SKADRTEVVQTLWRKTGHFLVLVENGTKAGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSWN-KKPKEEKFSMVILARGSPEEAH--------RWPRITQPVLKRPRHVHCHLCCPDG 408          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Human
Match: METTL17 (methyltransferase like 17 [Source:HGNC Symbol;Acc:HGNC:19280])

HSP 1 Score: 89.3521 bits (220), Expect = 3.386e-20
Identity = 45/109 (41.28%), Postives = 65/109 (59.63%), Query Frame = 2
Query:  521 IRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSS 847
            + Y+E LS +Y+ ARL   FAA  + F+EIR R P F P    DFGSG GS  WAA+S+W   +++++  VD S  +L ++E LLK G+       +PG+  R +L  S
Sbjct:   66 LSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFGSGTGSVTWAAHSIWG-QSLREYMCVDRSAAMLVLAEKLLKGGSESGE-PYIPGVFFRQFLPVS 172          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Human
Match: METTL17 (methyltransferase like 17 [Source:HGNC Symbol;Acc:HGNC:19280])

HSP 1 Score: 73.559 bits (179), Expect = 4.845e-15
Identity = 34/74 (45.95%), Postives = 47/74 (63.51%), Query Frame = 2
Query:  521 IRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDAS 742
            + Y+E LS +Y+ ARL   FAA  + F+EIR R P F P    DFGSG GS  WAA+S+W   +++++  VD S
Sbjct:   66 LSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFGSGTGSVTWAAHSIWG-QSLREYMCVDRS 138          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Celegans
Match: F32A7.4 (pep chromosome:WBcel235:I:14839856:14843128:1 gene:WBGene00009305.1 transcript:F32A7.4.1 gene_biotype:protein_coding transcript_biotype:protein_coding gene_symbol:F32A7.4)

HSP 1 Score: 99.3673 bits (246), Expect = 5.869e-22
Identity = 91/400 (22.75%), Postives = 162/400 (40.50%), Query Frame = 2
Query:  458 ETFRKSVEASVKYEIDDKPNAIRYSENL------------SNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSIS-EFLLKDGAMKQHLTALP----GITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVA-------------------------------STENEEKPAKIFSPCP-------------------HSMACPKS-KTACSFPVKFEELRLTEQIGELKQEN-----ISFVVLSKGD--LSDYYTNEIRQLLSYPRIISYKTSGKVH-DLCQLDGSANRYFMETENRSLKRFIRKCEPGDFMPVTEKTQADS 1429
            E+F   V+ + +YEI ++ + I   EN             +  Y +ARLAPN+A   +   E     P F P    DFGSG G+  WA  + WP   +K+  +VD S  ++  S + L  + + +      P     +  R +L  S +  YD+V++   L +I G   +R ++I +LW +T +F++ IE      F  +LEARD+L+                                +  + EK A +    P                   H + CP    ++C+F  +F+ +R   +  E + +       ++++L K    +++ +T  I        + + K  G V  D+C       R  +  ++  +   +R    GD +P+  KT   S
Sbjct:  135 ESFGGKVQEAQQYEIRNEVDRIMKKENFNWKPLEITTKESAAAYSLARLAPNYAEITRTLEEFNT-IPDFQPETVLDFGSGAGAGFWAIQNKWP--DVKEITMVDLSDAMMKFSMDSLRNEQSSEASQNGRPFVHNNVNFRRHLIPSLNTTYDVVLAHRVLCEI-GSSETRLQLIESLWKRTNRFLILIESSQTGAFGGLLEARDFLLTQGTLVDYRKLLKSLEEAVMLSPKVVRIVEDYNLSDYEKYALLMEAVPPGHTVPTMLPTATVLAPCPHDLGCPLGVHSSCTFNTRFQPIRADGRRSEKESDGTEVSKFTYMILEKSQRKVNNEHTERI--------LKNRKLGGHVTCDVCTAFRGIQRITLSKKHGEMYTALRSRRDGDLLPINLKTMTSS 522          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Fly
Match: CG13126 (gene:FBgn0032168 transcript:FBtr0343747)

HSP 1 Score: 142.895 bits (359), Expect = 7.163e-37
Identity = 89/295 (30.17%), Postives = 156/295 (52.88%), Query Frame = 2
Query:  455 SETFRKSVEASVKYEIDDKPNA---IRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKIFSPCPHSMACPK-----SKTACSFPVKFEELRL-TEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQL 1312
            +E +R+  E  +   +  +  A   I Y    S +Y +AR A  +A   +V  E+ +R  +F P +FFDFGSGIG+  W A+ +W    I +++ VD S  +  ISE +L+DG   + + AL  + +R +L  + +  YD+VI  ++L ++      R +++ NLW K   ++V +E+GT+ G + + EAR +L+     +E+     +PCPH + CP+      +T C+FP+ +  LRL ++ + +      S+ +L KG  SD  +       S+PRI+        H +C+L
Sbjct:  127 AERWRRKRELEINKRLGQRIYAWKRIEYGAYESLVYAIARGAQEYAVLKRVLTELAQRDEQFRPRSFFDFGSGIGTGMWVASELWR-EHIFEYYNVDRSREMNEISELILRDGHENKQI-ALRNVFYRQFL-PAIETNYDLVIISHTLFELENK-EQREDVLRNLWRKCDGYLVIVEEGTRRGSELVNEARQFLL----EQEQEGHTVAPCPHDLVCPRLRDLADRTPCNFPISYAPLRLGSDFLADRHTSLYSYAILKKGSQSDSSS-------SWPRIVRPTLVRSKHAICRL 406          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Fly
Match: CG13126 (gene:FBgn0032168 transcript:FBtr0079892)

HSP 1 Score: 142.895 bits (359), Expect = 7.163e-37
Identity = 89/295 (30.17%), Postives = 156/295 (52.88%), Query Frame = 2
Query:  455 SETFRKSVEASVKYEIDDKPNA---IRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKIFSPCPHSMACPK-----SKTACSFPVKFEELRL-TEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQL 1312
            +E +R+  E  +   +  +  A   I Y    S +Y +AR A  +A   +V  E+ +R  +F P +FFDFGSGIG+  W A+ +W    I +++ VD S  +  ISE +L+DG   + + AL  + +R +L  + +  YD+VI  ++L ++      R +++ NLW K   ++V +E+GT+ G + + EAR +L+     +E+     +PCPH + CP+      +T C+FP+ +  LRL ++ + +      S+ +L KG  SD  +       S+PRI+        H +C+L
Sbjct:  127 AERWRRKRELEINKRLGQRIYAWKRIEYGAYESLVYAIARGAQEYAVLKRVLTELAQRDEQFRPRSFFDFGSGIGTGMWVASELWR-EHIFEYYNVDRSREMNEISELILRDGHENKQI-ALRNVFYRQFL-PAIETNYDLVIISHTLFELENK-EQREDVLRNLWRKCDGYLVIVEEGTRRGSELVNEARQFLL----EQEQEGHTVAPCPHDLVCPRLRDLADRTPCNFPISYAPLRLGSDFLADRHTSLYSYAILKKGSQSDSSS-------SWPRIVRPTLVRSKHAICRL 406          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Zebrafish
Match: mettl17 (methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GENE-031118-203])

HSP 1 Score: 191.045 bits (484), Expect = 2.404e-54
Identity = 140/476 (29.41%), Postives = 236/476 (49.58%), Query Frame = 2
Query:   56 NIKSANKLLKVCPKFEKYMIINGETNASVRNHPCYLQLPTIQLPDRLDKAVAKYL-RDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTE---NEEKPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNE-------IRQLLSYPRIISYKTSGKVHDLCQLDGSANRYFMETENRSLKRFIRKCEPGDFMPVTEKTQADSLND 1438
            ++K A +        E+   +NG   A  R HP    L T+QLP++L  A    L R +V      LT  A+     LW R  + E +       L  + I      +E   N ++N  D  L+  ++   KV+SE  R +   +          A+RY+E+L  +Y+VARLA  +AA  +   EI+KR P F+P +  DFGSG+G+  WAA+ +W   ++K++  VD+S  + +++E LL +G+ + + T +  +  R +L  S  +Q+D+V++ +SL ++A     R  +I+ LW KT  ++V +E GTK G Q ++EARD ++   +   ++ +   IF+PC H + CPK        C+F   +  L L+    E +QE  S++++S+ D       E       I Q+   PR +  +      +L QL  +A R+      + + R  R  + GD +PV  K    ++ND
Sbjct:   20 SLKEAIRCQSSAAPLEQADYLNG---APHRKHPGVTNLKTVQLPEQLQLAAQSILQRADV----KSLTERAQKLSNFLWSRKRVIESS------QLREKAIILERKFLEEERNVSENDIDHNLEARIRK--KVLSELRRTTYHRA----------ALRYNEDLGLVYMVARLAGGYAAVLRALNEIKKRDPLFVPYSLLDFGSGLGTGTWAAHRLWG-DSLKEYVCVDSSGDMNTLAEQLLLEGSERNNPT-IKQVYFRQFLPVSPKVQFDLVVAAFSLSELA-TLDERLNVISTLWRKTNSYLVLVENGTKEGHQILMEARDAILKREDEILHDPRRPSIFAPCTHELKCPKLIRQPVVPCNFFQFYYSLPLSRS-QERQQERFSYLIVSRSDGEKAQKAEHWDMARVIAQVHRRPRHVQCQLCCVNGELKQLAVTARRH-----GKDMYRCARNSDWGDLLPVFHKEDEHTIND 461          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Zebrafish
Match: mettl17 (methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GENE-031118-203])

HSP 1 Score: 191.045 bits (484), Expect = 2.404e-54
Identity = 140/476 (29.41%), Postives = 236/476 (49.58%), Query Frame = 2
Query:   56 NIKSANKLLKVCPKFEKYMIINGETNASVRNHPCYLQLPTIQLPDRLDKAVAKYL-RDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTE---NEEKPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNE-------IRQLLSYPRIISYKTSGKVHDLCQLDGSANRYFMETENRSLKRFIRKCEPGDFMPVTEKTQADSLND 1438
            ++K A +        E+   +NG   A  R HP    L T+QLP++L  A    L R +V      LT  A+     LW R  + E +       L  + I      +E   N ++N  D  L+  ++   KV+SE  R +   +          A+RY+E+L  +Y+VARLA  +AA  +   EI+KR P F+P +  DFGSG+G+  WAA+ +W   ++K++  VD+S  + +++E LL +G+ + + T +  +  R +L  S  +Q+D+V++ +SL ++A     R  +I+ LW KT  ++V +E GTK G Q ++EARD ++   +   ++ +   IF+PC H + CPK        C+F   +  L L+    E +QE  S++++S+ D       E       I Q+   PR +  +      +L QL  +A R+      + + R  R  + GD +PV  K    ++ND
Sbjct:   20 SLKEAIRCQSSAAPLEQADYLNG---APHRKHPGVTNLKTVQLPEQLQLAAQSILQRADV----KSLTERAQKLSNFLWSRKRVIESS------QLREKAIILERKFLEEERNVSENDIDHNLEARIRK--KVLSELRRTTYHRA----------ALRYNEDLGLVYMVARLAGGYAAVLRALNEIKKRDPLFVPYSLLDFGSGLGTGTWAAHRLWG-DSLKEYVCVDSSGDMNTLAEQLLLEGSERNNPT-IKQVYFRQFLPVSPKVQFDLVVAAFSLSELA-TLDERLNVISTLWRKTNSYLVLVENGTKEGHQILMEARDAILKREDEILHDPRRPSIFAPCTHELKCPKLIRQPVVPCNFFQFYYSLPLSRS-QERQQERFSYLIVSRSDGEKAQKAEHWDMARVIAQVHRRPRHVQCQLCCVNGELKQLAVTARRH-----GKDMYRCARNSDWGDLLPVFHKEDEHTIND 461          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Zebrafish
Match: mettl17 (methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GENE-031118-203])

HSP 1 Score: 179.874 bits (455), Expect = 3.323e-50
Identity = 136/453 (30.02%), Postives = 226/453 (49.89%), Query Frame = 2
Query:   56 NIKSANKLLKVCPKFEKYMIINGETNASVRNHPCYLQLPTIQLPDRLDKAVAKYL-RDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTE---NEEKPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNE-------IRQLLSYPRIISYKTSGKVHDLCQLDGSANR---YFMETENRSL 1360
            ++K A +        E+   +NG   A  R HP    L T+QLP++L  A    L R +V      LT  A+     LW R  + E +       L  + I      +E   N ++N  D  L+  ++   KV+SE  R +   +          A+RY+E+L  +Y+VARLA  +AA  +   EI+KR P F+P +  DFGSG+G+  WAA+ +W   ++K++  VD+S  + +++E LL +G+ + + T +  +  R +L  S  +Q+D+V++ +SL ++A     R  +I+ LW KT  ++V +E GTK G Q ++EARD ++   +   ++ +   IF+PC H + CPK        C+F   +  L L+    E +QE  S++++S+ D       E       I Q+   PR +  +      +L QL  +A R   Y   + NRSL
Sbjct:   20 SLKEAIRCQSSAAPLEQADYLNG---APHRKHPGVTNLKTVQLPEQLQLAAQSILQRADV----KSLTERAQKLSNFLWSRKRVIESS------QLREKAIILERKFLEEERNVSENDIDHNLEARIRK--KVLSELRRTTYHRA----------ALRYNEDLGLVYMVARLAGGYAAVLRALNEIKKRDPLFVPYSLLDFGSGLGTGTWAAHRLWG-DSLKEYVCVDSSGDMNTLAEQLLLEGSERNNPT-IKQVYFRQFLPVSPKVQFDLVVAAFSLSELA-TLDERLNVISTLWRKTNSYLVLVENGTKEGHQILMEARDAILKREDEILHDPRRPSIFAPCTHELKCPKLIRQPVVPCNFFQFYYSLPLSRS-QERQQERFSYLIVSRSDGEKAQKAEHWDMARVIAQVHRRPRHVQCQLCCVNGELKQLAVTARRHGKYGTLSYNRSL 443          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Zebrafish
Match: mettl17 (methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GENE-031118-203])

HSP 1 Score: 129.028 bits (323), Expect = 3.774e-33
Identity = 92/303 (30.36%), Postives = 155/303 (51.16%), Query Frame = 2
Query:   56 NIKSANKLLKVCPKFEKYMIINGETNASVRNHPCYLQLPTIQLPDRLDKAVAKYL-RDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKF 961
            ++K A +        E+   +NG   A  R HP    L T+QLP++L  A    L R +V      LT  A+     LW R  + E +       L  + I      +E   N ++N  D  L+  ++   KV+SE  R +   +          A+RY+E+L  +Y+VARLA  +AA  +   EI+KR P F+P +  DFGSG+G+  WAA+ +W   ++K++  VD+S  + +++E LL +G+ + + T +  +  R +L  S  +Q+D+V++ +SL ++A     R  +I+ LW KT  +
Sbjct:   20 SLKEAIRCQSSAAPLEQADYLNG---APHRKHPGVTNLKTVQLPEQLQLAAQSILQRADV----KSLTERAQKLSNFLWSRKRVIESS------QLREKAIILERKFLEEERNVSENDIDHNLEARIRK--KVLSELRRTTYHRA----------ALRYNEDLGLVYMVARLAGGYAAVLRALNEIKKRDPLFVPYSLLDFGSGLGTGTWAAHRLWG-DSLKEYVCVDSSGDMNTLAEQLLLEGSERNNPT-IKQVYFRQFLPVSPKVQFDLVVAAFSLSELA-TLDERLNVISTLWRKTNSY 294          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Zebrafish
Match: mettl17 (methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GENE-031118-203])

HSP 1 Score: 82.0333 bits (201), Expect = 1.263e-17
Identity = 62/194 (31.96%), Postives = 93/194 (47.94%), Query Frame = 2
Query:   98 FEKYMIINGETNASVRNHPCYLQLPTIQLPDRLDKAVAKYL-RDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSA 676
             E+   +NG   A  R HP    L T+QLP++L  A    L R +V      LT  A+     LW R  + E +       L  + I      +E   N ++N  D  L+  ++   KV+SE  R +   +          A+RY+E+L  +Y+VARLA  +AA  +   EI+KR P F+P +  DFGSG+G+ 
Sbjct:   15 LEQADYLNG---APHRKHPGVTNLKTVQLPEQLQLAAQSILQRADV----KSLTERAQKLSNFLWSRKRVIESS------QLREKAIILERKFLEEERNVSENDIDHNLEARIRK--KVLSELRRTTYHRA----------ALRYNEDLGLVYMVARLAGGYAAVLRALNEIKKRDPLFVPYSLLDFGSGLGTG 183          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Xenopus
Match: spag7 (sperm associated antigen 7 [Source:Xenbase;Acc:XB-GENE-1010187])

HSP 1 Score: 191.815 bits (486), Expect = 9.890e-55
Identity = 136/449 (30.29%), Postives = 207/449 (46.10%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIR----------YSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRRE-IITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEE----KPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQL---DGSANRYFMET--ENRSLKRFIRKCEPGDFMPVTEKT 1417
            R HP  + L  +QLP     A    L+ +                         T + LQ H+                NSLNN   S     +D    +++V +E   K   AS +   +   N +R          Y+E L  +Y  AR    +AA  +   EI +RCP+F P    DFGSG GS  WAAN++W   ++ ++  VD++  +  +SE +LK G+    +  + G+  R +L  S  +QYD+V+S +SL D+    +S RE ++  LW KTG F+V +E GTK G Q ++EARD +V   E++E    +P ++F+PCPH M CPK     +  C+F  K++ L       E + E  SF+++S+G +   Y         +PRIIS+  S   H  C +   DG      +      R L R  R  E GD +P+   T
Sbjct:   37 RKHPGVINLKVVQLPKEAQDAAKVLLQGS-------------------------TIRDLQGHI----------------NSLNNYLWSRKRPAED---KDLRVRAEELEKKFRASQEKLRNRVLNTLRKNIYHWQPMSYTEELGLVYFAARFDGGYAAVTRALKEIHQRCPEFKPQTLLDFGSGTGSVTWAANNLWG-KSLVEYMCVDSAAPMNRLSELVLKGGSESGEM-HISGVYFRQFLPLSPKVQYDLVVSAFSLTDLPS--LSEREKVVQALWRKTGGFLVLVESGTKEGHQLLMEARD-IVLQKEDKEIWDHRPPQVFAPCPHQMPCPKLSNRLQMPCNFIQKYQPLPFNWNPHE-RWEKFSFIIISRGYVGGAY---------WPRIISHVLSRPRHVHCHMCCADGELKHEVITARRHGRDLYRCARNSEWGDRLPILTST 426          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Xenopus
Match: spag7 (sperm associated antigen 7 [Source:Xenbase;Acc:XB-GENE-1010187])

HSP 1 Score: 191.815 bits (486), Expect = 1.275e-54
Identity = 136/440 (30.91%), Postives = 210/440 (47.73%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITE-KTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRRE-IITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEE----KPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQL---DGSANRYFMET--ENRSLKRFIRKCEPGDFMPVTEKT 1417
            R HP  + L  +QLP     A AK L     +R  +L     +    LW R    E K L+     L ++           S+     +E     + +++ V     T RK++     Y        + Y+E L  +Y  AR    +AA  +   EI +RCP+F P    DFGSG GS  WAAN++W   ++ ++  VD++  +  +SE +LK G+    +  + G+  R +L  S  +QYD+V+S +SL D+    +S RE ++  LW KTG F+V +E GTK G Q ++EARD +V   E++E    +P ++F+PCPH M CPK     +  C+F  K++ L       E + E  SF+++S+G +   Y         +PRIIS+  S   H  C +   DG      +      R L R  R  E GD +P+   T
Sbjct:   28 RKHPGVINLKVVQLPKEAQDA-AKVLLQGSTIR--DLQGHINSLNNYLWSRKRPAEDKDLRVRAEELEKK--------FRASVGCDAETESFEQQEKLRNRV---LNTLRKNI-----YHW----QPMSYTEELGLVYFAARFDGGYAAVTRALKEIHQRCPEFKPQTLLDFGSGTGSVTWAANNLWG-KSLVEYMCVDSAAPMNRLSELVLKGGSESGEMH-ISGVYFRQFLPLSPKVQYDLVVSAFSLTDLPS--LSEREKVVQALWRKTGGFLVLVESGTKEGHQLLMEARD-IVLQKEDKEIWDHRPPQVFAPCPHQMPCPKLSNRLQMPCNFIQKYQPLPFNWNPHE-RWEKFSFIIISRGYVGGAY---------WPRIISHVLSRPRHVHCHMCCADGELKHEVITARRHGRDLYRCARNSEWGDRLPILTST 429          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Xenopus
Match: spag7 (sperm associated antigen 7 [Source:Xenbase;Acc:XB-GENE-1010187])

HSP 1 Score: 191.815 bits (486), Expect = 1.544e-54
Identity = 136/440 (30.91%), Postives = 210/440 (47.73%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITE-KTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRRE-IITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEE----KPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQL---DGSANRYFMET--ENRSLKRFIRKCEPGDFMPVTEKT 1417
            R HP  + L  +QLP     A AK L     +R  +L     +    LW R    E K L+     L ++           S+     +E     + +++ V     T RK++     Y        + Y+E L  +Y  AR    +AA  +   EI +RCP+F P    DFGSG GS  WAAN++W   ++ ++  VD++  +  +SE +LK G+    +  + G+  R +L  S  +QYD+V+S +SL D+    +S RE ++  LW KTG F+V +E GTK G Q ++EARD +V   E++E    +P ++F+PCPH M CPK     +  C+F  K++ L       E + E  SF+++S+G +   Y         +PRIIS+  S   H  C +   DG      +      R L R  R  E GD +P+   T
Sbjct:   37 RKHPGVINLKVVQLPKEAQDA-AKVLLQGSTIR--DLQGHINSLNNYLWSRKRPAEDKDLRVRAEELEKK--------FRASVGCDAETESFEQQEKLRNRV---LNTLRKNI-----YHW----QPMSYTEELGLVYFAARFDGGYAAVTRALKEIHQRCPEFKPQTLLDFGSGTGSVTWAANNLWG-KSLVEYMCVDSAAPMNRLSELVLKGGSESGEM-HISGVYFRQFLPLSPKVQYDLVVSAFSLTDLPS--LSEREKVVQALWRKTGGFLVLVESGTKEGHQLLMEARD-IVLQKEDKEIWDHRPPQVFAPCPHQMPCPKLSNRLQMPCNFIQKYQPLPFNWNPHE-RWEKFSFIIISRGYVGGAY---------WPRIISHVLSRPRHVHCHMCCADGELKHEVITARRHGRDLYRCARNSEWGDRLPILTST 438          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Xenopus
Match: spag7 (sperm associated antigen 7 [Source:Xenbase;Acc:XB-GENE-1010187])

HSP 1 Score: 191.43 bits (485), Expect = 2.099e-54
Identity = 136/440 (30.91%), Postives = 210/440 (47.73%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITE-KTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRRE-IITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEE----KPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQL---DGSANRYFMET--ENRSLKRFIRKCEPGDFMPVTEKT 1417
            R HP  + L  +QLP     A AK L     +R  +L     +    LW R    E K L+     L ++           S+     +E     + +++ V     T RK++     Y        + Y+E L  +Y  AR    +AA  +   EI +RCP+F P    DFGSG GS  WAAN++W   ++ ++  VD++  +  +SE +LK G+    +  + G+  R +L  S  +QYD+V+S +SL D+    +S RE ++  LW KTG F+V +E GTK G Q ++EARD +V   E++E    +P ++F+PCPH M CPK     +  C+F  K++ L       E + E  SF+++S+G +   Y         +PRIIS+  S   H  C +   DG      +      R L R  R  E GD +P+   T
Sbjct:   35 RKHPGVINLKVVQLPKEAQDA-AKVLLQGSTIR--DLQGHINSLNNYLWSRKRPAEDKDLRVRAEELEKK--------FRASVGCDAETESFEQQEKLRNRV---LNTLRKNI-----YHW----QPMSYTEELGLVYFAARFDGGYAAVTRALKEIHQRCPEFKPQTLLDFGSGTGSVTWAANNLWG-KSLVEYMCVDSAAPMNRLSELVLKGGSESGEM-HISGVYFRQFLPLSPKVQYDLVVSAFSLTDLPS--LSEREKVVQALWRKTGGFLVLVESGTKEGHQLLMEARD-IVLQKEDKEIWDHRPPQVFAPCPHQMPCPKLSNRLQMPCNFIQKYQPLPFNWNPHE-RWEKFSFIIISRGYVGGAY---------WPRIISHVLSRPRHVHCHMCCADGELKHEVITARRHGRDLYRCARNSEWGDRLPILTST 436          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Xenopus
Match: spag7 (sperm associated antigen 7 [Source:Xenbase;Acc:XB-GENE-1010187])

HSP 1 Score: 190.274 bits (482), Expect = 4.305e-54
Identity = 136/451 (30.16%), Postives = 203/451 (45.01%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAI------------RYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRRE-IITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEE----KPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQL---DGSANRYFMET--ENRSLKRFIRKCEPGDFMPVTEKT 1417
            R HP  + L  +QLP     A    L+D                              LQ H+                NSLNN   S     +D    +++V +E   K   ASV  +       I             Y+E L  +Y  AR    +AA  +   EI +RCP+F P    DFGSG GS  WAAN++W   ++ ++  VD++  +  +SE +LK G+    +  + G+  R +L  S  +QYD+V+S +SL D+    +S RE ++  LW KTG F+V +E GTK G Q ++EARD +V   E++E    +P ++F+PCPH M CPK     +  C+F  K++ L       E + E  SF+++S+G +   Y         +PRIIS+  S   H  C +   DG      +      R L R  R  E GD +P+   T
Sbjct:   35 RKHPGVINLKVVQLPKEAQDAAKVLLQD------------------------------LQGHI----------------NSLNNYLWSRKRPAED---KDLRVRAEELEKKFRASVGCDAGKLKEMIYSICIAELLYHFTYTEELGLVYFAARFDGGYAAVTRALKEIHQRCPEFKPQTLLDFGSGTGSVTWAANNLWG-KSLVEYMCVDSAAPMNRLSELVLKGGSESGEMH-ISGVYFRQFLPLSPKVQYDLVVSAFSLTDLPS--LSEREKVVQALWRKTGGFLVLVESGTKEGHQLLMEARD-IVLQKEDKEIWDHRPPQVFAPCPHQMPCPKLSNRLQMPCNFIQKYQPLPFNWNPHE-RWEKFSFIIISRGYVGGAY---------WPRIISHVLSRPRHVHCHMCCADGELKHEVITARRHGRDLYRCARNSEWGDRLPILTST 421          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Mouse
Match: Mettl17 (methyltransferase like 17 [Source:MGI Symbol;Acc:MGI:1098577])

HSP 1 Score: 187.963 bits (476), Expect = 3.241e-53
Identity = 139/440 (31.59%), Postives = 214/440 (48.64%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAA-KNFKIVLWERALITE-KTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEE---KPAKIFSPCPHSMACPK---SKT-ACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIIS--YKTSGKVH-DLCQLDGSANRYFMET--ENRSLKRFIRKCEPGDFMPVTEKTQ 1420
            R HP  L LP +QLP  L  A A+ +    P+R  E  + A  N+   LW R L  E + LQ     L ++      L  ++S    +   +  L               RK+      Y   +    + YSE LS +Y+ ARL   FAA  + F+EI+ R P+F P    DFGSG GS AWAA+  W   +++++  VD+S  +L ++E LLK G+ +     +PG+  R +L  S  +Q+D+V+S Y+L ++      R E+I NLW KT  F+V +E GTKAG + +++AR+ ++   E      +P+ +F+PCPH + CP+   SK+ ACSF   +  +       + K+E  S V+L++G          ++   +PRI     K    VH  LC  DG      +      R L R  R    GD +PV   ++
Sbjct:   51 RKHPGILHLPHVQLPQALADA-AQLMLFERPMRSVEKQVQALTNY---LWSRHLPVEPEELQRRAAYLEKK-----FLEKQDSAPTEEKLREAVL------------HALRKTT-----YHWQE----LSYSEELSLIYMAARLDGGFAAVFRAFHEIQARIPEFRPQTLMDFGSGTGSVAWAAHRTW-GQSLREYVCVDSSAAMLGLAEKLLKGGS-ESGKPCIPGVFFRQFLPVSPKVQFDVVVSAYALSELP-SRADRIEVIQNLWRKTSHFLVLVENGTKAGHRLLMDARNLVLGEKEKSPLDLRPSFVFAPCPHELPCPQLNASKSLACSFSQAYHPIPFNWN-KKPKEEIFSMVILARGS--------PKEANRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVVTARRHGRDLYRCARVSSWGDLLPVIAPSE 448          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Mouse
Match: Mettl17 (methyltransferase like 17 [Source:MGI Symbol;Acc:MGI:1098577])

HSP 1 Score: 181.415 bits (459), Expect = 1.523e-50
Identity = 131/404 (32.43%), Postives = 201/404 (49.75%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAA-KNFKIVLWERALITE-KTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEE---KPAKIFSPCPHSMACPK---SKT-ACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIIS--YKTSGKVH-DLCQLDG 1318
            R HP  L LP +QLP  L  A    L +  P+R  E  + A  N+   LW R L  E + LQ     L ++      L  ++S    +   +  L               RK+      Y   +    + YSE LS +Y+ ARL   FAA  + F+EI+ R P+F P    DFGSG GS AWAA+  W   +++++  VD+S  +L ++E LLK G+ +     +PG+  R +L  S  +Q+D+V+S Y+L ++      R E+I NLW KT  F+V +E GTKAG + +++AR+ ++   E      +P+ +F+PCPH + CP+   SK+ ACSF   +  +       + K+E  S V+L++G          ++   +PRI     K    VH  LC  DG
Sbjct:   51 RKHPGILHLPHVQLPQALADAAQLMLFER-PMRSVEKQVQALTNY---LWSRHLPVEPEELQRRAAYLEKK-----FLEKQDSAPTEEKLREAVL------------HALRKTT-----YHWQE----LSYSEELSLIYMAARLDGGFAAVFRAFHEIQARIPEFRPQTLMDFGSGTGSVAWAAHRTW-GQSLREYVCVDSSAAMLGLAEKLLKGGS-ESGKPCIPGVFFRQFLPVSPKVQFDVVVSAYALSELP-SRADRIEVIQNLWRKTSHFLVLVENGTKAGHRLLMDARNLVLGEKEKSPLDLRPSFVFAPCPHELPCPQLNASKSLACSFSQAYHPIPFNWN-KKPKEEIFSMVILARGS--------PKEANRWPRITQPVLKRPRHVHCHLCCPDG 412          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Mouse
Match: Mettl17 (methyltransferase like 17 [Source:MGI Symbol;Acc:MGI:1098577])

HSP 1 Score: 147.132 bits (370), Expect = 6.222e-40
Identity = 73/188 (38.83%), Postives = 116/188 (61.70%), Query Frame = 2
Query:  521 IRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEE---KPAKIFSP 1075
            + YSE LS +Y+ ARL   FAA  + F+EI+ R P+F P    DFGSG GS AWAA+  W   +++++  VD+S  +L ++E LLK G+ +     +PG+  R +L  S  +Q+D+V+S Y+L ++      R E+I NLW KT  F+V +E GTKAG + +++AR+ ++   E      +P+ +F+P
Sbjct:   96 LSYSEELSLIYMAARLDGGFAAVFRAFHEIQARIPEFRPQTLMDFGSGTGSVAWAAHRTWG-QSLREYVCVDSSAAMLGLAEKLLKGGS-ESGKPCIPGVFFRQFLPVSPKVQFDVVVSAYALSELP-SRADRIEVIQNLWRKTSHFLVLVENGTKAGHRLLMDARNLVLGEKEKSPLDLRPSFVFAP 280          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Mouse
Match: Mettl17 (methyltransferase like 17 [Source:MGI Symbol;Acc:MGI:1098577])

HSP 1 Score: 93.2041 bits (230), Expect = 5.042e-21
Identity = 67/213 (31.46%), Postives = 100/213 (46.95%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAA-KNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLK 778
            R HP  L LP +QLP  L  A A+ +    P+R  E  + A  N+   LW R L  E            +++      +E       +S       T +   + +    RK+      Y   +    + YSE LS +Y+ ARL   FAA  + F+EI+ R P+F P    DFGSG GS AWAA+  W   +++++  VD+S  +L ++E LLK
Sbjct:   51 RKHPGILHLPHVQLPQALADA-AQLMLFERPMRSVEKQVQALTNY---LWSRHLPVEP-----------EELQRRAAYLEKKFLEKQDSAP-----TEEKLREAVLHALRKTT-----YHWQE----LSYSEELSLIYMAARLDGGFAAVFRAFHEIQARIPEFRPQTLMDFGSGTGSVAWAAHRTWG-QSLREYVCVDSSAAMLGLAEKLLK 233          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Mouse
Match: Mettl17 (methyltransferase like 17 [Source:MGI Symbol;Acc:MGI:1098577])

HSP 1 Score: 93.2041 bits (230), Expect = 5.042e-21
Identity = 67/213 (31.46%), Postives = 100/213 (46.95%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAA-KNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLK 778
            R HP  L LP +QLP  L  A A+ +    P+R  E  + A  N+   LW R L  E            +++      +E       +S       T +   + +    RK+      Y   +    + YSE LS +Y+ ARL   FAA  + F+EI+ R P+F P    DFGSG GS AWAA+  W   +++++  VD+S  +L ++E LLK
Sbjct:   51 RKHPGILHLPHVQLPQALADA-AQLMLFERPMRSVEKQVQALTNY---LWSRHLPVEP-----------EELQRRAAYLEKKFLEKQDSAP-----TEEKLREAVLHALRKTT-----YHWQE----LSYSEELSLIYMAARLDGGFAAVFRAFHEIQARIPEFRPQTLMDFGSGTGSVAWAAHRTWG-QSLREYVCVDSSAAMLGLAEKLLK 233          
BLAST of Methyltransferase-like protein 17 vs. UniProt/SwissProt
Match: sp|Q9H7H0|MET17_HUMAN (Methyltransferase-like protein 17, mitochondrial OS=Homo sapiens OX=9606 GN=METTL17 PE=1 SV=1)

HSP 1 Score: 194.126 bits (492), Expect = 1.298e-54
Identity = 133/431 (30.86%), Postives = 203/431 (47.10%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITE-KTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTEN---EEKPAKIFSPCPHSMACPK-SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIIS--YKTSGKVH-DLCQLDGSANRYFMET--ENRSLKRFIRKCEPGDFMPV 1405
            R HP  L+LP ++LP  L       L  +       +    +     LW R L  E + LQ   R+L ++            L N D      L  T +     +    RK+      Y   +    + Y+E LS +Y+ ARL   FAA  + F+EIR R P F P    DFGSG GS  WAA+S+W   +++++  VD S  +L ++E LLK G+       +PG+  R +L  S  +Q+D+V+S +SL ++      R E++  LW KTG F+V +E GTKAG   +++ARD ++   E    + +P  +F+PCPH + CP+ +  ACSF   +  +  +    + K+E  S V+L++G   + +         +PRI     K    VH  LC  DG      +      R L R  R    GD +PV
Sbjct:   50 RQHPGILKLPHVRLPQALANGAQLLLLGSAG---PTMENQVQTLTSYLWSRHLPVEPEELQRRARHLEKK-----------FLENPD------LSQTEEKLRGAVLHALRKTT-----YHWQE----LSYTEGLSLVYMAARLDGGFAAVSRAFHEIRARNPAFQPQTLMDFGSGTGSVTWAAHSIW-GQSLREYMCVDRSAAMLVLAEKLLKGGSESGE-PYIPGVFFRQFLPVSPKVQFDVVVSAFSLSELP-SKADRTEVVQTLWRKTGHFLVLVENGTKAGHSLLMDARDLVLKGKEKSPLDPRPGFVFAPCPHELPCPQLTNLACSFSQAYHPIPFSWN-KKPKEEKFSMVILARGSPEEAH--------RWPRITQPVLKRPRHVHCHLCCPDGHMQHAVLTARRHGRDLYRCARVSSWGDLLPV 439          
BLAST of Methyltransferase-like protein 17 vs. UniProt/SwissProt
Match: sp|Q3U2U7|MET17_MOUSE (Methyltransferase-like protein 17, mitochondrial OS=Mus musculus OX=10090 GN=Mettl17 PE=2 SV=2)

HSP 1 Score: 187.963 bits (476), Expect = 2.267e-52
Identity = 139/440 (31.59%), Postives = 214/440 (48.64%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAA-KNFKIVLWERALITE-KTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEE---KPAKIFSPCPHSMACPK---SKT-ACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIIS--YKTSGKVH-DLCQLDGSANRYFMET--ENRSLKRFIRKCEPGDFMPVTEKTQ 1420
            R HP  L LP +QLP  L  A A+ +    P+R  E  + A  N+   LW R L  E + LQ     L ++      L  ++S    +   +  L               RK+      Y   +    + YSE LS +Y+ ARL   FAA  + F+EI+ R P+F P    DFGSG GS AWAA+  W   +++++  VD+S  +L ++E LLK G+ +     +PG+  R +L  S  +Q+D+V+S Y+L ++      R E+I NLW KT  F+V +E GTKAG + +++AR+ ++   E      +P+ +F+PCPH + CP+   SK+ ACSF   +  +       + K+E  S V+L++G          ++   +PRI     K    VH  LC  DG      +      R L R  R    GD +PV   ++
Sbjct:   51 RKHPGILHLPHVQLPQALADA-AQLMLFERPMRSVEKQVQALTNY---LWSRHLPVEPEELQRRAAYLEKK-----FLEKQDSAPTEEKLREAVL------------HALRKTT-----YHWQE----LSYSEELSLIYMAARLDGGFAAVFRAFHEIQARIPEFRPQTLMDFGSGTGSVAWAAHRTW-GQSLREYVCVDSSAAMLGLAEKLLKGGS-ESGKPCIPGVFFRQFLPVSPKVQFDVVVSAYALSELP-SRADRIEVIQNLWRKTSHFLVLVENGTKAGHRLLMDARNLVLGEKEKSPLDLRPSFVFAPCPHELPCPQLNASKSLACSFSQAYHPIPFNWN-KKPKEEIFSMVILARGS--------PKEANRWPRITQPVLKRPRHVHCHLCCPDGHMQHAVVTARRHGRDLYRCARVSSWGDLLPVIAPSE 448          
BLAST of Methyltransferase-like protein 17 vs. UniProt/SwissProt
Match: sp|Q2TBP8|MET17_BOVIN (Methyltransferase-like protein 17, mitochondrial OS=Bos taurus OX=9913 GN=METTL17 PE=2 SV=1)

HSP 1 Score: 187.578 bits (475), Expect = 3.999e-52
Identity = 132/433 (30.48%), Postives = 210/433 (48.50%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTEN---EEKPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKG--DLSDYYTNEIRQLLSYPRIISYKTSGKVH-DLCQLDGSANRYFMET--ENRSLKRFIRKCEPGDFMPV 1405
            R HP  LQL  ++LP  L +A    L  +      +   A  N+   LW R L  E         L R+ +    L  +  L N D+ +      T K + +++    R +      Y   +    + YSE LS +Y+ ARL   FAA  + F+EI+ R P+F P    DFGSG GS  WAA+S W   +++++  VD+S  +L ++E LLK G+    +  +PG+  R +L  S  +Q+D+V++ +SL ++      R +++  LW KTG F+V IE GTKAG   +++ARD ++   E    + +P  +F+PCPH + CP+       ACSF   +  +  +    + K+E  S V+L++G  + ++ +    + +L  PR         VH  LC  DG      +      R L R  R    GD +PV
Sbjct:   52 RRHPGILQLSCVRLPQALAEAGQLLLLGSAMPNMEKQVQALTNY---LWSRHLPVEP------EELQRRAV----LLEKKILENADSCQ------TEKHHEEILHALRRTT------YHWQE----LSYSEGLSLVYMAARLDGGFAAVSRAFHEIQARLPEFQPQTLMDFGSGTGSVTWAAHSTW-GQSLREYMCVDSSAAMLELAEKLLKGGS-GSGMPCVPGVFFRQFLPVSPKVQFDVVVAAFSLSELP-SKADRTDVVQTLWRKTGHFLVLIENGTKAGHSLLMDARDLVLNGKEKSPLDPRPGFVFAPCPHELPCPQLTASKPLACSFSQAYYPIPFSWN-KKPKEEKFSLVILARGSPEKANRWPRITQPVLKRPR--------HVHCHLCCPDGHMQHAVITARRHGRDLYRCARVSSWGDLLPV 443          
BLAST of Methyltransferase-like protein 17 vs. UniProt/SwissProt
Match: sp|Q86ZU7|CO112_SCHPO (Rsm22-cox11 tandem protein 2, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox1102 PE=1 SV=2)

HSP 1 Score: 56.9954 bits (136), Expect = 3.755e-7
Identity = 81/319 (25.39%), Postives = 125/319 (39.18%), Query Frame = 2
Query:  641 NFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADI---------------QYDIVISCYSLLDIAGGYMSRREI---ITNLWN---KTGKFIVFIEQGTKAGFQAILEARDWLVASTEN---EEKPAKIFSPCPHSMACPKS------KTACSFPVK-----FEELRL-TEQIGELKQENISFVVLSKG----------------DLSDYYTNEIRQLLSYPRII--SYKTSGKV-HDLCQLDGSANRYFM-ETENRSLKRFIRKCEPGDFMPVTEKTQADS 1429
            +  D G G G  A A+ SV+P            S +++  + FL K          +  I H  Y S+S +                 Y +VI+   LL++     S +E+   + +LW+     G  +V  E+GTK GF  I  AR +L+  ++N   ++  A I +PCPH   CP           CSF        F  L +         + + S+VV+ KG                DL +        L ++PRII    K  G V  D+C  D    R  + +++ +   R  RK   GD  P+  K Q+ S
Sbjct:  176 HILDCGKGPGIGALASYSVFPTPN---------SVSIVEENPFLKK---------IIYDIHHNIYPSTSPNPTSPVTLNRLPLGKKDSYTLVIASNKLLEMK----SEKELFDYLRSLWSLVSNDGGLLVLCERGTKRGFSLIQRARTFLLQKSKNTSDKQFNAHIVAPCPHDGRCPIDIENGVRANICSFKQHFFLSPFSRLYVPRSHRRSSDRSHYSYVVIQKGITRPLNNTTQRFKNDEDLLENVNVTSPTLKNWPRIIRPPLKRDGHVIIDVCDSDARLRRNIVPKSQGKLAYRLARKSAWGDLFPLEGKVQSTS 472          
BLAST of Methyltransferase-like protein 17 vs. UniProt/SwissProt
Match: sp|Q9UTM2|CO111_SCHPO (Rsm22-cox11 tandem protein 1, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cox1101 PE=1 SV=2)

HSP 1 Score: 56.6102 bits (135), Expect = 4.165e-7
Identity = 81/319 (25.39%), Postives = 125/319 (39.18%), Query Frame = 2
Query:  641 NFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADI---------------QYDIVISCYSLLDIAGGYMSRREI---ITNLWN---KTGKFIVFIEQGTKAGFQAILEARDWLVASTEN---EEKPAKIFSPCPHSMACPKS------KTACSFPVK-----FEELRL-TEQIGELKQENISFVVLSKG----------------DLSDYYTNEIRQLLSYPRII--SYKTSGKV-HDLCQLDGSANRYFM-ETENRSLKRFIRKCEPGDFMPVTEKTQADS 1429
            +  D G G G  A A+ SV+P            S +++  + FL K          +  I H  Y S+S +                 Y +VI+   LL++     S +E+   + +LW+     G  +V  E+GTK GF  I  AR +L+  ++N   ++  A I +PCPH   CP           CSF        F  L +         + + S+VV+ KG                DL +        L ++PRII    K  G V  D+C  D    R  + +++ +   R  RK   GD  P+  K Q+ S
Sbjct:  176 HILDCGKGPGIGALASYSVFPTPN---------SVSIVEENPFLKK---------IIYDIHHNIYPSTSPNPTSPVTLNRLPLGKKDSYTLVIASNKLLEMK----SEKELFDYLRSLWSLVSNDGGLLVLCERGTKRGFSLIQRARTFLLQKSKNTSDKQFNAHIVAPCPHDGRCPIDIENGVRANICSFKQHFFLSPFSRLYVPRSHRRSSDRSHYSYVVIQKGITRPLNNTTQRFKNDEDLLENVNVTSPTLKNWPRIIRPPLKRDGHVIIDVCDSDARLRRNIVPKSQGKLAYRLARKSAWGDLFPLEGKVQSTS 472          
BLAST of Methyltransferase-like protein 17 vs. TrEMBL
Match: A0A3R7F0Y8 (Methyltransferase-like protein 17 OS=Clonorchis sinensis OX=79923 GN=Mettl17 PE=4 SV=1)

HSP 1 Score: 301.982 bits (772), Expect = 3.890e-93
Identity = 169/439 (38.50%), Postives = 255/439 (58.09%), Query Frame = 2
Query:  149 HPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLL-KDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKIFSPCPHSMACPKSKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSY-PRIISYKTSGK---VHDLCQLDGSANR--YFMETENRSLKRFIRKCEPGDFMPVTEKT--QADSLND 1438
            HPC+L LP + LP +LD+A   YLR++    P  +   A+     LW R L  +   QA  R L     SS+    E  + N D   D  L   V+ + +      RK     +K E  D+  +I YS +   LYL ARLAPNFA+ C+V YEIRKRCPKF+P N FDFGSG+G+  WA N+VWP+G +K+H + + S  +  +SEF+L K+  +K   T  PG+ HR +L +++  QYD+V+S +SL+++ G   SR  +++NLWNKT  F+V +EQGTKAGF AILEARDWLV     +      F+PCPH + C K+ + C+  V++    LT +  E   E IS++V+S+GD   + +  I +   + PR++SY  + +   VHD+C  DG+  R  +  ++ ++ L  ++R  + GD +P  ++T  + D + D
Sbjct:   46 HPCFLSLPALALPAQLDRAAINYLREHSLSSPKAIESRAELMNNYLWSRQLSFDT--QAIHRTL-----SSDGGVPE--IGNVDAC-DPELAQAVECHPEEQLTQIRKGALRKMKQEALDEWKSITYSGHNCELYLTARLAPNFASVCRVLYEIRKRCPKFIPRNLFDFGSGLGTVTWAVNTVWPVGCVKEHLMFEPSADMTRLSEFMLQKNLVVKSPETIFPGVYHRRFLPANSQ-QYDLVVSAHSLMELPGT-KSRHRVLSNLWNKTSDFLVLVEQGTKAGFTAILEARDWLVTEGGGD---VFFFAPCPHKLICGKADSVCNISVQYYPFGLTVEKNEPSTELISYLVVSRGDWRRHQSPVIEEDPQFLPRLVSYGLNSEKVLVHDICLPDGNVERTSFSKKSTDKPLYYYLRHAKAGDILPCVQRTDFEMDGMPD 469          
BLAST of Methyltransferase-like protein 17 vs. TrEMBL
Match: H2KPN9 (Methyltransferase-like protein 17 mitochondrial OS=Clonorchis sinensis OX=79923 GN=CLF_102348 PE=4 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 5.846e-93
Identity = 169/439 (38.50%), Postives = 255/439 (58.09%), Query Frame = 2
Query:  149 HPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLL-KDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKIFSPCPHSMACPKSKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSY-PRIISYKTSGK---VHDLCQLDGSANR--YFMETENRSLKRFIRKCEPGDFMPVTEKT--QADSLND 1438
            HPC+L LP + LP +LD+A   YLR++    P  +   A+     LW R L  +   QA  R L     SS+    E  + N D   D  L   V+ + +      RK     +K E  D+  +I YS +   LYL ARLAPNFA+ C+V YEIRKRCPKF+P N FDFGSG+G+  WA N+VWP+G +K+H + + S  +  +SEF+L K+  +K   T  PG+ HR +L +++  QYD+V+S +SL+++ G   SR  +++NLWNKT  F+V +EQGTKAGF AILEARDWLV     +      F+PCPH + C K+ + C+  V++    LT +  E   E IS++V+S+GD   + +  I +   + PR++SY  + +   VHD+C  DG+  R  +  ++ ++ L  ++R  + GD +P  ++T  + D + D
Sbjct:   46 HPCFLSLPALALPAQLDRAAINYLREHSLSSPKAIESRAELMNNYLWSRQLSFDT--QAIHRTL-----SSDGGVPE--IGNVDAC-DPELAQAVECHPEEQLTQIRKGALRKMKQEALDEWKSITYSGHNCELYLTARLAPNFASVCRVLYEIRKRCPKFIPRNLFDFGSGLGTVTWAVNTVWPVGCVKEHLMFEPSADMTRLSEFMLQKNLVVKSPETIFPGVYHRRFLPANSQ-QYDLVVSAHSLMELPGT-KSRHRVLSNLWNKTSDFLVLVEQGTKAGFTAILEARDWLVTEGGGD---VFFFAPCPHKLICGKADSVCNISVQYYPFGLTVENNEPSTELISYLVVSRGDWRRHQSPVIEEDPQFLPRLVSYGLNSEKVLVHDICLPDGNVERTSFSKKSTDKPLYYYLRHAKAGDILPCVQRTDFEMDGMPD 469          
BLAST of Methyltransferase-like protein 17 vs. TrEMBL
Match: A0A4V3SGH1 (Uncharacterized protein OS=Opisthorchis felineus OX=147828 GN=CRM22_002180 PE=4 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 5.373e-92
Identity = 166/430 (38.60%), Postives = 254/430 (59.07%), Query Frame = 2
Query:  149 HPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLL-KDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKIFSPCPHSMACPKSKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSY-PRIISYKTSGK---VHDLCQLDGSANR--YFMETENRSLKRFIRKCEPGDFMPVTEKT 1417
            HPC+L LP + LP +LD+A   YLR++    P  +   A+     LW R L  +   QA  R L     SS+    E  + + D   D  L   V+ + +      R+     VK E  D+  ++ YS +   LYL ARLAPNFA+ C+V YEIRKRCPKF+P N FDFGSG+G+  WA N+VWP+G +K+H + + S  +  +SEF+L K+  +K   T  PG+ HR ++ SS+   YD+V+S +SL+++ G   SR+ +++NLWN+T  F+V +EQGTKAGF AILEARDWL+  TE  E    +F+PCPH + C K+ + C+  V++    LT +  E   E IS++V+S+GD   + +  I +   + PR++SY ++ K   +HD+C  DG+  R  +   + ++ L  ++R  + GD +P  ++T
Sbjct:   46 HPCFLSLPALALPAQLDRAAINYLREHSLSSPRAIENRAELMNNYLWSRQLSFDT--QAIQRTL-----SSDGGVPE--VGDVDTC-DPELAQAVECHSEEQLTQIRQGALRKVKQEALDEWKSLTYSGHNCELYLTARLAPNFASVCRVLYEIRKRCPKFIPRNLFDFGSGLGTVTWALNTVWPVGCVKEHLMFEPSADMTRLSEFMLRKNLVVKSTETIFPGVYHRRFMPSSSQ-HYDLVVSAHSLMELPGT-KSRQRVLSNLWNRTTDFLVLVEQGTKAGFAAILEARDWLL--TEGGED-VFLFAPCPHKLLCGKAGSVCNISVQYYPFGLTMEKNEPSTELISYLVVSRGDWRRHQSPVIEEDPQFLPRLVSYGSTSKKVLMHDICLPDGNLERTTFSKRSTDKPLYYYLRHAKAGDILPCVQRT 460          
BLAST of Methyltransferase-like protein 17 vs. TrEMBL
Match: A0A5J4NKK7 (Uncharacterized protein OS=Paragonimus westermani OX=34504 GN=DEA37_0009412 PE=4 SV=1)

HSP 1 Score: 291.967 bits (746), Expect = 6.948e-89
Identity = 169/457 (36.98%), Postives = 254/457 (55.58%), Query Frame = 2
Query:  119 NGETNASV----RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTL--QAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAM-KQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKIFSPCPHSMACPKSKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSY-PRIISYKTSGK---VHDLCQLDGSANR--YFMETENRSLKRFIRKCEPGDFMPVTEKTQADS----LND 1438
            N +T  SV    R +P YL LP I LP +LD A   YLR+N    P  +   ++     LW R L++E  +  Q   +NL+   +       ++ LN T        DD  +S         R SV  S +  +++   ++ YS +   LYL ARLAPNFA++C+VFYEIRKRCPKF+P N FDFGSG+G+  WA N+VWP+G IK+H++V+ S  + ++SEF+ +   + K   T   GI HR ++ ++    YD+V+S Y+L+++  G   R   +++LW++T  F+V +EQGTKAGF AILEARDWL+     +     IF+PCPH   C K  + C+  V++    LT +  E   E IS++++S+GD   Y T  +     + PR++SY  S     +HD+C  +GS  R  +   + ++SL  F+R    GD +P  E +  D     LND
Sbjct:   57 NAQTGPSVASRLRQNPYYLSLPAIALPAQLDLAAITYLRENSLSSPKAIEDRSELLYNFLWSRPLLSESQIIHQMEAKNLSIGDVG------DSDLNLTTAVLSHHPDDLTRSR--------RSSVWKSHEMALEEW-KSLTYSGHNCELYLTARLAPNFASACRVFYEIRKRCPKFIPRNLFDFGSGLGTITWATNTVWPVGCIKEHYMVEPSADMTALSEFMFRKSLVTKTPETVFHGIYHRRFMPATKQ-TYDLVVSAYTLIELP-GLRERLRSVSSLWDRTAGFLVLVEQGTKAGFAAILEARDWLITHGGED---LFIFAPCPHKQNCGKKDSLCNIAVQYYHFGLTREKSEPLTEKISYLIVSRGDWRKYQTPVVEVDPPHLPRLVSYGISNSRPILHDVCLPNGSVERTVFPKTSTDKSLYYFVRHARAGDILPGDEASVTDETTHLLND 493          
BLAST of Methyltransferase-like protein 17 vs. TrEMBL
Match: G4LYS8 (Huntingtin interacting protein-related OS=Schistosoma mansoni OX=6183 GN=Smp_210640 PE=4 SV=1)

HSP 1 Score: 285.804 bits (730), Expect = 1.046e-86
Identity = 164/434 (37.79%), Postives = 242/434 (55.76%), Query Frame = 2
Query:  152 PCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKP-NAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLL-KDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKIFSPCPHSMACPKSKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIR-QLLSYPRIISYKTSGK---VHDLCQLDGSANRYFM--ETENRSLKRFIRKCEPGDFMPVTEKTQADS 1429
            PCYLQLP I LP RLD     YLR++    P  +   +K     LW R LI+E  +   +R  ++ + S +       L++ D  E L              + F    EA +  E+D K   ++ YS +   LYLV+RLAPNFA  C+V YEIRKRCP F+P + FDFGSG+G+ AWA N+VWP+G ++QH+LV+ S  +  +SEF+  K G+ +   +  PG+ HR ++ S+ + QY++V+   +LL+I     SR  +I++LW KT  F+VFIEQGTK+GFQAILEARD+L     N      IFSPCPH+  C K  + C+  V++    LT    E   E IS++V+SKGD   +    ++ +    PRI+++K S     +HD+C   G+  R     +  +  L  ++++   GD +P    T  DS
Sbjct:   62 PCYLQLPPISLPARLDAVAIDYLREHSLSPPKAIEDRSKILTNYLWSRPLISEGKV---IRKSSKIQDSWD-------LDSCDEDEGLVF----------ALKNFTSQHEAQISRELDLKSWKSLSYSGHTCELYLVSRLAPNFATVCRVLYEIRKRCPSFIPKSLFDFGSGLGTVAWATNTVWPVGCVRQHYLVEPSLHMTRLSEFMFQKQGSAQPFESVFPGVYHRRFMPSTKN-QYNLVVCANTLLEIPCK-SSRSRVISSLWEKTTDFLVFIEQGTKSGFQAILEARDFLRI---NGGSDVHIFSPCPHAQTCGKKDSNCNIVVRYYNFGLTRFKSEPSSELISYLVVSKGDWRRHQIPVVKPESDQLPRIVTHKLSKNDQPIHDICMPSGAVERVLFPKQQTDACLYYYMKQAHSGDIVPAEVVTTNDS 470          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Cavefish
Match: mettl17 (methyltransferase-like protein 17, mitochondrial [Source:NCBI gene;Acc:103030420])

HSP 1 Score: 159.458 bits (402), Expect = 7.563e-43
Identity = 126/447 (28.19%), Postives = 212/447 (47.43%), Query Frame = 2
Query:  143 RNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITH---RSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTE---NEEKPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQLDGSANRYFM-----ETENRSLKRFIRKCEPGDFMPVTEKTQADSLND 1438
            R HP    L T++LP+ L +     +  +     SE +   KN+   LW R    E +       L  + ++     ME   N   + ED +  D+ K   KV+ E  RK     +          +RY E L  +YL ARLA ++AA+ +   EI+KR   F P +  DFGSG+G+  WA++S W   ++K++  VDAS  + +++E LL  G+ K      P I H   R +L  S  +Q D+V++ +SL +++     R + +  LW KT  ++V +E GTK G   ++EARD L+   E   ++ +   +F+PC H ++CPK        C+F   +  L L    GE +QE  S++++ + +       +  +L+ + R+ +       H  CQ+  S  +            R + R  R  + GD +P T  T+ ++L +
Sbjct:   46 RKHPGVTNLKTVRLPEDLQRGALMLIHKSEVKDLSERSSKLKNY---LWSRKRAVEAS------ELREKAVTLERKLMEK--NQQKDGEDSSTSDS-KIRKKVLYE-LRKMTYHWM---------PLRYDEELGVVYLAARLAGSYAAAIRALNEIKKRDQMFAPCSLLDFGSGLGTVLWASHSHWG-DSLKEYVCVDASGAMNTLAEQLLSGGSEKG-----PLIKHAYFRQFLPVSPKVQSDLVVAAFSLSELS-TQKEREDTVLTLWRKTNTYLVLVENGTKQGHHILMEARDVLLKKQEKVLHDFRRPVVFAPCTHELSCPKLLNQPVVPCNFLQSYCPLPLPGS-GETEQEKFSYLIMCREEKQVEKPGQT-ELVQWGRLTAPVHRRTRHVQCQICSSTGKLKQLAVTPRKHGRDMYRCARSSDWGDRLP-TISTEDNALTE 460          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Cavefish
Match: ENSAMXT00000042434.1 (pep primary_assembly:Astyanax_mexicanus-2.0:APWO02000911.1:52074:60599:1 gene:ENSAMXG00000043327.1 transcript:ENSAMXT00000042434.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 141.354 bits (355), Expect = 1.153e-35
Identity = 99/312 (31.73%), Postives = 158/312 (50.64%), Query Frame = 2
Query:  227 NVPLRPSE---LTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITH---RSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTE---NEEKPAKIFSPCPHSMACPKSKTACSFPVKF 1135
            ++PL+ SE   L+  +   K  LW R    E +       L  + ++     ME   N   + ED +  D+ K   KV+ E  RK     + Y        +RY E L  +YL ARLA ++AA+ +   EI+KR   F P +  DFGSG+G+  WA++S W   ++K++  VDAS  + +++E LL  G+ K      P I H   R +L  S  +Q D+V++ +SL +++     R + +  LW KT  ++V +E GTK G   ++EARD L+   E   ++ +   +F+PC H ++CPK       P  F
Sbjct:  259 HLPLKESEVKDLSERSSKLKNYLWSRKRAVEAS------ELREKAVTLERKLMEK--NQQKDGEDSSTSDS-KIRKKVLYE-LRK-----MTYHW----MPLRYDEELGVVYLAARLAGSYAAAIRALNEIKKRDQMFAPCSLLDFGSGLGTVLWASHSHWG-DSLKEYVCVDASGAMNTLAEQLLSGGSEKG-----PLIKHAYFRQFLPVSPKVQSDLVVAAFSLSELSTQ-KEREDTVLTLWRKTNTYLVLVENGTKQGHHILMEARDVLLKKQEKVLHDFRRPVVFAPCTHELSCPKLLNQPVVPCNF 544          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Sea Lamprey
Match: mettl17 (methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GENE-031118-203])

HSP 1 Score: 164.466 bits (415), Expect = 6.090e-46
Identity = 91/316 (28.80%), Postives = 163/316 (51.58%), Query Frame = 2
Query:  521 IRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVAST--ENEEKPAKIFSPCPHSMACPKSKT----ACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQL---DGSANR--YFMETENRSLKRFIRKCEPGDFMPVTEKTQADSLN 1435
            +RY E++S  ++ AR+    AA+ +   EI+KR P F P +  DFGSG GS+ WAA+  W  G+I  H+ VD S  +  +++ LL++G  +   + +  +  R +L  S  ++YD+V++ +SL ++ G    R   + +LW +T  F+V IE GT +G+  +++ARD L+  T  +N+E    +F+PC H + CP++       C+F   ++      ++   + E  S+++  +G+          Q+  +PRI+        H  C +   +G+     +  +   R L R IR C+ GD +P  +    D  N
Sbjct:   78 LRYDEDMSLTFMAARMGGCHAATVRALTEIKKRVPDFCPTSLLDFGSGTGSSVWAAHETWS-GSIGDHYCVDVSPAMNKLADMLLREG-QENATSVIERVYFRQFLPPSK-VRYDVVVAAFSLSEL-GSATDRLSTVLSLWQRTNSFLVLIENGTLSGYTILMQARDALLQETDEQNKENQGHVFAPCSHGLQCPRTLARKLIPCNFTQNYQPFDFESKLHPSRTEKFSYLIFRRGE------ENAEQV--WPRILQPVKCRTRHAHCHMCCSNGAIEHIVFTRQRHGRDLYRSIRHCKVGDRVPTDQLDFKDKSN 381          
BLAST of Methyltransferase-like protein 17 vs. Ensembl Medaka
Match: mettl17 (methyltransferase like 17 [Source:NCBI gene;Acc:101165423])

HSP 1 Score: 176.407 bits (446), Expect = 5.287e-49
Identity = 132/458 (28.82%), Postives = 221/458 (48.25%), Query Frame = 2
Query:  113 IINGETNASVRNHPCYLQLPTIQLPDRLDKAVAKYLRD----NVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQK-ISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITH---RSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTE---NEEKPAKIFSPCPHSMACPK----SKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIIS--YKTSGKVH-DLCQLDGSANRYFM--ETENRSLKRFIRKCEPGDFMPVTEKTQAD 1426
             + GE +   R HP    L T +LP+ L  A    +       +P R  +LT    NF   LW R    E           RQK +S      E ++  T++ ++ AL+D ++   +V SE  +K    +           ++Y E +  +Y+ +RLA  +AA  +V  EI+KR P F P    DFGSG+G+ AWA++S+W    +++   VD+S  + +++E LLK    +    A P I H   R +L  S  +Q+D+V++ ++L ++      R E    LW KT  ++V +E GTK G Q ++EARD L+   E   ++ +P+ +F+PCPH+M CPK     K  C+F  ++  L L     + + EN S+++L +    +    E  + +++ R+I    + +  VH   C   G      +     +R + R  R  + GD +PV +    D
Sbjct:   37 FLKGELH---RKHPGLTNLKTQRLPETLQMAALSVIHRAQIAQLPGRSQKLT----NF---LWSRKRAVEDLT-------VRQKALSLEKDLWEKAMQRTEDFDEKALEDKIRR--RVFSELRKKIYHWT----------PLKYDEEMGVVYMASRLAGGYAAVRRVLNEIKKRDPSFSPQTLLDFGSGLGTVAWASHSLWG-DFLREMVCVDSSGPMNTLAERLLKGDDER----AEPHIKHVYFRQFLPVSPKVQFDLVVAAFTLSELP-TMKDREEASFTLWRKTSSYLVLVENGTKEGHQMLMEARDTLLKRQEKTVHDPRPSSVFAPCPHAMTCPKLAQEPKAPCNFQQQYHPLSLPGH-KDCQTENFSYLILRR----EGPVEEKAEAVTWSRLIGPVLRRTRHVHCRTCSPHGELKHVVVTARKHSRDVYRCARNSQWGDLLPVVQNLDED 454          
BLAST of Methyltransferase-like protein 17 vs. Planmine SMEST
Match: SMESG000058279.1 (SMESG000058279.1)

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 443/443 (100.00%), Postives = 443/443 (100.00%), Query Frame = 2
Query:  110 MIINGETNASVRNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKIFSPCPHSMACPKSKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQLDGSANRYFMETENRSLKRFIRKCEPGDFMPVTEKTQADSLND 1438
            MIINGETNASVRNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKIFSPCPHSMACPKSKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQLDGSANRYFMETENRSLKRFIRKCEPGDFMPVTEKTQADSLND
Sbjct:    1 MIINGETNASVRNHPCYLQLPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKTLQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETFRKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRKRCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISEFLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMSRREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKIFSPCPHSMACPKSKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDLSDYYTNEIRQLLSYPRIISYKTSGKVHDLCQLDGSANRYFMETENRSLKRFIRKCEPGDFMPVTEKTQADSLND 443          
The following BLAST results are available for this feature:
BLAST of Methyltransferase-like protein 17 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
METTL172.704e-5530.86methyltransferase like 17 [Source:HGNC Symbol;Acc:... [more]
METTL172.887e-5329.84methyltransferase like 17 [Source:HGNC Symbol;Acc:... [more]
METTL176.039e-5231.25methyltransferase like 17 [Source:HGNC Symbol;Acc:... [more]
METTL173.386e-2041.28methyltransferase like 17 [Source:HGNC Symbol;Acc:... [more]
METTL174.845e-1545.95methyltransferase like 17 [Source:HGNC Symbol;Acc:... [more]
back to top
BLAST of Methyltransferase-like protein 17 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
F32A7.45.869e-2222.75pep chromosome:WBcel235:I:14839856:14843128:1 gene... [more]
back to top
BLAST of Methyltransferase-like protein 17 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG131267.163e-3730.17gene:FBgn0032168 transcript:FBtr0343747[more]
CG131267.163e-3730.17gene:FBgn0032168 transcript:FBtr0079892[more]
back to top
BLAST of Methyltransferase-like protein 17 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mettl172.404e-5429.41methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GEN... [more]
mettl172.404e-5429.41methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GEN... [more]
mettl173.323e-5030.02methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GEN... [more]
mettl173.774e-3330.36methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GEN... [more]
mettl171.263e-1731.96methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Methyltransferase-like protein 17 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
spag79.890e-5530.29sperm associated antigen 7 [Source:Xenbase;Acc:XB-... [more]
spag71.275e-5430.91sperm associated antigen 7 [Source:Xenbase;Acc:XB-... [more]
spag71.544e-5430.91sperm associated antigen 7 [Source:Xenbase;Acc:XB-... [more]
spag72.099e-5430.91sperm associated antigen 7 [Source:Xenbase;Acc:XB-... [more]
spag74.305e-5430.16sperm associated antigen 7 [Source:Xenbase;Acc:XB-... [more]
back to top
BLAST of Methyltransferase-like protein 17 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mettl173.241e-5331.59methyltransferase like 17 [Source:MGI Symbol;Acc:M... [more]
Mettl171.523e-5032.43methyltransferase like 17 [Source:MGI Symbol;Acc:M... [more]
Mettl176.222e-4038.83methyltransferase like 17 [Source:MGI Symbol;Acc:M... [more]
Mettl175.042e-2131.46methyltransferase like 17 [Source:MGI Symbol;Acc:M... [more]
Mettl175.042e-2131.46methyltransferase like 17 [Source:MGI Symbol;Acc:M... [more]
back to top
BLAST of Methyltransferase-like protein 17 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9H7H0|MET17_HUMAN1.298e-5430.86Methyltransferase-like protein 17, mitochondrial O... [more]
sp|Q3U2U7|MET17_MOUSE2.267e-5231.59Methyltransferase-like protein 17, mitochondrial O... [more]
sp|Q2TBP8|MET17_BOVIN3.999e-5230.48Methyltransferase-like protein 17, mitochondrial O... [more]
sp|Q86ZU7|CO112_SCHPO3.755e-725.39Rsm22-cox11 tandem protein 2, mitochondrial OS=Sch... [more]
sp|Q9UTM2|CO111_SCHPO4.165e-725.39Rsm22-cox11 tandem protein 1, mitochondrial OS=Sch... [more]
back to top
BLAST of Methyltransferase-like protein 17 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A3R7F0Y83.890e-9338.50Methyltransferase-like protein 17 OS=Clonorchis si... [more]
H2KPN95.846e-9338.50Methyltransferase-like protein 17 mitochondrial OS... [more]
A0A4V3SGH15.373e-9238.60Uncharacterized protein OS=Opisthorchis felineus O... [more]
A0A5J4NKK76.948e-8936.98Uncharacterized protein OS=Paragonimus westermani ... [more]
G4LYS81.046e-8637.79Huntingtin interacting protein-related OS=Schistos... [more]
back to top
BLAST of Methyltransferase-like protein 17 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mettl177.563e-4328.19methyltransferase-like protein 17, mitochondrial [... [more]
ENSAMXT00000042434.11.153e-3531.73pep primary_assembly:Astyanax_mexicanus-2.0:APWO02... [more]
back to top
BLAST of Methyltransferase-like protein 17 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl176.090e-4628.80methyltransferase like 17 [Source:ZFIN;Acc:ZDB-GEN... [more]
back to top
BLAST of Methyltransferase-like protein 17 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransferase-like protein 17 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Methyltransferase-like protein 17 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mettl175.287e-4928.82methyltransferase like 17 [Source:NCBI gene;Acc:10... [more]
back to top
BLAST of Methyltransferase-like protein 17 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000058279.10.000e+0100.00SMESG000058279.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023484 ID=SMED30023484|Name=Methyltransferase-like protein 17|organism=Schmidtea mediterranea sexual|type=transcript|length=1599bp
TTTTATATAAAATTGAATGGCAACAAAACTTGCAGAAAACCTTTTTAATA
TCAATAATATAAAATCAGCTAATAAACTGCTGAAAGTATGTCCTAAGTTT
GAAAAGTATATGATAATCAATGGTGAAACAAATGCATCAGTACGTAATCA
TCCATGTTACCTTCAATTACCTACTATTCAATTGCCAGATAGATTAGACA
AAGCAGTTGCAAAATACTTGCGTGATAATGTTCCATTAAGACCAAGTGAA
TTAACAATCGCAGCTAAAAATTTTAAAATTGTTCTGTGGGAAAGAGCTCT
AATAACTGAGAAAACTTTACAAGCGCATGTTCGAAATCTCGCAAGGCAGA
AAATCTCTTCCAATATGCTTGCAATGGAAAACTCATTAAATAATACTGAC
AATTCTGAAGATTTAGCTCTCGACGATACCGTCAAATCCAATGTTAAAGT
CATCTCTGAAACGTTCAGGAAAAGCGTAGAAGCATCTGTCAAATACGAAA
TAGACGATAAGCCGAATGCTATTCGATATTCGGAAAATCTATCGAATTTG
TATTTGGTCGCTCGGTTAGCCCCAAATTTTGCAGCAAGTTGCAAAGTTTT
CTATGAAATTCGCAAACGATGTCCAAAATTCATGCCCGTGAATTTTTTTG
ATTTCGGATCTGGAATCGGTAGTGCAGCCTGGGCAGCCAATAGTGTTTGG
CCAATAGGTACAATAAAGCAGCATTTTCTTGTAGACGCGTCAACAACTTT
GTTGTCGATTTCAGAATTTCTATTAAAAGACGGGGCAATGAAACAGCATT
TGACAGCTTTGCCAGGGATAACCCATCGGTCTTATTTGTCTAGTTCAGCG
GACATTCAATATGACATAGTTATCAGTTGCTACAGTTTGCTCGATATTGC
AGGTGGATATATGAGTCGACGAGAAATTATCACAAATCTATGGAATAAAA
CCGGGAAATTCATTGTCTTCATAGAACAAGGTACAAAAGCCGGTTTTCAA
GCAATACTCGAAGCAAGAGACTGGCTTGTGGCTAGCACGGAAAATGAGGA
AAAACCCGCTAAAATATTTTCTCCGTGTCCTCATTCTATGGCTTGTCCAA
AATCTAAAACTGCTTGTAGTTTTCCAGTGAAATTTGAAGAGTTACGTTTA
ACAGAGCAAATTGGAGAATTAAAACAAGAAAATATTTCATTTGTGGTTTT
AAGTAAAGGCGACTTATCAGATTATTATACTAATGAAATCAGGCAATTAT
TATCATATCCGAGAATAATTTCCTATAAAACATCTGGAAAGGTGCATGAC
CTTTGCCAATTGGACGGCAGTGCTAATCGATACTTCATGGAAACGGAAAA
CAGGTCTTTGAAACGATTCATTCGAAAATGCGAACCCGGTGATTTTATGC
CAGTCACAGAAAAAACGCAGGCTGATTCATTAAATGACTGATGTTATGAA
TTAATCAATACAAGAATAAATTTAATACCAACAATTGAATTCAAATAATT
ATTGTGTGTATGCTAGAAATTTGTAATTGTGTGTGTGCTTACACATTCCG
CACACGTTCGAAGATCATAGAGATGCACTATTACAGCGAGATCGGAAGA
back to top

protein sequence of SMED30023484-orf-1

>SMED30023484-orf-1 ID=SMED30023484-orf-1|Name=SMED30023484-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=475bp
MATKLAENLFNINNIKSANKLLKVCPKFEKYMIINGETNASVRNHPCYLQ
LPTIQLPDRLDKAVAKYLRDNVPLRPSELTIAAKNFKIVLWERALITEKT
LQAHVRNLARQKISSNMLAMENSLNNTDNSEDLALDDTVKSNVKVISETF
RKSVEASVKYEIDDKPNAIRYSENLSNLYLVARLAPNFAASCKVFYEIRK
RCPKFMPVNFFDFGSGIGSAAWAANSVWPIGTIKQHFLVDASTTLLSISE
FLLKDGAMKQHLTALPGITHRSYLSSSADIQYDIVISCYSLLDIAGGYMS
RREIITNLWNKTGKFIVFIEQGTKAGFQAILEARDWLVASTENEEKPAKI
FSPCPHSMACPKSKTACSFPVKFEELRLTEQIGELKQENISFVVLSKGDL
SDYYTNEIRQLLSYPRIISYKTSGKVHDLCQLDGSANRYFMETENRSLKR
FIRKCEPGDFMPVTEKTQADSLND*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0002032epidermal cell
PLANA:0002109X1 cell
Vocabulary: INTERPRO
TermDefinition
IPR015324Ribosomal_Rsm22-like
Vocabulary: biological process
TermDefinition
GO:0006412translation
GO:0032259methylation
Vocabulary: molecular function
TermDefinition
GO:0008168methyltransferase activity
GO:0016740transferase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR015324Ribosomal protein Rsm22-likePFAMPF09243Rsm22coord: 175..458
e-value: 3.2E-44
score: 151.2
NoneNo IPR availablePANTHERPTHR21320:SF0METHYLTRANSFERASE-LIKE PROTEIN 17, MITOCHONDRIALcoord: 38..465
NoneNo IPR availablePANTHERPTHR21320CYTOCHROME C OXIDASE ASSEMBLY PROTEIN COX11-RELATEDcoord: 38..465