INX-13

Overview
NameINX-13 (AFD29613.1)
Smed IDSMED30023483
Length (bp)1464
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of INX-13 (SMED30023483) t-SNE clustered cells

Violin plots show distribution of expression levels for INX-13 (SMED30023483) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of INX-13 (SMED30023483) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for INX-13 (SMED30023483) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023483

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 16

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
X1 cellSMED30023483SMESG000043575.1 SmedASXL_013857SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
X2 cellSMED30023483SMESG000043575.1 SmedASXL_013857SmedAsxl_ww_GCZZ01PMID:26114597
Zhu et al., 2015
FACS sorted cell population asexual adult RNA-sequencing evidence
pharynxSMED30023483SMESG000043575.1 dd_Smed_v4_11501_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
nervous systemSMED30023483SMESG000043575.1 dd_Smed_v4_11501_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023483SMESG000043575.1 dd_Smed_v4_11501_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023483SMESG000043575.1 dd_Smed_v4_11501_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
parenchymaSMED30023483SMESG000043575.1 dd_Smed_v4_11501_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
sigma neoblastSMED30023483SMESG000043575.1 JQ425145smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
gamma neoblastSMED30023483SMESG000043575.1 JQ425145smed_ncbi_20200123PMID:25017721
van Wolfswinkel et al., 2014
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
neuronSMED30023483SMESG000043575.1 Contig50609newmark_estsPMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
neuronSMED30023483SMESG000043575.1 Contig50609uc_Smed_v2PMID:27612384
Roberts-Galbraith et al., 2016
whole organism asexual adult colorimetric in situ hybridization evidence
pharynx musculatureSMED30023483SMESG000043575.1 dd_Smed_v4_11501_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
zeta neoblastSMED30023483SMESG000043575.1 dd_Smed_v4_11501_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
neoblastSMED30023483SMESG000043575.1 SMED_28576_V2_1GPL14150PMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023483SMESG000043575.1 SMED_28576_V2_1GPL14150_gene_modelsPMID:22385657
Wagner et al., 2012
whole organism asexual adult cDNA to DNA expression microarray evidence
neoblastSMED30023483SMESG000043575.1 SMED30023483smed_20140614PMID:22385657
Wagner et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of INX-13 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 187.578 bits (475), Expect = 1.592e-54
Identity = 110/393 (27.99%), Postives = 203/393 (51.65%), Query Frame = 3
Query:  147 EDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQS 1325
            +DF D+ N+     ++    +IVS +QY   PI C++ +       E Y  N CWVE T  L  ++  P +  D +  Q   ++YYQW+PFVL+L+A+ +Y+P + W+ + +   G++++ L + A DA   D + R   ++ I+ ++E  L   R++  +              KR  N +   Y  IK+ Y+    +Q+ ++  FL  +       +G  ILR++L+G++W  +  FPRV MC   +  +GN ++   QC+L INM NEKI++FL+F+   V F++ +S+  WI            +++ L+ TD   +     ++ + +FV +FL  DG F +RM+S + GD+  + ++  L+           +  +R+++I+    +S
Sbjct:   19 DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPA-QFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQ---ISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQ--------KRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNL----FYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATD-----RQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH----------NFNDRVRKIQFNSTES 380          
BLAST of INX-13 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 187.578 bits (475), Expect = 1.592e-54
Identity = 110/393 (27.99%), Postives = 203/393 (51.65%), Query Frame = 3
Query:  147 EDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQS 1325
            +DF D+ N+     ++    +IVS +QY   PI C++ +       E Y  N CWVE T  L  ++  P +  D +  Q   ++YYQW+PFVL+L+A+ +Y+P + W+ + +   G++++ L + A DA   D + R   ++ I+ ++E  L   R++  +              KR  N +   Y  IK+ Y+    +Q+ ++  FL  +       +G  ILR++L+G++W  +  FPRV MC   +  +GN ++   QC+L INM NEKI++FL+F+   V F++ +S+  WI            +++ L+ TD   +     ++ + +FV +FL  DG F +RM+S + GD+  + ++  L+           +  +R+++I+    +S
Sbjct:   19 DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPA-QFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQ---ISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQ--------KRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDNL----FYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATD-----RQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH----------NFNDRVRKIQFNSTES 380          
BLAST of INX-13 vs. Ensembl Celegans
Match: inx-1 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394])

HSP 1 Score: 187.578 bits (475), Expect = 4.954e-54
Identity = 107/367 (29.16%), Postives = 193/367 (52.59%), Query Frame = 3
Query:  147 EDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFE 1247
            +DF D+ N+     ++    +IVS +QY   PI C++ +       E Y  N CWVE T  L  ++  P +  D +  Q   ++YYQW+PFVL+L+A+ +Y+P + W+ + +   G++++ L + A DA   D + R   ++ I+ ++E  L   R++  +              KR  N +   Y  IK+ Y+    +Q+ ++  FL  +       +G  ILR++L+G++W  +  FPRV MC   +  +GN ++   QC+L INM NEKI++FL+F+   V F++ +S+  WI            +++ L+ TD   +     ++ + +FV +FL  DG F +RM+S + GD+  + ++  L+ 
Sbjct:   19 DDFVDKLNYHYTSAIIFAFAIIVSAKQYVGYPIQCWVPA-QFTDAWEQYTENYCWVENTYYLPLTSAFPLEYGDRRARQ---ISYYQWVPFVLALEALCFYIPCIMWRGLLHWHSGINVQSLTQMACDARMMDADARAATVQTIAGHMEDALEIQREVTDVSGMCVQ--------KRWANYVTLLYVFIKMLYLGNVVLQVFMLNSFLGTDN----LFYGFHILRDLLNGREWEVSGNFPRVTMCDFEVRVLGNVHHHTVQCVLMINMFNEKIFLFLWFWYFMVAFVSAVSMFHWIIISFLPGQHMKFIRKYLRATDLATD-----RQSVKKFVHKFLGYDGVFCMRMISAHAGDILATELIVALWH 364          
BLAST of INX-13 vs. Ensembl Celegans
Match: inx-13 (Innexin [Source:UniProtKB/TrEMBL;Acc:O44887])

HSP 1 Score: 182.956 bits (463), Expect = 1.116e-52
Identity = 113/372 (30.38%), Postives = 197/372 (52.96%), Query Frame = 3
Query:  141 GLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSY-YFLIKIAYISVGFIQLLIMFHFLKLNRKEG--YQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFE 1247
            G +D  DR N+    ++L+I  L +S +QY   PI C+I +   G+  E Y  N C+V+ T  ++    +P    D    +   + YYQW+PF+L LQA+L+YLP LFW+++ +N  G+ L++++  A  A+  D++ R +  +    ++   L           T+ +R  ++      G   ++Y Y  +K  Y+      + I+F F+ LN   G  Y  +G  IL +IL+G++W E+  FPRV MC   +  +GN +    QC+L INM NEK+Y+FL+F+L  V   T ++L  W  ++  R  +K  +K  L++ D   + +    + +D+FV   L+ DG FI  ++  N G + +  V+  +++
Sbjct:   15 GDDDSIDRLNYYWTPMLLVIFALTLSAKQYVGQPIQCWIPAQFTGA-WEQYSENYCFVQNTYFISPDKYIPDSEID---REGAEIGYYQWVPFILGLQAILFYLPSLFWRLMNFNS-GVALKKMLFGAKKADRVDEKARNEAAKSTGAHLYESL-----------TLQSRFAKYTSAFTYGGSYLTYLYLFVKFLYL------VQIVFQFIILNNFLGTSYTFWGLGILSDILNGREWEESGHFPRVTMCDFEVRVLGNKHRHTVQCVLMINMFNEKVYVFLWFWLVIVGVATFLNLVNWTRKLMFRSARKAHIKSYLQIEDNFSDDNSRNGQILDKFVDYKLKSDGVFITHLIDNNGGSVFSHDVIVDMWD 364          
BLAST of INX-13 vs. Ensembl Celegans
Match: inx-18 (Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8])

HSP 1 Score: 184.111 bits (466), Expect = 1.210e-52
Identity = 115/411 (27.98%), Postives = 214/411 (52.07%), Query Frame = 3
Query:  147 EDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNR---IGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVG-NRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYA-----EIDLRNRIKRIENEEYQSECGSSTFMK 1352
            +DF DR ++     ++L+  ++VS +QY  +PI C++ +       E Y  N CWV+ T  + F   +PH+L+D    ++ ++ YYQW+PFVL++ A+ +++P   W+++        G+ L+ +  D N     D   R K ++ ++R+I+  L   R     + +V    IF+   GK  G  + S Y  IK  +++   +Q +++  FL+      Y +FG  +L ++  G++W ++  FPRV +C   +  +GN +    QC+L INML EKI+IFL+ +L+ +  +T ++L  W   +     ++H V + L      ++ DQ     I RFV  FLR DG F+++M++ + G+L  + V  +L+ I+           +I+ R  ++     +++S     T +K
Sbjct:   25 DDFVDRLHYLYTSTMVLMFAVLVSAKQYVGHPIECFVPA-QFTRAMEQYTENYCWVQNTYWVPFQDLIPHRLDD---RERRQIGYYQWVPFVLAVAALTFHIPSSVWRMLAGQSGLNAGLVLQLVCGDEN----VDPVVRDKTVDIVARHIDDALMYQRDHGARRHSVYIFAIFK--LGKFYGAYVSSVYIFIKALHLANVILQFMLLNSFLQ---TSDYPMFGAHVLYDLFMGREWRDSGKFPRVTLCDFEIRVLGNVHRHTVQCVLVINMLTEKIFIFLWLWLTVLAIVTALNLIFWFIALVSNSCREHFVSKHLD-----IQSDQ-----ISRFVHRFLRADGVFLLQMIASHSGNLMAAKVTEQLWMIFVRRSGKPVIEDKIEDRGSVRSTNGNDWESHDDGKTSLK 412          
BLAST of INX-13 vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0301860)

HSP 1 Score: 86.2705 bits (212), Expect = 4.057e-18
Identity = 80/316 (25.32%), Postives = 138/316 (43.67%), Query Frame = 3
Query:  162 RANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGT--VPLNFSA----KVPHKLEDWKLLQQDRMNY---YQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDAND--ANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDW---TETQVFPRVGMCR-NALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQK 1064
            R +++  +I+L+   L+V+ RQY  +PI C +  +P G      +   CW+  T  VP   +      V        +  +D + Y   YQW+ FVL  QA+L+Y+P+  W+     R+ M    LV D N    N E    R+KI+                   +   +GN + RH       N     +F+ +    ++ F+ ++   +F+       +  +G  +L+      D       +VFP+V  C  +     G+       C+LP+N++NEKIY+FL+F+    + ++IMS    IYR+      K
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKM----LVMDLNSPIVNDECKNDRKKIL-------------------VDYFIGN-LNRH-------NFYAFRFFVCE----ALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWF---IILSIMSGISLIYRIAVVAGPK 297          
BLAST of INX-13 vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071005)

HSP 1 Score: 86.2705 bits (212), Expect = 4.057e-18
Identity = 80/316 (25.32%), Postives = 138/316 (43.67%), Query Frame = 3
Query:  162 RANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGT--VPLNFSA----KVPHKLEDWKLLQQDRMNY---YQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDAND--ANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDW---TETQVFPRVGMCR-NALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQK 1064
            R +++  +I+L+   L+V+ RQY  +PI C +  +P G      +   CW+  T  VP   +      V        +  +D + Y   YQW+ FVL  QA+L+Y+P+  W+     R+ M    LV D N    N E    R+KI+                   +   +GN + RH       N     +F+ +    ++ F+ ++   +F+       +  +G  +L+      D       +VFP+V  C  +     G+       C+LP+N++NEKIY+FL+F+    + ++IMS    IYR+      K
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKM----LVMDLNSPIVNDECKNDRKKIL-------------------VDYFIGN-LNRH-------NFYAFRFFVCE----ALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWF---IILSIMSGISLIYRIAVVAGPK 297          
BLAST of INX-13 vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0332314)

HSP 1 Score: 86.2705 bits (212), Expect = 4.057e-18
Identity = 80/316 (25.32%), Postives = 138/316 (43.67%), Query Frame = 3
Query:  162 RANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGT--VPLNFSA----KVPHKLEDWKLLQQDRMNY---YQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDAND--ANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDW---TETQVFPRVGMCR-NALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQK 1064
            R +++  +I+L+   L+V+ RQY  +PI C +  +P G      +   CW+  T  VP   +      V        +  +D + Y   YQW+ FVL  QA+L+Y+P+  W+     R+ M    LV D N    N E    R+KI+                   +   +GN + RH       N     +F+ +    ++ F+ ++   +F+       +  +G  +L+      D       +VFP+V  C  +     G+       C+LP+N++NEKIY+FL+F+    + ++IMS    IYR+      K
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKM----LVMDLNSPIVNDECKNDRKKIL-------------------VDYFIGN-LNRH-------NFYAFRFFVCE----ALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWF---IILSIMSGISLIYRIAVVAGPK 297          
BLAST of INX-13 vs. Ensembl Fly
Match: Inx2 (gene:FBgn0027108 transcript:FBtr0071006)

HSP 1 Score: 86.2705 bits (212), Expect = 4.057e-18
Identity = 80/316 (25.32%), Postives = 138/316 (43.67%), Query Frame = 3
Query:  162 RANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGT--VPLNFSA----KVPHKLEDWKLLQQDRMNY---YQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDAND--ANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDW---TETQVFPRVGMCR-NALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQK 1064
            R +++  +I+L+   L+V+ RQY  +PI C +  +P G      +   CW+  T  VP   +      V        +  +D + Y   YQW+ FVL  QA+L+Y+P+  W+     R+ M    LV D N    N E    R+KI+                   +   +GN + RH       N     +F+ +    ++ F+ ++   +F+       +  +G  +L+      D       +VFP+V  C  +     G+       C+LP+N++NEKIY+FL+F+    + ++IMS    IYR+      K
Sbjct:   25 RMHYKATVIILIAFSLLVTSRQYIGDPIDCIVDEIPLGV-----MDTYCWIYSTFTVPERLTGITGRDVVQPGVGSHVEGEDEVKYHKYYQWVCFVLFFQAILFYVPRYLWKSWEGGRLKM----LVMDLNSPIVNDECKNDRKKIL-------------------VDYFIGN-LNRH-------NFYAFRFFVCE----ALNFVNVIGQIYFVDFFLDGEFSTYGSDVLKFTELEPDERIDPMARVFPKVTKCTFHKYGPSGSVQTHDGLCVLPLNIVNEKIYVFLWFWF---IILSIMSGISLIYRIAVVAGPK 297          
BLAST of INX-13 vs. Ensembl Fly
Match: zpg (gene:FBgn0024177 transcript:FBtr0076983)

HSP 1 Score: 72.7886 bits (177), Expect = 1.218e-13
Identity = 80/308 (25.97%), Postives = 131/308 (42.53%), Query Frame = 3
Query:  180 NIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGT--------VPLNFSAKVPHKLEDWKLLQQDRMNY---YQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETR---RKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSG--KDWT--ETQVFPRVGMCR-NALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVT 1046
             + +LL C  ++S +QYF +PI C+      G    DY+   CW+ G          PL   A         K++  +  NY   YQW+  VL L++ ++Y+P   W+I      G  L+ L  D +      D++R   R ++ + S +              KET     FR+          VSY F  +I  +S+  +  L++  F       G+       L ++ +G    W      VFP+   C        G++N     CLLP+N+LNEKI+ FL+ +   +L   ++SL   +YR+ 
Sbjct:   31 TVALLLACTFLLSSKQYFGDPIQCF------GDKDMDYVHAFCWIYGAYVSDNVTVTPLRNGAAQCRPDAVSKVVPPENRNYITYYQWVVLVLLLESFVFYMPAFLWKIWE----GGRLKHLCDDFHKMAVCKDKSRTHLRVLVNYFSSDY-------------KETH----FRY---------FVSYVF-CEILNLSISILNFLLLDVFFG-----GFWGRYRNALLSLYNGDYNQWNIITMAVFPKCAKCEMYKGGPSGSSNIYDYLCLLPLNILNEKIFAFLWIWF--ILVAMLISLKF-LYRLA 293          
BLAST of INX-13 vs. UniProt/SwissProt
Match: sp|O01393|UNC9_CAEEL (Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN=unc-9 PE=1 SV=1)

HSP 1 Score: 182.185 bits (461), Expect = 2.303e-51
Identity = 111/372 (29.84%), Postives = 201/372 (54.03%), Query Frame = 3
Query:  147 EDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRI--FRHVPGKRNGNLLVSY-YFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIY 1253
            +D  D+ N+     ++ +  ++VS +QY   PI C++ +       E Y  N CWV+ T  L     +PH   +    +  ++ YYQW+PFVL+L+A+L+Y+P + W+++++   G+ ++ LV+ A D+   D E+R + ++ I+ N+E  L+   ++ +     GNR+     +   R+    V++ Y  +KI Y      Q+ ++  FL  NR + Y   G ++L ++++G++W E+  FPRV +C   ++ +GN +    QC+L INM NEKI++FL+F+   +   T+ SL  WIY       Q + V + L   +    +     + + RFV  FLRQDG F++RM++ + G+L    +   L+  Y
Sbjct:   21 DDIIDKLNYYYTTAIITVFAILVSAKQYVGFPIQCWVPAT-FTEPMEQYTENYCWVQNTYFLPLHDYIPHNYAE---RENRQIGYYQWVPFVLALEALLFYVPTIVWRLLSWQS-GIHVQSLVQMACDSRLLDLESRNRALQTIATNVEEALHVKHQVMS-----GNRLKLLNLIICTRSSGAAVTFLYISVKILYTVNIVGQIFLLNTFLG-NRSKWY---GLQVLNDLMNGREWEESGHFPRVTLCDFEVKVLGNVHRHTVQCVLMINMFNEKIFLFLWFWYFLLAGATLCSLFYWIYISVVPSRQLNFVGKYLTGIE---GYKMVDSQSLRRFVFHFLRQDGVFLLRMVATHAGELPCYELAKTLWNNY 375          
BLAST of INX-13 vs. UniProt/SwissProt
Match: sp|Q03412|UNC7_CAEEL (Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN=unc-7 PE=1 SV=1)

HSP 1 Score: 174.481 bits (441), Expect = 2.691e-47
Identity = 111/404 (27.48%), Postives = 204/404 (50.50%), Query Frame = 3
Query:  147 EDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNI--EIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLK-MTDFLVE--FDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQSECGSST 1343
            +DF D+ N+     +L    L+VS +QY   PI C++ +    +  E Y  N CWV+ T  +     +P ++   +  Q   + YYQW+PF+L+++A+L+Y+P + W+ + Y   G++L+ LV+ A DA   D E + + +  ++R++  E+ L    +    +    N       G+  G  +   Y  IK+ Y +   +Q  ++ H L  N       +G  +L++++   +W +T +FPRV +C   +  +GN +    QC+L INM NEKI++FL+F+  +   +T+ +   WI  +         V++ L+ + D   +   D  T RK   F   FLR+DG F++RM+S + G+L +S ++  L++ +           N + R   + + +E G  T
Sbjct:  139 DDFVDKLNYYYTTTILASFALLVSAKQYVGFPIQCWVPATFTDA-MEQYTENYCWVQNTYWVPMQEDIPREIYSRRNRQ---IGYYQWVPFILAIEALLFYVPCILWRGLLYWHSGINLQGLVQMACDARLMDSEIKTRTVYTMARHMQDEVQLTNIDRQGHSRSCFSNLQLGANCGRHCGCYVTMLYIGIKVLYSANVLLQFFLLNHLLGSNDLA----YGFSLLKDLMHAIEWEQTGMFPRVTLCDFEVRVLGNIHRHTVQCVLMINMFNEKIFLFLWFWFLTCGIVTVCNTMYWILIMFIPSQGMSFVRKYLRVLPDHPAKPIADDVTLRK---FTNNFLRKDGVFMLRMISTHAGELMSSELILALWQDF-----------NNVDRSPTQFWDAEHGQGT 520          
BLAST of INX-13 vs. UniProt/SwissProt
Match: sp|Q23157|INX11_CAEEL (Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=inx-11 PE=3 SV=1)

HSP 1 Score: 170.629 bits (431), Expect = 2.917e-46
Identity = 112/379 (29.55%), Postives = 193/379 (50.92%), Query Frame = 3
Query:  147 EDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIIC-YISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKII----EHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSY-YFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKID----RFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIY 1253
            +D+SDR N+     +LL   +++S +Q+   PI C + +  PG  + E Y  N CW + T  +  +  V    ++ +     +++YYQW+PF L LQA  +  P   W+  + N  G+ + ++V+ A D+ + ++E R K I     H+S  +       RK   + +TV    F++  G       +S+ Y   K+ Y    F QL +M +FL  NR   Y   G  ++++I+ G+ W  +  FPR  +C   + Q+ N      QC+L IN+ NEKI++ L+F+   +L  + +SL  W   +      K  VKQ L ++  L  F+Q   R+ D    +FV ++L +DG F++RM+S + G +  + +V  L+E Y
Sbjct:   20 DDWSDRLNYLMTPNILLAFSVLISFKQFGGRPIECMFPNKFPG--SWEQYAENYCWSQDTYFVEPTQDVSLLKKEERYTPDRQLSYYQWVPFFLLLQAAFFRAPSYLWKYFS-NHSGIRIHEVVEKAKDSANVEEEVREKNILILKRHLSSALRFQANMERKKVQVHKTVTFLNFQYSSG------FISWIYLFTKVLYFLNVFAQLYLMNYFLGTNRHHWY---GFGVVQDIVQGEPWERSGYFPRAAVCDFEVRQVANIQRYSVQCVLVINIFNEKIFVLLWFWYVILLLSSTVSLVQWFIVLVFPCFSKWFVKQHLALST-LQNFNQRNSRREDSDVSKFVTQYLHKDGVFVLRMVSSHAGIIFATDLVQALYEAY 385          
BLAST of INX-13 vs. UniProt/SwissProt
Match: sp|O61715|INX19_CAEEL (Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=inx-19 PE=1 SV=2)

HSP 1 Score: 167.162 bits (422), Expect = 5.133e-45
Identity = 115/422 (27.25%), Postives = 210/422 (49.76%), Query Frame = 3
Query:  105 SYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSE-DDETRRKIIEHISRNIEIML---YGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQ-KHVVK--QCLKMTDF--LVEFDQ------------YTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIE 1307
            S++N  SV    G +D  DR N+    ++L +C L++S +QY   PI C+++      + E+YI + CW++ T  +     VP   +D    ++ ++ YYQW+PF+L  +A+++ LP +FW++ ++   G++++ L+  A D  +  D   R+K +E I+ N    L     + +I+        +  R + G+     L   +   K+ Y      Q LI+   LK      +  FG ++L +I +G+ WTET  FPRV +C   +  + N N    QC L IN++NEK++ FL+ +   +  IT  S   WI        +  +V+K  Q  + ++F  L +F++            +    +D FV +FL+ DG  ++RM+S + GD+    +V  L++ +    + E +    +K +E
Sbjct:   26 SFINALSVR---GDDDAVDRLNYYYTPLILAVCCLVISAKQYGGTPIECWVNP-HSRESMEEYIESYCWIQNTYWIPMYENVP---DDHTAREEKQIGYYQWVPFILIAEALMFSLPCIFWRLCSFQS-GLNIQTLINAACDGQALLDASDRQKAVEAITTNFVDNLDLQSPNGRIRARGWIARIKFSRFLSGQ----CLSILHSFTKLLYSMNVVAQFLILNACLK---SSDFLFFGFQVLNDIWAGRPWTETGHFPRVTLCDFEVRYLANLNRYTVQCALLINIINEKVFAFLWCWYMILAIITTCSFIYWIANSFIHSEKVDYVMKFIQIAESSEFKKLQKFEKDATVERLYTVIAFAPHLLDTFVSDFLKSDGVLMLRMISNHAGDMIVVQLVRNLWQEFRERNWREFEEHEEMKDVE 432          
BLAST of INX-13 vs. UniProt/SwissProt
Match: sp|Q19746|INX3_CAEEL (Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx-3 PE=1 SV=2)

HSP 1 Score: 165.622 bits (418), Expect = 8.357e-45
Identity = 105/371 (28.30%), Postives = 191/371 (51.48%), Query Frame = 3
Query:  144 LEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYIS-SVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLK--MTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFE 1247
             +D  DR ++     +L    ++VS +QY  + I C++     GG   E Y  + C+++ T  +   +++P  +ED    Q+  + YYQW+P VL++QA ++YLP   W  + Y + G+D   ++ +A    S+D ETR K +  +   I  +L       T  +    R + +  GK  G++    Y  IK+ Y++  F+Q +I+  FL     E + L+G     ++ +G++W ++ VFPRV +C  ++ ++ N +    QC+L INM NEKIY+F++F+   VL  T ++    IYR++   ++ + ++  L   + +F  E     K  I  F    L+QDG  ++R +  + G + T  +   LF+
Sbjct:   20 FDDAVDRLSYVTTATLLAFFSIMVSCKQYVGSAIQCWMPMEFKGG--WEQYAEDYCFIQNTFFIPERSEIPGDVED---RQKAEIGYYQWVPIVLAIQAFMFYLPSWIWSSL-YKQCGLDFPSVISEAEALRSQDSETRTKGVNKLVDFIGDIL------DTRSKNEYGRFYCYRFGKGLGSMTSMLYICIKLMYLANVFVQFIILNKFLG---NETF-LWGFHTFADLYAGREWQDSGVFPRVTLCDFSVRKLANVHRYTVQCVLMINMFNEKIYLFIWFWFVFVLITTFINTLCTIYRLSFDSSRHNYIRSLLSGPVNNFKDE-----KAMIASFANNGLKQDGVLLMRFIDDHAGAMVTKEICEELFK 369          
BLAST of INX-13 vs. TrEMBL
Match: H9CXU2 (Innexin OS=Schmidtea mediterranea OX=79327 GN=inx PE=2 SV=1)

HSP 1 Score: 920.998 bits (2379), Expect = 0.000e+0
Identity = 443/444 (99.77%), Postives = 444/444 (100.00%), Query Frame = 3
Query:   84 MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQSECGSSTFMKIPLKNKGVALKTSNRPTAPQV 1415
            MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKL+RKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQSECGSSTFMKIPLKNKGVALKTSNRPTAPQV
Sbjct:    1 MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLSRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQSECGSSTFMKIPLKNKGVALKTSNRPTAPQV 444          
BLAST of INX-13 vs. TrEMBL
Match: A0A4E0RW48 (Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 3.612e-158
Identity = 223/468 (47.65%), Postives = 311/468 (66.45%), Query Frame = 3
Query:   84 MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNF-SAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRH--VPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNR--IKRIEN--EEYQSECGSST------------------FMKIPLK-NKGVALKTSNRPTAP 1409
            M+A+E L Y+  FSVA Y G ED +DRANFQ N+IVLLICM++V++RQYFM P++CY+ +   G NA+ YITN+CW+EGT P+N  S  VPHKL +W+ ++  +MNYYQW+P VL LQA+LYYLP++ W I TYNR G DL+ LV+ AN    ED E R+K+++HI+R +E++L+  R+ +T +E +     R   +PGKR+GN LV  Y  +K+ Y SVG  QL +M+ FL+ + +EGY  FG R+L +I+ G+ WTETQVFPRVGMCR+ L+ +G +N   AQC+LPINMLNEKIY+FLYFFL +V+ IT++S+P+W+ R+  +K Q+H V++ LK+ D     D      +DRF+ EFLRQDG+FI+RM+SMN GDL T  +VC LF  Y  + Y + D R    + R+    + Y S  G S                   FM  PL+   G  ++    P+AP
Sbjct:    1 MVATEFLGYIQSFSVANYVGFEDLADRANFQWNVIVLLICMVLVTLRQYFMTPLVCYLPTTVSGVNADSYITNLCWIEGTFPINLTSGVVPHKLAEWEAMKPMQMNYYQWVPLVLGLQAILYYLPRILWSIFTYNRTGTDLQNLVRTANMITKEDGEKRQKMVQHIARTLELLLFSRREYRTAQEGLAADFRRSSLIPGKRHGNNLVYVYLFVKLLYASVGIAQLYMMYVFLRFDSREGYLFFGFRVLSDIIQGRPWTETQVFPRVGMCRHTLQHVGASNRLFAQCVLPINMLNEKIYVFLYFFLGAVMCITLISIPLWVARMGLKKRQRHFVRRFLKIADVYDRDDPKMALLVDRFIAEFLRQDGHFILRMISMNAGDLITVEIVCCLFADYKKQ-YTDKDFRGPPVVPRMPKYMQSYFSGSGRSNHLSSGDVPTDINDKSHHGFMSAPLELGDGGPVRQRPLPSAP 467          
BLAST of INX-13 vs. TrEMBL
Match: A0A504Y5J8 (Innexin OS=Fasciola gigantica OX=46835 GN=inx PE=3 SV=1)

HSP 1 Score: 469.544 bits (1207), Expect = 3.692e-158
Identity = 223/468 (47.65%), Postives = 311/468 (66.45%), Query Frame = 3
Query:   84 MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNF-SAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRH--VPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNR--IKRIEN--EEYQSECGSST------------------FMKIPLK-NKGVALKTSNRPTAP 1409
            M+A+E L Y+  FSVA Y G ED +DRANFQ N+IVLLICM++V++RQYFM P++CY+ +   G NA+ YITN+CW+EGT P+N  S  VPHKL +W+ ++  +MNYYQW+P VL LQA+LYYLP++ W I TYNR G DL+ LV+ AN    ED E R+K+++HI+R +E++L+  R+ +T +E +     R   +PGKR+GN LV  Y  +K+ Y SVG  QL +M+ FL+ + +EGY  FG R+L +I+ G+ WTETQVFPRVGMCR+ L+ +G +N   AQC+LPINMLNEKIY+FLYFFL +V+ IT++S+P+W+ R+  +K Q+H V++ LK+ D     D      +DRF+ EFLRQDG+FI+RM+SMN GDL T  +VC LF  Y  + Y + D R    + R+    + Y S  G S                   FM  PL+   G  ++    P+AP
Sbjct:    1 MVATEFLGYIQSFSVANYVGFEDLADRANFQWNVIVLLICMVLVTLRQYFMTPLVCYLPTTVSGVNADSYITNLCWIEGTFPINLTSGVVPHKLAEWEAMKPMQMNYYQWVPLVLGLQAILYYLPRILWSIFTYNRTGTDLQNLVRTANMITKEDGEKRQKMVQHIARTLELLLFSRREYRTAQEGLAADFRRSSLIPGKRHGNNLVYVYLFVKLLYASVGIAQLYMMYVFLRFDSREGYLFFGFRVLSDIIQGRPWTETQVFPRVGMCRHTLQHVGASNRLFAQCVLPINMLNEKIYVFLYFFLGAVMCITLISIPLWVARMGLKKRQRHFVRRFLKIADVYDRDDPKMALLVDRFIAEFLRQDGHFILRMISMNAGDLITVEIVCCLFADYKKQ-YTDKDFRGPPVVPRMPKYMQSYFSGSGRSNHLSSGDVPTDINDKSHHGFMSAPLELGDGGPVRQRPLPSAP 467          
BLAST of INX-13 vs. TrEMBL
Match: A0A3Q0KU38 (Innexin OS=Schistosoma mansoni OX=6183 GN=inx PE=3 SV=1)

HSP 1 Score: 466.463 bits (1199), Expect = 4.494e-157
Identity = 216/405 (53.33%), Postives = 292/405 (72.10%), Query Frame = 3
Query:   84 MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNF-SAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVG---NRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLR 1286
            M+ASE L YV  FSV  + G ED +DRANFQ N+IVLL+CM +V+MRQYFM P++CY+ +   G NA+ YITN+CW+EGT P+N  S  VPHKL++W  L+  +MNYYQW+P VL LQA+LYY+P++ W I TYNR G DL+ L++ AN  + ED E R+K+++HI++ +E++L+  R+ +T  +T+G    R    +PGKR+GN LV  Y  IK+ Y  VGF QL +M+ FL+ N  EGY LFG+RIL +I+ GK WTETQVFPRVGMCR+ L+ +G +N   AQC+LPINMLNEKIYIFL+FFL SV+ +T++S+P+W+YR+  ++ Q+H V++ LK+ D     D       DRF+ EFLRQDG+FI+RMLSMN GDL T  +VC LF  Y    +A ID R
Sbjct:    1 MVASEFLGYVQSFSVCNFVGFEDLADRANFQWNVIVLLLCMALVTMRQYFMTPLVCYLPTTVSGVNADSYITNLCWIEGTFPINLTSGIVPHKLQEWDALRPQQMNYYQWVPLVLGLQAILYYIPRIIWSIFTYNRTGTDLQNLIRQANLISKEDGEKRQKMVQHIAKTLELLLFNRREYRT-TDTLGASFRRSMAFMPGKRHGNNLVYVYLTIKLLYSIVGFFQLYLMYFFLRFNSYEGYWLFGYRILSDIIHGKQWTETQVFPRVGMCRHTLQHVGASNTLFAQCVLPINMLNEKIYIFLFFFLGSVMIMTMLSIPLWLYRMGLKQRQRHFVRRFLKIADVYDRDDPKIALLTDRFMAEFLRQDGHFILRMLSMNAGDLITVEIVCNLFADYKKR-FAGIDFR 403          
BLAST of INX-13 vs. TrEMBL
Match: A0A074Z666 (Innexin OS=Opisthorchis viverrini OX=6198 GN=inx PE=3 SV=1)

HSP 1 Score: 465.692 bits (1197), Expect = 1.264e-156
Identity = 218/465 (46.88%), Postives = 309/465 (66.45%), Query Frame = 3
Query:   84 MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNF-SAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRH---VPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQSEC------------------GSSTFMKIPLKNKGVA-LKTSNRPTAP 1409
            M+ASE L Y+  FS   Y G ED +DRANFQ N+I++LICM++V++RQYFM P++CY+ +   G NA+ YITN+CW+EGT P+N  S  VPH++E+W  ++  +MNYYQW+P VL LQA+LYYLP++FW I TYNR G DL+ LV+ AN    E+ E R K+++HI+R +EI+L+  R+ +    ++ +R+ RH   +PGKR+GN LV  Y  +K+ Y  +G  QL +M+ FL+ + +EGY  FG RIL++I+ GK WTETQ+FPRVGMCR+ L+ +G +N   AQC+LPINMLNEKIY+FL+FFL +V+ IT++S+P+W+ R+  +K Q+H V++ LK+ D     D      +DRF+ EFLRQDG+FI+RM+SMN GDL T  +VC LF  Y    Y + D R      +  +Y SE                       FM  PL+  G+A ++    PTAP
Sbjct:    1 MVASEFLGYIQTFSACNYVGFEDLADRANFQWNVIIILICMVLVTLRQYFMTPLVCYLPTTVSGVNADSYITNLCWIEGTFPINLTSGIVPHRMEEWDAMRPHQMNYYQWVPLVLGLQAILYYLPRIFWSIFTYNRTGTDLQNLVRTANSITKEEGEKRSKMVQHIARTLEILLFSRREYRGGSGSLADRL-RHSSIIPGKRHGNNLVYVYITVKLLYAIIGICQLYMMYLFLRFDAREGYLFFGFRILQDIIHGKPWTETQIFPRVGMCRHTLQHVGASNRLFAQCVLPINMLNEKIYVFLFFFLGAVMLITLISIPLWMSRMGMKKRQRHFVRRFLKIADVFDRDDPKMALLVDRFISEFLRQDGHFILRMISMNAGDLVTVEIVCCLFADYKKH-YMDKDFRGPPIVPKPPKYLSEYVPRLNHLSGDMPAEIVDKNHGGFMSAPLEQGGIATVRQRPLPTAP 463          
BLAST of INX-13 vs. Planmine SMEST
Match: SMESG000043575.1 (SMESG000043575.1)

HSP 1 Score: 922.539 bits (2383), Expect = 0.000e+0
Identity = 444/444 (100.00%), Postives = 444/444 (100.00%), Query Frame = 3
Query:   84 MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQSECGSSTFMKIPLKNKGVALKTSNRPTAPQV 1415
            MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQSECGSSTFMKIPLKNKGVALKTSNRPTAPQV
Sbjct:    1 MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQSECGSSTFMKIPLKNKGVALKTSNRPTAPQV 444          
BLAST of INX-13 vs. Planmine SMEST
Match: SMESG000065083.1 (SMESG000065083.1)

HSP 1 Score: 366.311 bits (939), Expect = 9.710e-123
Identity = 189/448 (42.19%), Postives = 283/448 (63.17%), Query Frame = 3
Query:   84 MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHR-----KIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEEYQSECGSSTFMKIPLKNKGVALKTSNRPTAPQ 1412
            M+ASE L Y++   V+   GLED  DR NF  ++IVL++C+LIV+++QY   PI CY+ +  GGSN   Y+ N+CWV+GT+ L+  AK P   E+WK L++ +M YYQW+PF+L LQ +++Y+PKL WQII YNR G D++ LV  AN A    DE R K++ ++S+ +E +LY HR     K+   +  + N +   +  KR G  LVS Y L+K++Y++ GFIQL+IM  FL  +       FG  +  NI SG DW  T +FPRV  C   +  +G  N+ VAQC+LP+NMLNE+IY FL+ ++  VL +TI+S+PIWI R+ C K ++H ++Q L +++ + + DQ     + +F  +FLR DG F+++M+S+N GD+ TS +VC+L+ IY T  Y     RN +    +E+   +  S T +K+   N  +A KTS  P+AP 
Sbjct:    1 MVASEFLDYLSKLQVSTNVGLEDLPDRLNFTFSVIVLMVCILIVTVKQYVFKPISCYLPNNIGGSNLLSYVENLCWVQGTIALSNQAKFPSTDEEWKNLEKHKMLYYQWVPFMLGLQCIMFYVPKLVWQIICYNRTGTDIQHLVVSANQAVHSSDEARSKMVSYLSKTLEQLLYQHRDHRSGKLAKFRRKIHNSVGFLMCSKRIGTWLVSSYLLLKLSYVANGFIQLIIMQKFLGFS-DFNLLTFGIEVGNNIWSGTDWKTTLIFPRVSYCFVKVTHLGVINSMVAQCVLPVNMLNERIYFFLWCWILIVLSLTILSIPIWILRILCIKYRRHFIRQFLIISEEITK-DQKENYLLAKFESQFLRHDGIFLLKMISLNAGDIITSEIVCQLWNIYKT-NYVN---RNFLNDGSDED---DDKSRTMIKLGFLNNKLADKTS--PSAPS 437          
BLAST of INX-13 vs. Planmine SMEST
Match: SMESG000080788.1 (SMESG000080788.1)

HSP 1 Score: 321.242 bits (822), Expect = 2.926e-105
Identity = 166/410 (40.49%), Postives = 245/410 (59.76%), Query Frame = 3
Query:   84 MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQD-RMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIMLYGHRKIK-----TLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMC--RNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRKIDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRN 1289
            M+A E L+ +  F ++ Y G+EDF+D+ +F  ++ +L++ M++V+++ Y   P+ CY ++ PGGSN E+Y+ N CWV GT+       +P    DW       R+NYYQW+PF+L LQ  ++Y+PK+ WQII YN+ G +LE +V DAN AN+     R+  IE I+R IE ML+ HR  +      L+  + N     V  K  G  L+  Y LIK  Y      QL IM  FL  N       FG+ +L N++SGK+W +T +FPRV  C  RN ++ +G  N  VAQC LP+NMLNEKIY+FL+F++  V  +T +S+P+W YR+     +   +K+ L M      +++  K  I+ F+ EFLR DG F++RML +N GD+ T+ +V RL EIY  E Y  +D RN
Sbjct:    1 MVAEEFLNLIGQFKISTYVGIEDFADKLSFLFSVTLLILSMMVVTIKSYLFKPLACYTATAPGGSNFENYLENYCWVHGTITFLPGEDIPQNDVDWARADDTRRINYYQWVPFILGLQCFMFYIPKIIWQIICYNKSGTNLESIVNDANAANNTPPVERKDKIERIARTIEDMLFQHRDYRQGNFAKLRRKIYNTCNFCVFSKHMGTWLILSYILIKFLYGLNVIGQLFIMKKFLGFNNSTSS--FGYTVLSNMISGKEWHQTGIFPRVTYCYVRN-IKHVGVANKYVAQCALPVNMLNEKIYVFLWFWMVLVGIVTAISIPLWFYRMAFLSRRSKFIKRFLMMHQ---NYERSDKPMINNFIEEFLRHDGVFLVRMLFINAGDIITADIVNRLLEIYK-ENYKHLDFRN 403          
BLAST of INX-13 vs. Planmine SMEST
Match: SMESG000081749.1 (SMESG000081749.1)

HSP 1 Score: 314.694 bits (805), Expect = 5.632e-103
Identity = 167/419 (39.86%), Postives = 257/419 (61.34%), Query Frame = 3
Query:   96 ELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQD---RMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIM-----LYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCR-NALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRK---IDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEE 1316
             L+   + F+V +Y G+ED +D+A+F  ++++L++C +IVS +QY    I CYI  +  G   EDYI N CW  GT+P   +  +P   +DW  +Q D   R+NYYQW+PFVL LQ VL+YLP+L W+ I YN  G DLE LV  A  A+++  E R++ I  +++ +E +     + GH K   L++    ++     G+R G   +S Y +IK+ Y++    Q+++M +FLK    +    FG  IL++ILSGK W +  +FPRV  C  + +  + + N+ +AQC LPINMLNEKIYIFL+F+   VLF+TI+S+P+W+YR+T  + +K  +K+ LK+         YTK K   I +FV +FLR DG FI+ ++S+N GDL  + +V  L+EIY+ + Y +ID R +     NE+
Sbjct:    3 SLIGEFSNFNVEKYVGVEDGADKASFLFSVVILVVCTVIVSTKQYIFGEIACYIPILNTGEKLEDYIQNYCWAHGTIPFRENETLPQNRKDW--MQADFDRRLNYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQ----KMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIK------SAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYN-KYYLKIDFRKKYISSSNEK 408          
BLAST of INX-13 vs. Planmine SMEST
Match: SMESG000081749.1 (SMESG000081749.1)

HSP 1 Score: 312.383 bits (799), Expect = 3.722e-102
Identity = 164/416 (39.42%), Postives = 253/416 (60.82%), Query Frame = 3
Query:   99 LLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYFMNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQQDR-MNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDANSEDDETRRKIIEHISRNIEIM-----LYGHRKIKTLKETVGNRIFRHVPGKRNGNLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILSGKDWTETQVFPRVGMCR-NALEQMGNTNNAVAQCLLPINMLNEKIYIFLYFFLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRK---IDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDLRNRIKRIENEE 1316
             LS    F   +Y G+ED +D+A+F  ++I+L++C +IVS +QY    I CYI  V  G + + Y+ N CWV GT+P   +  +P   ++W +    R +NYYQW+PFVL LQ VL+YLP+L W+ I YN  G DLE LV  A  A+++  E R++ I  +++ +E +     + GH K   L++    ++     G+R G   +S Y +IK+ Y++    Q+++M +FLK    +    FG  IL++ILSGK W +  +FPRV  C  + +  + + N+ +AQC LPINMLNEKIYIFL+F+   VLF+TI+S+P+W+YR+T  + +K  +K+ LK+         YTK K   I +FV +FLR DG FI+ ++S+N GDL  + +V  L+EIY+ + Y +ID R +     NE+
Sbjct:    4 FLSQFTAFQAGKYVGIEDAADKASFLFSVIILVVCSVIVSTKQYITADISCYIPVVLSGVDLDKYVKNYCWVHGTIPFYANETLPQTKDEWIIADASRKINYYQWVPFVLGLQGVLFYLPRLIWKTIIYNLSGNDLEGLVVSAKKASNQVGEIRKETILQVAKCLEDLFLQRRVLGHTKFPVLRQ----KMSLICCGRRTGVFFISLYIVIKLLYLTNAICQIILMQNFLKYGVSKLNAAFGWTILKDILSGKQWNDNLLFPRVSFCFISDISTVTHKNHHIAQCALPINMLNEKIYIFLWFWTVGVLFLTIISIPLWLYRMTFFRKRKDFIKRFLKIK------SAYTKDKKNLISQFVEQFLRHDGIFILHIISLNAGDLIATDIVSELWEIYN-KYYLKIDFRKKYISSSNEK 408          
The following BLAST results are available for this feature:
BLAST of INX-13 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of INX-13 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
inx-11.592e-5427.99Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-11.592e-5427.99Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-14.954e-5429.16Innexin [Source:UniProtKB/TrEMBL;Acc:Q17394][more]
inx-131.116e-5230.38Innexin [Source:UniProtKB/TrEMBL;Acc:O44887][more]
inx-181.210e-5227.98Innexin [Source:UniProtKB/TrEMBL;Acc:Q8MXG8][more]
back to top
BLAST of INX-13 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Inx24.057e-1825.32gene:FBgn0027108 transcript:FBtr0301860[more]
Inx24.057e-1825.32gene:FBgn0027108 transcript:FBtr0071005[more]
Inx24.057e-1825.32gene:FBgn0027108 transcript:FBtr0332314[more]
Inx24.057e-1825.32gene:FBgn0027108 transcript:FBtr0071006[more]
zpg1.218e-1325.97gene:FBgn0024177 transcript:FBtr0076983[more]
back to top
BLAST of INX-13 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of INX-13 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of INX-13 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of INX-13 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O01393|UNC9_CAEEL2.303e-5129.84Innexin unc-9 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q03412|UNC7_CAEEL2.691e-4727.48Innexin unc-7 OS=Caenorhabditis elegans OX=6239 GN... [more]
sp|Q23157|INX11_CAEEL2.917e-4629.55Innexin-11 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|O61715|INX19_CAEEL5.133e-4527.25Innexin-19 OS=Caenorhabditis elegans OX=6239 GN=in... [more]
sp|Q19746|INX3_CAEEL8.357e-4528.30Innexin-3 OS=Caenorhabditis elegans OX=6239 GN=inx... [more]
back to top
BLAST of INX-13 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
H9CXU20.000e+099.77Innexin OS=Schmidtea mediterranea OX=79327 GN=inx ... [more]
A0A4E0RW483.612e-15847.65Innexin OS=Fasciola hepatica OX=6192 GN=inx PE=3 S... [more]
A0A504Y5J83.692e-15847.65Innexin OS=Fasciola gigantica OX=46835 GN=inx PE=3... [more]
A0A3Q0KU384.494e-15753.33Innexin OS=Schistosoma mansoni OX=6183 GN=inx PE=3... [more]
A0A074Z6661.264e-15646.88Innexin OS=Opisthorchis viverrini OX=6198 GN=inx P... [more]
back to top
BLAST of INX-13 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of INX-13 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of INX-13 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of INX-13 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of INX-13 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of INX-13 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000043575.10.000e+0100.00SMESG000043575.1[more]
SMESG000065083.19.710e-12342.19SMESG000065083.1[more]
SMESG000080788.12.926e-10540.49SMESG000080788.1[more]
SMESG000081749.15.632e-10339.86SMESG000081749.1[more]
SMESG000081749.13.722e-10239.42SMESG000081749.1[more]
back to top
Cross References
External references for this transcript
DatabaseAccession
SmedGD GBrowseSMED30023483
GenBankAFD29613.1
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023483 ID=SMED30023483|Name=INX-13|organism=Schmidtea mediterranea sexual|type=transcript|length=1464bp
CTCATTATTATGTATTTCATGTAACATAAGGATAATATTGACAAATCCTT
TATAACCAAATTTTCTGTTTAGTTTTTCAATAAATGATAGCTTCTGAATT
GCTTTCTTATGTCAATGGATTCTCTGTCGCTCAATATGCAGGCTTAGAAG
ACTTTTCAGATCGTGCTAACTTCCAGGGAAATATTATTGTGTTGTTAATA
TGCATGCTGATTGTATCCATGAGGCAGTATTTCATGAATCCCATAATTTG
CTATATATCATCGGTACCCGGTGGCAGTAATGCTGAAGATTACATAACCA
ATATGTGCTGGGTTGAAGGCACTGTTCCACTGAATTTTTCTGCTAAAGTA
CCTCATAAATTAGAGGATTGGAAACTCCTTCAACAAGATAGAATGAATTA
TTACCAATGGATTCCGTTTGTTTTGAGTTTACAAGCCGTTTTGTACTATT
TACCGAAGCTTTTTTGGCAAATCATCACATACAATCGAATCGGAATGGAT
CTTGAACAACTGGTGAAAGATGCAAACGATGCTAATAGTGAGGACGATGA
AACGAGAAGGAAAATAATTGAACATATCTCTCGAAACATTGAAATCATGC
TGTATGGTCACCGAAAAATTAAAACGCTAAAAGAAACCGTTGGAAATAGA
ATTTTCCGACATGTTCCCGGTAAACGAAATGGAAACCTTCTGGTCTCATA
TTACTTTCTCATCAAAATCGCCTATATCTCTGTTGGTTTCATTCAATTGT
TGATTATGTTTCACTTTCTGAAACTCAATCGAAAAGAAGGTTACCAACTA
TTTGGGCATCGAATTCTCAGAAATATCCTCTCCGGCAAAGATTGGACAGA
GACTCAAGTTTTCCCAAGAGTCGGAATGTGCCGAAACGCCCTGGAACAAA
TGGGAAATACCAATAATGCTGTTGCTCAATGCCTTTTGCCTATCAATATG
CTCAATGAAAAAATCTACATTTTTCTCTACTTTTTCCTAAGTTCCGTTCT
TTTTATCACAATCATGAGCCTGCCGATTTGGATTTATCGTGTCACTTGTA
GGAAAACTCAGAAACATGTTGTGAAGCAATGCTTAAAAATGACTGATTTT
CTGGTAGAATTCGATCAATACACTAAGCGGAAAATCGATAGGTTTGTCGT
AGAATTTCTTAGACAGGATGGGAATTTTATTATTCGAATGCTCTCCATGA
ACGTTGGCGATTTGACGACTTCGAGCGTTGTTTGCCGATTGTTTGAGATT
TATTCAACTGAAGGCTACGCAGAAATCGACCTGAGAAACAGAATCAAGCG
AATTGAAAACGAGGAATATCAAAGCGAGTGCGGCAGTTCAACTTTTATGA
AAATCCCTCTGAAAAATAAAGGAGTCGCACTGAAAACCTCAAACCGACCG
ACGGCACCGCAAGTCGAATTAGAGCTTTTATAAATCTAAATCAAAATTAT
ATTTTATATCAATT
back to top

protein sequence of SMED30023483-orf-1

>SMED30023483-orf-1 ID=SMED30023483-orf-1|Name=SMED30023483-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=450bp
MIASELLSYVNGFSVAQYAGLEDFSDRANFQGNIIVLLICMLIVSMRQYF
MNPIICYISSVPGGSNAEDYITNMCWVEGTVPLNFSAKVPHKLEDWKLLQ
QDRMNYYQWIPFVLSLQAVLYYLPKLFWQIITYNRIGMDLEQLVKDANDA
NSEDDETRRKIIEHISRNIEIMLYGHRKIKTLKETVGNRIFRHVPGKRNG
NLLVSYYFLIKIAYISVGFIQLLIMFHFLKLNRKEGYQLFGHRILRNILS
GKDWTETQVFPRVGMCRNALEQMGNTNNAVAQCLLPINMLNEKIYIFLYF
FLSSVLFITIMSLPIWIYRVTCRKTQKHVVKQCLKMTDFLVEFDQYTKRK
IDRFVVEFLRQDGNFIIRMLSMNVGDLTTSSVVCRLFEIYSTEGYAEIDL
RNRIKRIENEEYQSECGSSTFMKIPLKNKGVALKTSNRPTAPQVELELL*
back to top
Aliases
The feature 'INX-13' has the following synonyms
Synonym
INX-13
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000009sigma neoblast
PLANA:0000014zeta neoblast
PLANA:0000016pharynx
PLANA:0000039gamma neoblast
PLANA:0000099neuron
PLANA:0000429neoblast
PLANA:0000478pharynx musculature
PLANA:0002109X1 cell
PLANA:0002111X2 cell
Vocabulary: INTERPRO
TermDefinition
IPR000990Innexin
Vocabulary: cellular component
TermDefinition
GO:0005921gap junction
GO:0005886plasma membrane
GO:0016020membrane
GO:0016021integral component of membrane
GO:0030054cell junction
Vocabulary: biological process
TermDefinition
GO:0006810transport
GO:0006811ion transport
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 140..160
NoneNo IPR availablePANTHERPTHR11893:SF36INNEXIN-5coord: 16..406
NoneNo IPR availableTMHMMTMhelixcoord: 202..224
NoneNo IPR availableTMHMMTMhelixcoord: 34..51
NoneNo IPR availableTMHMMTMhelixcoord: 106..128
NoneNo IPR availableTMHMMTMhelixcoord: 295..317
IPR000990InnexinPRINTSPR01262INNEXINcoord: 45..56
score: 41.33
coord: 283..299
score: 59.06
coord: 74..83
score: 34.4
coord: 106..128
score: 54.09
coord: 207..221
score: 29.6
coord: 259..268
score: 50.4
IPR000990InnexinPFAMPF00876Innexincoord: 22..390
e-value: 8.3E-98
score: 327.9
IPR000990InnexinPANTHERPTHR11893INNEXINcoord: 16..406
IPR000990InnexinPROSITEPS51013PANNEXINcoord: 17..396
score: 27.894