Myosin, light chain kinase a

Overview
NameMyosin, light chain kinase a
Smed IDSMED30023471
Length (bp)2071
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Myosin, light chain kinase a (SMED30023471) t-SNE clustered cells

Violin plots show distribution of expression levels for Myosin, light chain kinase a (SMED30023471) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Myosin, light chain kinase a (SMED30023471) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Myosin, light chain kinase a (SMED30023471) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023471

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 6

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
intestinal phagocyteSMED30023471SMESG000081274.1 Contig787newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
intestinal phagocyteSMED30023471SMESG000058434.1 Contig787newmark_estsPMID:23079596
Forsthoefel et al., 2012
FACS sorted cell population asexual adult cDNA to DNA expression microarray evidence
pharynxSMED30023471SMESG000081274.1 dd_Smed_v4_3482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
parenchymal cellSMED30023471SMESG000081274.1 dd_Smed_v4_3482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermal cellSMED30023471SMESG000081274.1 dd_Smed_v4_3482_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
epidermisSMED30023471SMESG000081274.1 dd_Smed_v4_3482_0_1dd_Smed_v4PMID:28292427
Wurtzel et al., 2017
whole organism asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Myosin, light chain kinase a vs. Ensembl Human
Match: MYLK (myosin light chain kinase [Source:HGNC Symbol;Acc:HGNC:7590])

HSP 1 Score: 229.18 bits (583), Expect = 9.623e-63
Identity = 126/320 (39.38%), Postives = 190/320 (59.38%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +S FY  E R+G GKFG+V R+   +T+K +A K     S K ++NI  EI I++CLH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+  I  M QI +GV +IH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YEP GY TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS+LL ++   RL  ++CL+H WL     K      ++ +S  RMK Y+A  KWQK   A++++    ++
Sbjct: 1460 VSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPK----LVQCVDAFEEKANIVMVL-EIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLM----KDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1761          
BLAST of Myosin, light chain kinase a vs. Ensembl Human
Match: MYLK (myosin light chain kinase [Source:HGNC Symbol;Acc:HGNC:7590])

HSP 1 Score: 229.18 bits (583), Expect = 9.623e-63
Identity = 126/320 (39.38%), Postives = 190/320 (59.38%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +S FY  E R+G GKFG+V R+   +T+K +A K     S K ++NI  EI I++CLH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+  I  M QI +GV +IH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YEP GY TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS+LL ++   RL  ++CL+H WL     K      ++ +S  RMK Y+A  KWQK   A++++    ++
Sbjct: 1460 VSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPK----LVQCVDAFEEKANIVMVL-EIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLM----KDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1761          
BLAST of Myosin, light chain kinase a vs. Ensembl Human
Match: MYLK (myosin light chain kinase [Source:HGNC Symbol;Acc:HGNC:7590])

HSP 1 Score: 228.794 bits (582), Expect = 1.150e-62
Identity = 126/320 (39.38%), Postives = 190/320 (59.38%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +S FY  E R+G GKFG+V R+   +T+K +A K     S K ++NI  EI I++CLH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+  I  M QI +GV +IH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YEP GY TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS+LL ++   RL  ++CL+H WL     K      ++ +S  RMK Y+A  KWQK   A++++    ++
Sbjct: 1391 VSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPK----LVQCVDAFEEKANIVMVL-EIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLM----KDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1692          
BLAST of Myosin, light chain kinase a vs. Ensembl Human
Match: MYLK (myosin light chain kinase [Source:HGNC Symbol;Acc:HGNC:7590])

HSP 1 Score: 228.794 bits (582), Expect = 1.150e-62
Identity = 126/320 (39.38%), Postives = 190/320 (59.38%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +S FY  E R+G GKFG+V R+   +T+K +A K     S K ++NI  EI I++CLH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+  I  M QI +GV +IH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YEP GY TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS+LL ++   RL  ++CL+H WL     K      ++ +S  RMK Y+A  KWQK   A++++    ++
Sbjct: 1391 VSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPK----LVQCVDAFEEKANIVMVL-EIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLM----KDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1692          
BLAST of Myosin, light chain kinase a vs. Ensembl Human
Match: MYLK3 (myosin light chain kinase 3 [Source:HGNC Symbol;Acc:HGNC:29826])

HSP 1 Score: 210.69 bits (535), Expect = 4.603e-60
Identity = 125/315 (39.68%), Postives = 189/315 (60.00%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKS--LNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
            +G G+FG+V R T   T    A+K I  +S K R+++ NEI I++ L    H+  LI+  D   SK  +  ++ EY+DGGELFD+I + +  LTE +V+    QI +GV+++H   I+H DLKPENI+  ++    +KIIDFG A ++  +   K   GT  F+APEV+ YE   + TD+WSVGVI + LL+G++PF     G+T     D E +  I  C +DF  + F G+SEEAK F+S LL++E S R+SA++CLKH+WL++   K+    T L   + LQ+   Y+A  KW+K    + + +  +   TS
Sbjct:  180 LGGGRFGQVHRCTEKSTGLPLAAKIIKVKSAKDREDVKNEINIMNQL---SHV-NLIQLYDAFESK-HSCTLVMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVNQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPF----LGET-----DAETMNFIVNCSWDFDADTFEGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLNNLPAKASRSKTRLKSQLLLQK---YIAQRKWKKHFYVVTAANRLRKFPTS 477          
BLAST of Myosin, light chain kinase a vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 190.66 bits (483), Expect = 2.751e-50
Identity = 121/346 (34.97%), Postives = 197/346 (56.94%), Query Frame = 2
Query:  791 SVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLS----------SCYNKSLNTNLSRS-ISLQRMKNYVAVHKW 1792
            SV++E+     ++S    + T  I   P    +++   E  +GKG +G V R T   T K +A+K +  R    ++N+I+EI +++ LH  + ++ L EA D          +I E++ GGELF++I  +  L++E+ V   M QIL GV+ +H   I+H DLKPENI+  +KN++ LKIIDFG A K D K   K + GT  F APEV+ Y+P G  TD+W+VGVI++ LL+G++PF     GD     SD + + N+    +DF D  +  +S+ AK FI  L+I++  KR+S  + L+H W++          S Y K +   L +S +  ++ +N++++ +W
Sbjct: 5199 SVDYER---VAKDSEPSEYKTIDIHRLPNDLQAKYIIHE-ELGKGAYGTVYRATEKATGKTWAAKMVQVRPGVKKENVIHEISMMNQLHHEK-LLNLHEAFDMGNE----MWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKNSNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPF----LGD-----SDEDTLANVSASDWDFDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWITGPLLSAFNDLSEYVKKMQPKLDKSGVPARQKRNFLSLKRW 5526          
BLAST of Myosin, light chain kinase a vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 190.66 bits (483), Expect = 2.853e-50
Identity = 121/346 (34.97%), Postives = 197/346 (56.94%), Query Frame = 2
Query:  791 SVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLS----------SCYNKSLNTNLSRS-ISLQRMKNYVAVHKW 1792
            SV++E+     ++S    + T  I   P    +++   E  +GKG +G V R T   T K +A+K +  R    ++N+I+EI +++ LH  + ++ L EA D          +I E++ GGELF++I  +  L++E+ V   M QIL GV+ +H   I+H DLKPENI+  +KN++ LKIIDFG A K D K   K + GT  F APEV+ Y+P G  TD+W+VGVI++ LL+G++PF     GD     SD + + N+    +DF D  +  +S+ AK FI  L+I++  KR+S  + L+H W++          S Y K +   L +S +  ++ +N++++ +W
Sbjct: 5199 SVDYER---VAKDSEPSEYKTIDIHRLPNDLQAKYIIHE-ELGKGAYGTVYRATEKATGKTWAAKMVQVRPGVKKENVIHEISMMNQLHHEK-LLNLHEAFDMGNE----MWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKNSNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPF----LGD-----SDEDTLANVSASDWDFDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWITGPLLSAFNDLSEYVKKMQPKLDKSGVPARQKRNFLSLKRW 5526          
BLAST of Myosin, light chain kinase a vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 190.66 bits (483), Expect = 2.853e-50
Identity = 121/346 (34.97%), Postives = 197/346 (56.94%), Query Frame = 2
Query:  791 SVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLS----------SCYNKSLNTNLSRS-ISLQRMKNYVAVHKW 1792
            SV++E+     ++S    + T  I   P    +++   E  +GKG +G V R T   T K +A+K +  R    ++N+I+EI +++ LH  + ++ L EA D          +I E++ GGELF++I  +  L++E+ V   M QIL GV+ +H   I+H DLKPENI+  +KN++ LKIIDFG A K D K   K + GT  F APEV+ Y+P G  TD+W+VGVI++ LL+G++PF     GD     SD + + N+    +DF D  +  +S+ AK FI  L+I++  KR+S  + L+H W++          S Y K +   L +S +  ++ +N++++ +W
Sbjct: 5199 SVDYER---VAKDSEPSEYKTIDIHRLPNDLQAKYIIHE-ELGKGAYGTVYRATEKATGKTWAAKMVQVRPGVKKENVIHEISMMNQLHHEK-LLNLHEAFDMGNE----MWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKNSNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPF----LGD-----SDEDTLANVSASDWDFDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWITGPLLSAFNDLSEYVKKMQPKLDKSGVPARQKRNFLSLKRW 5526          
BLAST of Myosin, light chain kinase a vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 189.504 bits (480), Expect = 7.869e-50
Identity = 121/346 (34.97%), Postives = 197/346 (56.94%), Query Frame = 2
Query:  791 SVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLS----------SCYNKSLNTNLSRS-ISLQRMKNYVAVHKW 1792
            SV++E+     ++S    + T  I   P    +++   E  +GKG +G V R T   T K +A+K +  R    ++N+I+EI +++ LH  + ++ L EA D          +I E++ GGELF++I  +  L++E+ V   M QIL GV+ +H   I+H DLKPENI+  +KN++ LKIIDFG A K D K   K + GT  F APEV+ Y+P G  TD+W+VGVI++ LL+G++PF     GD     SD + + N+    +DF D  +  +S+ AK FI  L+I++  KR+S  + L+H W++          S Y K +   L +S +  ++ +N++++ +W
Sbjct: 12103 SVDYER---VAKDSEPSEYKTIDIHRLPNDLQAKYIIHE-ELGKGAYGTVYRATEKATGKTWAAKMVQVRPGVKKENVIHEISMMNQLHHEK-LLNLHEAFDMGNE----MWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKNSNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPF----LGD-----SDEDTLANVSASDWDFDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWITGPLLSAFNDLSEYVKKMQPKLDKSGVPARQKRNFLSLKRW 12430          
BLAST of Myosin, light chain kinase a vs. Ensembl Celegans
Match: ttn-1 (Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4SLH0])

HSP 1 Score: 189.504 bits (480), Expect = 7.869e-50
Identity = 121/346 (34.97%), Postives = 197/346 (56.94%), Query Frame = 2
Query:  791 SVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLS----------SCYNKSLNTNLSRS-ISLQRMKNYVAVHKW 1792
            SV++E+     ++S    + T  I   P    +++   E  +GKG +G V R T   T K +A+K +  R    ++N+I+EI +++ LH  + ++ L EA D          +I E++ GGELF++I  +  L++E+ V   M QIL GV+ +H   I+H DLKPENI+  +KN++ LKIIDFG A K D K   K + GT  F APEV+ Y+P G  TD+W+VGVI++ LL+G++PF     GD     SD + + N+    +DF D  +  +S+ AK FI  L+I++  KR+S  + L+H W++          S Y K +   L +S +  ++ +N++++ +W
Sbjct: 12103 SVDYER---VAKDSEPSEYKTIDIHRLPNDLQAKYIIHE-ELGKGAYGTVYRATEKATGKTWAAKMVQVRPGVKKENVIHEISMMNQLHHEK-LLNLHEAFDMGNE----MWLIEEFVSGGELFEKILEDDSLMSEEEVRDYMHQILLGVSHMHKNQIVHLDLKPENILLKAKNSNELKIIDFGLARKLDPKKSVKLLFGTPEFCAPEVVNYQPVGLSTDMWTVGVISYVLLSGLSPF----LGD-----SDEDTLANVSASDWDFDDPSWDDVSDLAKDFICRLMIKDKRKRMSVQDALRHPWITGPLLSAFNDLSEYVKKMQPKLDKSGVPARQKRNFLSLKRW 12430          
BLAST of Myosin, light chain kinase a vs. Ensembl Fly
Match: Strn-Mlck (gene:FBgn0265045 transcript:FBtr0336643)

HSP 1 Score: 219.164 bits (557), Expect = 2.621e-61
Identity = 119/314 (37.90%), Postives = 185/314 (58.92%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHI-ETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
            +GKG+FG V +V    + ++  A+K I     + R  ++ EI I+  L   + +++L  + +     P+   ++ EY+ GGELF+++ A+   LTE + I  + Q+ DGV ++H +S++H DLKPENI+  ++ +  +KIIDFG A + D K P + + GT  F+ PE++ YEP G+ +D+WSVGVI + LL+G++PF     GDT     D E   NI R  YD+ DE F  +S+EAK FIS LL+     RL+A +CL  KWLS   + SL+ N    I   ++K ++   KWQK   AI+++    NL  S
Sbjct:  156 LGKGRFGIVYKVQERGQPEQLLAAKVIKCIKSQDRQKVLEEISIMRALQHPK-LLQLAASFE----SPREIVMVMEYITGGELFERVVADDFTLTEMDCILFLRQVCDGVAYMHGQSVVHLDLKPENIMCHTRTSHQIKIIDFGLAQRLDTKAPVRVLFGTPEFIPPEIISYEPIGFQSDMWSVGVICYVLLSGLSPF----MGDT-----DVETFSNITRADYDYDDEAFDCVSQEAKDFISQLLVHRKEDRLTAQQCLASKWLSQRPDDSLSNN---KICTDKLKKFIIRRKWQKTGNAIRALGRMANLSVS 452          
BLAST of Myosin, light chain kinase a vs. Ensembl Fly
Match: Strn-Mlck (gene:FBgn0265045 transcript:FBtr0336646)

HSP 1 Score: 219.164 bits (557), Expect = 1.969e-60
Identity = 119/314 (37.90%), Postives = 185/314 (58.92%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHI-ETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
            +GKG+FG V +V    + ++  A+K I     + R  ++ EI I+  L   + +++L  + +     P+   ++ EY+ GGELF+++ A+   LTE + I  + Q+ DGV ++H +S++H DLKPENI+  ++ +  +KIIDFG A + D K P + + GT  F+ PE++ YEP G+ +D+WSVGVI + LL+G++PF     GDT     D E   NI R  YD+ DE F  +S+EAK FIS LL+     RL+A +CL  KWLS   + SL+ N    I   ++K ++   KWQK   AI+++    NL  S
Sbjct:  284 LGKGRFGIVYKVQERGQPEQLLAAKVIKCIKSQDRQKVLEEISIMRALQHPK-LLQLAASFE----SPREIVMVMEYITGGELFERVVADDFTLTEMDCILFLRQVCDGVAYMHGQSVVHLDLKPENIMCHTRTSHQIKIIDFGLAQRLDTKAPVRVLFGTPEFIPPEIISYEPIGFQSDMWSVGVICYVLLSGLSPF----MGDT-----DVETFSNITRADYDYDDEAFDCVSQEAKDFISQLLVHRKEDRLTAQQCLASKWLSQRPDDSLSNN---KICTDKLKKFIIRRKWQKTGNAIRALGRMANLSVS 580          
BLAST of Myosin, light chain kinase a vs. Ensembl Fly
Match: Strn-Mlck (gene:FBgn0265045 transcript:FBtr0336644)

HSP 1 Score: 219.164 bits (557), Expect = 2.134e-60
Identity = 119/314 (37.90%), Postives = 185/314 (58.92%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHI-ETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
            +GKG+FG V +V    + ++  A+K I     + R  ++ EI I+  L   + +++L  + +     P+   ++ EY+ GGELF+++ A+   LTE + I  + Q+ DGV ++H +S++H DLKPENI+  ++ +  +KIIDFG A + D K P + + GT  F+ PE++ YEP G+ +D+WSVGVI + LL+G++PF     GDT     D E   NI R  YD+ DE F  +S+EAK FIS LL+     RL+A +CL  KWLS   + SL+ N    I   ++K ++   KWQK   AI+++    NL  S
Sbjct:  300 LGKGRFGIVYKVQERGQPEQLLAAKVIKCIKSQDRQKVLEEISIMRALQHPK-LLQLAASFE----SPREIVMVMEYITGGELFERVVADDFTLTEMDCILFLRQVCDGVAYMHGQSVVHLDLKPENIMCHTRTSHQIKIIDFGLAQRLDTKAPVRVLFGTPEFIPPEIISYEPIGFQSDMWSVGVICYVLLSGLSPF----MGDT-----DVETFSNITRADYDYDDEAFDCVSQEAKDFISQLLVHRKEDRLTAQQCLASKWLSQRPDDSLSNN---KICTDKLKKFIIRRKWQKTGNAIRALGRMANLSVS 596          
BLAST of Myosin, light chain kinase a vs. Ensembl Fly
Match: Strn-Mlck (gene:FBgn0265045 transcript:FBtr0336649)

HSP 1 Score: 219.55 bits (558), Expect = 1.044e-59
Identity = 119/314 (37.90%), Postives = 185/314 (58.92%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHI-ETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
            +GKG+FG V +V    + ++  A+K I     + R  ++ EI I+  L   + +++L  + +     P+   ++ EY+ GGELF+++ A+   LTE + I  + Q+ DGV ++H +S++H DLKPENI+  ++ +  +KIIDFG A + D K P + + GT  F+ PE++ YEP G+ +D+WSVGVI + LL+G++PF     GDT     D E   NI R  YD+ DE F  +S+EAK FIS LL+     RL+A +CL  KWLS   + SL+ N    I   ++K ++   KWQK   AI+++    NL  S
Sbjct: 7587 LGKGRFGIVYKVQERGQPEQLLAAKVIKCIKSQDRQKVLEEISIMRALQHPK-LLQLAASFES----PREIVMVMEYITGGELFERVVADDFTLTEMDCILFLRQVCDGVAYMHGQSVVHLDLKPENIMCHTRTSHQIKIIDFGLAQRLDTKAPVRVLFGTPEFIPPEIISYEPIGFQSDMWSVGVICYVLLSGLSPF----MGDT-----DVETFSNITRADYDYDDEAFDCVSQEAKDFISQLLVHRKEDRLTAQQCLASKWLSQRPDDSLSNN---KICTDKLKKFIIRRKWQKTGNAIRALGRMANLSVS 7883          
BLAST of Myosin, light chain kinase a vs. Ensembl Fly
Match: Strn-Mlck (gene:FBgn0265045 transcript:FBtr0336651)

HSP 1 Score: 219.55 bits (558), Expect = 1.124e-59
Identity = 119/314 (37.90%), Postives = 185/314 (58.92%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHI-ETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
            +GKG+FG V +V    + ++  A+K I     + R  ++ EI I+  L   + +++L  + +     P+   ++ EY+ GGELF+++ A+   LTE + I  + Q+ DGV ++H +S++H DLKPENI+  ++ +  +KIIDFG A + D K P + + GT  F+ PE++ YEP G+ +D+WSVGVI + LL+G++PF     GDT     D E   NI R  YD+ DE F  +S+EAK FIS LL+     RL+A +CL  KWLS   + SL+ N    I   ++K ++   KWQK   AI+++    NL  S
Sbjct: 7626 LGKGRFGIVYKVQERGQPEQLLAAKVIKCIKSQDRQKVLEEISIMRALQHPK-LLQLAASFES----PREIVMVMEYITGGELFERVVADDFTLTEMDCILFLRQVCDGVAYMHGQSVVHLDLKPENIMCHTRTSHQIKIIDFGLAQRLDTKAPVRVLFGTPEFIPPEIISYEPIGFQSDMWSVGVICYVLLSGLSPF----MGDT-----DVETFSNITRADYDYDDEAFDCVSQEAKDFISQLLVHRKEDRLTAQQCLASKWLSQRPDDSLSNN---KICTDKLKKFIIRRKWQKTGNAIRALGRMANLSVS 7922          
BLAST of Myosin, light chain kinase a vs. Ensembl Zebrafish
Match: mylka (myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8207])

HSP 1 Score: 236.113 bits (601), Expect = 2.528e-66
Identity = 134/330 (40.61%), Postives = 195/330 (59.09%), Query Frame = 2
Query:  857 SIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNL-SRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +IKT   + +  FY  E R+G GKFG V ++    TKK +A K I   S K ++N+  EI I++ LH  +    L++ ID    K     ++ E + GGELFD+I + +  LTE+ VI  M QI+DGVNFIH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YE   Y TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  ISEEAK FIS+LL ++   RL+  +C +H WL     K   TN+ ++ +S +RMK Y+   KWQK   A++++    N+
Sbjct:  458 TIKTD--VKVKDFYDVEDRLGTGKFGTVFKLIEKSTKKVWAGKFIKAYSAKEKENVRQEIAIMNDLHHPK----LVQCIDAFEGKTDIVMVL-EMISGGELFDRIIDEDFELTEREVIKYMLQIVDGVNFIHKKGIVHLDLKPENIMCVNKTGSKIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEAISYATDMWSIGVICYILVSGLSPF----MGD-----NDNETLSNVTSATWDFEDEAFDEISEEAKDFISNLLKKDMKARLTCDQCFQHPWL-----KQDTTNMEAKKLSKERMKKYILRRKWQKTGHAVRAIGRLSNM 766          
BLAST of Myosin, light chain kinase a vs. Ensembl Zebrafish
Match: mylkb (myosin light chain kinase b [Source:ZFIN;Acc:ZDB-GENE-041111-150])

HSP 1 Score: 227.254 bits (578), Expect = 5.588e-63
Identity = 125/322 (38.82%), Postives = 194/322 (60.25%), Query Frame = 2
Query:  881 SISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNL-SRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            S+  FY  E R+G GKFG+V ++    +KK +A K I   S+K ++N+  EI I++ LH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+ VI  M QI+DGV FIH + I+H DLKPENI+  +K    +K+IDFG A + ++    K + GT  FVAPEV+ YE   Y TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS LL ++   RL+ ++C +H WL     K    N+ ++ +S +RMK Y+   +WQK   A++++S F ++
Sbjct:  522 SVKDFYDIEDRLGTGKFGQVFKLVEKSSKKVWAGKFIKAFSQKEKENVRQEIGIMNSLHHPK----LVQCMDAFEGKSDMVMVM-EMISGGELFERIVDEDFELTEREVIKYMLQIIDGVQFIHKQGIVHLDLKPENIMCINKTGSKIKLIDFGLARRLEDSGSLKVLFGTPEFVAPEVINYEAISYPTDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFEDEAFDEISDQAKDFISRLLKKDMRARLTCAQCFEHSWL-----KQDTKNMEAKQLSKERMKKYILRRRWQKTGNAVRAISRFSSM 824          
BLAST of Myosin, light chain kinase a vs. Ensembl Zebrafish
Match: mylk2 (myosin light chain kinase 2 [Source:ZFIN;Acc:ZDB-GENE-080616-2])

HSP 1 Score: 203.756 bits (517), Expect = 1.879e-55
Identity = 117/339 (34.51%), Postives = 203/339 (59.88%), Query Frame = 2
Query:  839 LAHHTKSIKTHPGISIS-QFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIAN-TELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
             AH   ++K+ P    +   +T EV +G G+FGKV + T   T    A+K I  R+ K RD  +NE+++++ L    +I++L EA +          +I EY++GGELF++I + +  LTE + +  + QI +GV ++H   ++H DLKPENI+  ++++  +KIIDFG A ++  +   K   GT  F+APEV+ ++   + TD+W++GV+ + LL+G++PF     GD      D + + N+    + F ++ F  +S +A+ F+S+LLIRE S R+SA++CLKH WL++ + K+ ++N+    S   +K Y+A   W+K  +AI + + FK + +S
Sbjct:  447 FAHRFVALKSSPPPCDTFSIHTREV-LGGGRFGKVHKCTETRTGMRLAAKIINTRNSKERDMALNEMQVMNQL-SHPNILQLYEAFEVKNQ----VVLILEYVEGGELFERIVDESSPLTEVDAMVFVKQICEGVQYMHQMYVLHLDLKPENILLVNRSSHQVKIIDFGLARRYKPREKLKVSFGTPEFLAPEVVNFDFVSFPTDMWTLGVVTYMLLSGLSPF----LGD-----DDGQTLNNVLMGNWYFDEDAFEHVSADARDFVSNLLIRERSGRMSATQCLKHPWLNNIFEKAKSSNIVLK-SQVLLKKYMARRLWKKNYIAIAAANRFKKIGSS 769          
BLAST of Myosin, light chain kinase a vs. Ensembl Zebrafish
Match: mylk5 (myosin, light chain kinase 5 [Source:ZFIN;Acc:ZDB-GENE-050309-74])

HSP 1 Score: 202.601 bits (514), Expect = 1.018e-54
Identity = 117/303 (38.61%), Postives = 179/303 (59.08%), Query Frame = 2
Query:  911 RIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELL-TEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLS-SCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAI 1813
            ++G GKFG+V R+TH  T +  A K    R  K R+    EIE+++ LH  +    L++ +    +K +   ++ EY+ GGELF++I +     TE + +G M QIL+G+ ++H ++I+H DLKPENIV   +    +KIIDFG A K D   P K M GT  FVAPEV+ +E     TD+WSVGVI + LL+G +PF+    G+     SD E +  +   +++F +E F  I++ AK FISSLL ++P +RLS  E L H WL   C + S  ++  +++S  +MK ++   KW+K   A+
Sbjct:  439 KLGVGKFGQVFRMTHKVTGRECAGKFYKSRRAKDREAARKEIELMNFLHHPK----LVQCLAAYDNKAEMVMVM-EYVAGGELFERIVDDSFEHTEVSSVGYMRQILEGIKYMHQQNILHLDLKPENIVCVDRTGSQIKIIDFGLACKLDPNTPLKVMQGTPEFVAPEVINFEAVTLTTDMWSVGVICYILLSGESPFQ----GE-----SDTETLALVTAAQWEFDEESFEEITDMAKGFISSLLNKDPRRRLSCEEALAHDWLGFLCVDNS--SSGGKNLSKDKMKKFLTRQKWKKTGKAL 725          
BLAST of Myosin, light chain kinase a vs. Ensembl Zebrafish
Match: mylk3 (myosin light chain kinase 3 [Source:NCBI gene;Acc:561635])

HSP 1 Score: 199.519 bits (506), Expect = 2.418e-54
Identity = 120/316 (37.97%), Postives = 181/316 (57.28%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKS--LNTNLSRSISLQRMKNYVAVHK-WQKLCMAIKSVSNFKNLITS 1849
            +G G+FG+V +   + +    A+K I  R  K RD + NEI +++ L+   H+  LI+  D   S+     +I EY++GGELF++I +    LTE + I    QI +GV ++H + I+H DLKPENI+  +   + +KIIDFG A K+  +   K   GT  F+APEV+ Y+   + TD+WSVGVI + LL+G++PF     GD     +D E + NI   +++F  E F  +SEEAK FISSLL+     RLSAS C+KH WL++  +K+      L   + LQR   Y+  H+ W+K   A+ + +  K    S
Sbjct:  411 LGGGRFGQVHKCAELSSGLTLAAKIIKVRGMKERDEVKNEIGVMNQLN---HV-NLIQLYDAFESRTN-LTLIMEYVEGGELFERIIDESYQLTELDAIVFTRQICEGVQYLHQQYILHLDLKPENILCVNSTGNQIKIIDFGLARKYRPREKLKVNFGTPEFLAPEVVNYDFVSFPTDMWSVGVITYMLLSGLSPF----MGD-----NDAETMNNILHAKWEFDTEAFENVSEEAKDFISSLLVSAKCSRLSASGCMKHSWLNNLEDKAKMYKVRLKSQMMLQR---YLVAHRQWKKHFYAVAAANRLKRFQQS 709          
BLAST of Myosin, light chain kinase a vs. Ensembl Xenopus
Match: MYLK4 (myosin light chain kinase family member 4 [Source:NCBI gene;Acc:100497991])

HSP 1 Score: 197.208 bits (500), Expect = 6.065e-57
Identity = 119/297 (40.07%), Postives = 179/297 (60.27%), Query Frame = 2
Query:  884 ISQFYTDEV--RIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRM 1765
            I+ FYT E    +G G+FG+V R     +    A+K I  +S K ++ + NEI++++ L+   H+  LI+  D   S+     +I EY+ GGELFD+I +    L+E + I  + QIL+G+ ++H   I+H DLKPENIV  S+    +KIIDFG A ++  +   K   GT  F+APEV+ Y+   + TD+WSVGVIA+ LL+G++PF   L  D      D E + NI  C+YDF  E F  ISE AK FI+ LLI+E   R+SA+E LKH W+S   + +L+  +S+ +S++ +
Sbjct:   22 INNFYTVETSEMLGGGRFGQVHRCVEKSSGLSLAAKIIKVKSHKEKEEVKNEIQVMNQLN---HV-NLIQLYDAFESRNDIV-LIMEYVKGGELFDRIIDENYNLSEADTIQFIKQILEGIQYMHQMYIVHLDLKPENIVCVSRTAYQVKIIDFGLARRYKPREKLKVHFGTPEFLAPEVVNYDYVSFPTDMWSVGVIAYMLLSGLSPF---LGED------DNETLNNILACQYDFEGEEFENISEAAKDFITKLLIKEKCWRMSATEALKHLWIS---DSNLHYRISQQVSIKSI 301          
BLAST of Myosin, light chain kinase a vs. Ensembl Xenopus
Match: nek2 (NIMA-related kinase 2 [Source:NCBI gene;Acc:407849])

HSP 1 Score: 191.815 bits (486), Expect = 3.498e-54
Identity = 122/304 (40.13%), Postives = 174/304 (57.24%), Query Frame = 2
Query:  911 RIGKGKFGKVSRVTHIETKKHFASKTIIYRSEK------TRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKN--NDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSR-SISLQRMKNYVAVHKWQ 1795
            ++G G FG+V +     T  ++A K I  R  K       RD +  E+ IL  L    +IM L    D   SK +   +I E + GGELFD IA  E L+E++ I  + QIL GV ++H+RSI H DLKPENI+   K+  +  +KIIDFG A K ++    KS+ GT  ++APEV+ YEP G  TD+WS+GVI + LL+G++PF+    G+T     D E + N+    Y+F D  F   SE AK FI  LL+++P  R++A ECL H W+    N+    N SR SI+++  K + A  KW+
Sbjct:   18 KLGSGHFGEVKKCKEKSTGTYYAGKFIKTRKCKGSRLGLDRDQVEREVFILQQLEHP-NIMRLH---DVFASKAEMV-LILELIRGGELFDFIAEKEALSEEDAIEFLEQILKGVAYMHTRSIAHFDLKPENIMLLQKDVPHPKIKIIDFGLAQKIEDGTVFKSLCGTPQYIAPEVINYEPLGPPTDMWSIGVITYILLSGLSPFQ----GET-----DQETLTNVVAGSYEFDDRIFKQTSELAKDFIRQLLLKDPRDRMTAVECLIHPWIKP-LNRKQAVNRSRSSINMKNFKKFNARRKWK 306          
BLAST of Myosin, light chain kinase a vs. Ensembl Xenopus
Match: nek2 (NIMA-related kinase 2 [Source:NCBI gene;Acc:407849])

HSP 1 Score: 191.43 bits (485), Expect = 8.569e-54
Identity = 122/304 (40.13%), Postives = 174/304 (57.24%), Query Frame = 2
Query:  911 RIGKGKFGKVSRVTHIETKKHFASKTIIYRSEK------TRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKN--NDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSR-SISLQRMKNYVAVHKWQ 1795
            ++G G FG+V +     T  ++A K I  R  K       RD +  E+ IL  L    +IM L    D   SK +   +I E + GGELFD IA  E L+E++ I  + QIL GV ++H+RSI H DLKPENI+   K+  +  +KIIDFG A K ++    KS+ GT  ++APEV+ YEP G  TD+WS+GVI + LL+G++PF+    G+T     D E + N+    Y+F D  F   SE AK FI  LL+++P  R++A ECL H W+    N+    N SR SI+++  K + A  KW+
Sbjct:   62 KLGSGHFGEVKKCKEKSTGTYYAGKFIKTRKCKGSRLGLDRDQVEREVFILQQLEHP-NIMRLH---DVFASKAEMV-LILELIRGGELFDFIAEKEALSEEDAIEFLEQILKGVAYMHTRSIAHFDLKPENIMLLQKDVPHPKIKIIDFGLAQKIEDGTVFKSLCGTPQYIAPEVINYEPLGPPTDMWSIGVITYILLSGLSPFQ----GET-----DQETLTNVVAGSYEFDDRIFKQTSELAKDFIRQLLLKDPRDRMTAVECLIHPWIKP-LNRKQAVNRSRSSINMKNFKKFNARRKWK 350          
BLAST of Myosin, light chain kinase a vs. Ensembl Xenopus
Match: nek2 (NIMA-related kinase 2 [Source:NCBI gene;Acc:407849])

HSP 1 Score: 192.2 bits (487), Expect = 9.440e-54
Identity = 122/304 (40.13%), Postives = 174/304 (57.24%), Query Frame = 2
Query:  911 RIGKGKFGKVSRVTHIETKKHFASKTIIYRSEK------TRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKN--NDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSR-SISLQRMKNYVAVHKWQ 1795
            ++G G FG+V +     T  ++A K I  R  K       RD +  E+ IL  L    +IM L    D   SK +   +I E + GGELFD IA  E L+E++ I  + QIL GV ++H+RSI H DLKPENI+   K+  +  +KIIDFG A K ++    KS+ GT  ++APEV+ YEP G  TD+WS+GVI + LL+G++PF+    G+T     D E + N+    Y+F D  F   SE AK FI  LL+++P  R++A ECL H W+    N+    N SR SI+++  K + A  KW+
Sbjct:   62 KLGSGHFGEVKKCKEKSTGTYYAGKFIKTRKCKGSRLGLDRDQVEREVFILQQLEHP-NIMRLH---DVFASKAEMV-LILELIRGGELFDFIAEKEALSEEDAIEFLEQILKGVAYMHTRSIAHFDLKPENIMLLQKDVPHPKIKIIDFGLAQKIEDGTVFKSLCGTPQYIAPEVINYEPLGPPTDMWSIGVITYILLSGLSPFQ----GET-----DQETLTNVVAGSYEFDDRIFKQTSELAKDFIRQLLLKDPRDRMTAVECLIHPWIKP-LNRKQAVNRSRSSINMKNFKKFNARRKWK 350          
BLAST of Myosin, light chain kinase a vs. Ensembl Xenopus
Match: ENSXETT00000029423.1 (serine/threonine-protein kinase 17A-like [Source:NCBI gene;Acc:101732252])

HSP 1 Score: 188.348 bits (477), Expect = 3.683e-53
Identity = 110/297 (37.04%), Postives = 168/297 (56.57%), Query Frame = 2
Query:  839 LAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYR--SEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIA--NTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKN--NDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSC 1711
            L+H    ++  P +S  +    E  +G+GKF  V +   + + K +A+K +  R   E  R +IINEI IL+      ++++L E  + N        ++ EY  GGE+F+Q      E  TEK+V+ ++ QIL GV  +H  +++H DLKP+NI+  S +   D+ +I+DFG + + D     + ++GT  +VAPEVL YEP    TD+WSVGV+ + +L G++PF     GDT +     E   NI +    +S E F GISE A  FI SLL++ P KR+ A +CLKH WL+S 
Sbjct:    7 LSHTHTPLREEPFLSSYRLVGKE--LGRGKFAVVRKCVELSSGKEYAAKFLRKRRKGEDCRSDIINEIAILEMARLSPYVVDLHEVYETNSE----IVLVMEYAAGGEIFEQCVADQDEAFTEKDVVRLISQILQGVLHLHRSNVVHLDLKPQNILLTSSSPLGDI-RIVDFGLSRQVDAIKEIREILGTPEYVAPEVLSYEPISTATDMWSVGVLTYVMLTGVSPF----LGDTKQ-----ETFLNISQVNIQYSQEDFQGISEPAIDFIKSLLVKNPRKRIRADQCLKHPWLNSA 287          
BLAST of Myosin, light chain kinase a vs. Ensembl Mouse
Match: Mylk (myosin, light polypeptide kinase [Source:MGI Symbol;Acc:MGI:894806])

HSP 1 Score: 227.254 bits (578), Expect = 3.115e-62
Identity = 126/320 (39.38%), Postives = 188/320 (58.75%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +S  Y  E R+G GKFG+V R+   +T K +A K     S K +DNI  EI I++CLH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+  I  M QI +GV +IH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YEP GY TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS+LL ++   RL  ++CL+H WL     K      ++ +S  RMK Y+A  KWQK   A++++    ++
Sbjct: 1491 VSDVYDIEERLGSGKFGQVFRLVEKKTGKIWAGKFFKAYSAKEKDNIRQEISIMNCLHHPK----LVQCVDAFEEKANIVMVL-EIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLM----KDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1792          
BLAST of Myosin, light chain kinase a vs. Ensembl Mouse
Match: Mylk3 (myosin light chain kinase 3 [Source:MGI Symbol;Acc:MGI:2443063])

HSP 1 Score: 219.55 bits (558), Expect = 8.022e-62
Identity = 132/325 (40.62%), Postives = 198/325 (60.92%), Query Frame = 2
Query:  875 GISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLIT 1846
            G ++SQ    EV +G G+FG+V R T   T    A+K I  ++ K R+++ NE+ I++ L    H+  LI+  D   SK  +F +I EY+DGGELFD+I + +  LTE +V+    QI +GV+++H   I+H DLKPENI+  S+    +KIIDFG A ++  +   K   GT  F+APEV+ YE   + TD+WSVGVI + LL+G++PF     G+T     D E +  I  C +DF  + F G+SEEAK F+S LL++E S R+SA++CLKH+WLS    K+  +N+ R  S Q ++ Y+A  KW+K    + +V+  +   T
Sbjct:  355 GYTVSQH---EV-LGGGRFGQVHRCTERSTGLALAAKIIKVKNVKDREDVKNEVNIMNQLS---HV-NLIQLYDAFESK-SSFTLIMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVSQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPF----LGET-----DAETMNFIVNCSWDFDADTFKGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLSHLPAKASGSNV-RLRSQQLLQKYMAQSKWKKHFHVVTAVNRLRKFPT 660          
BLAST of Myosin, light chain kinase a vs. Ensembl Mouse
Match: Mylk3 (myosin light chain kinase 3 [Source:MGI Symbol;Acc:MGI:2443063])

HSP 1 Score: 219.55 bits (558), Expect = 5.528e-61
Identity = 134/338 (39.64%), Postives = 200/338 (59.17%), Query Frame = 2
Query:  845 HHTKSIK---THPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLIT 1846
            H   SIK      G ++SQ       +G G+FG+V R T   T    A+K I  ++ K R+++ NE+ I++ L    H+  LI+  D   SK  +F +I EY+DGGELFD+I + +  LTE +V+    QI +GV+++H   I+H DLKPENI+  S+    +KIIDFG A ++  +   K   GT  F+APEV+ YE   + TD+WSVGVI + LL+G++PF     G+T     D E +  I  C +DF  + F G+SEEAK F+S LL++E S R+SA++CLKH+WLS    K+  +N+ R  S Q ++ Y+A  KW+K    + +V+  +   T
Sbjct:  475 HRVVSIKDTLISAGYTVSQHEV----LGGGRFGQVHRCTERSTGLALAAKIIKVKNVKDREDVKNEVNIMNQLS---HV-NLIQLYDAFESK-SSFTLIMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVSQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPF----LGET-----DAETMNFIVNCSWDFDADTFKGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLSHLPAKASGSNV-RLRSQQLLQKYMAQSKWKKHFHVVTAVNRLRKFPT 793          
BLAST of Myosin, light chain kinase a vs. Ensembl Mouse
Match: Mylk3 (myosin light chain kinase 3 [Source:MGI Symbol;Acc:MGI:2443063])

HSP 1 Score: 215.698 bits (548), Expect = 5.414e-60
Identity = 131/321 (40.81%), Postives = 193/321 (60.12%), Query Frame = 2
Query:  845 HHTKSIK---THPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQ 1795
            H   SIK      G ++SQ       +G G+FG+V R T   T    A+K I  ++ K R+++ NE+ I++ L    H+  LI+  D   SK  +F +I EY+DGGELFD+I + +  LTE +V+    QI +GV+++H   I+H DLKPENI+  S+    +KIIDFG A ++  +   K   GT  F+APEV+ YE   + TD+WSVGVI + LL+G++PF     G+T     D E +  I  C +DF  + F G+SEEAK F+S LL++E S R+SA++CLKH+WLS    K+  +N+ R  S Q ++ Y+A  KW+
Sbjct:  412 HRVVSIKDTLISAGYTVSQHEV----LGGGRFGQVHRCTERSTGLALAAKIIKVKNVKDREDVKNEVNIMNQLS---HV-NLIQLYDAFESK-SSFTLIMEYVDGGELFDRITDEKYHLTELDVVLFTRQICEGVHYLHQHYILHLDLKPENILCVSQTGHQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPF----LGET-----DAETMNFIVNCSWDFDADTFKGLSEEAKDFVSRLLVKEKSCRMSATQCLKHEWLSHLPAKASGSNV-RLRSQQLLQKYMAQSKWK 713          
BLAST of Myosin, light chain kinase a vs. Ensembl Mouse
Match: Mylk4 (myosin light chain kinase family, member 4 [Source:MGI Symbol;Acc:MGI:3643758])

HSP 1 Score: 197.978 bits (502), Expect = 1.905e-56
Identity = 114/265 (43.02%), Postives = 162/265 (61.13%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLS 1705
            +G G+FG+V +     T    A+K I  R  K ++++ NEI +++ L    H+  LI+  D   SK     ++ EY++GGELFD+I +    LTE + I  M QI +G+ ++H   I+H DLKPENI+  +++   +KIIDFG A ++  +   K   GT  F+APEV+ Y+   + TD+WSVGVI + LL+G++PF     GD     +D E + NI  CR+D  DE F  ISEEAK FIS LLI+E S R+SASE LKH WLS
Sbjct:  113 LGGGRFGQVHKCEEKATGLKLAAKIIKTRGAKDKEDVKNEISVMNQLD---HV-NLIQLYDAFESKHDII-LVMEYVEGGELFDRIIDENCNLTELDTILFMKQICEGIRYMHQMYILHLDLKPENILCVNRDAKQIKIIDFGLARRYKPREKLKVNFGTPEFLAPEVVNYDFVSFSTDMWSVGVITYMLLSGLSPF----LGD-----NDAETLTNILACRWDLEDEEFQDISEEAKEFISKLLIKEKSWRISASEALKHPWLS 363          
BLAST of Myosin, light chain kinase a vs. UniProt/SwissProt
Match: sp|Q28824|MYLK_BOVIN (Myosin light chain kinase, smooth muscle OS=Bos taurus OX=9913 GN=MYLK PE=1 SV=1)

HSP 1 Score: 228.794 bits (582), Expect = 3.554e-62
Identity = 126/320 (39.38%), Postives = 190/320 (59.38%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +S FY  E R+G GKFG+V R+   +T K +A K     S K ++NI  EI I++CLH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+  I  M QI +GV +IH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YEP GY TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS+LL ++   RL+ ++CL+H WL     K      ++ +S  RMK Y+A  KWQK   A++++    ++
Sbjct:  721 VSDFYDIEERLGSGKFGQVFRLVEKKTGKIWAGKFFKAYSAKEKENIRQEISIMNCLHHPK----LVQCVDAFEEKANIVMVL-EIVSGGELFERIIDEDFELTERECIKYMKQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLNCTQCLQHPWLM----KDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1022          
BLAST of Myosin, light chain kinase a vs. UniProt/SwissProt
Match: sp|Q15746|MYLK_HUMAN (Myosin light chain kinase, smooth muscle OS=Homo sapiens OX=9606 GN=MYLK PE=1 SV=4)

HSP 1 Score: 229.18 bits (583), Expect = 4.621e-62
Identity = 126/320 (39.38%), Postives = 190/320 (59.38%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +S FY  E R+G GKFG+V R+   +T+K +A K     S K ++NI  EI I++CLH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+  I  M QI +GV +IH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YEP GY TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS+LL ++   RL  ++CL+H WL     K      ++ +S  RMK Y+A  KWQK   A++++    ++
Sbjct: 1460 VSDFYDIEERLGSGKFGQVFRLVEKKTRKVWAGKFFKAYSAKEKENIRQEISIMNCLHHPK----LVQCVDAFEEKANIVMVL-EIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLM----KDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1761          
BLAST of Myosin, light chain kinase a vs. UniProt/SwissProt
Match: sp|P29294|MYLK_RABIT (Myosin light chain kinase, smooth muscle OS=Oryctolagus cuniculus OX=9986 GN=MYLK PE=1 SV=2)

HSP 1 Score: 226.868 bits (577), Expect = 1.590e-61
Identity = 125/320 (39.06%), Postives = 188/320 (58.75%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +S FY  E R+G GKFG+V R+   +T K +A K     S K ++NI  EI I++CLH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+  I  M QI +GV +IH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YEP  Y TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS+LL ++   RL  ++CL+H WL     K      ++ +S  RMK Y+A  KWQK   A++++    ++
Sbjct:  692 VSDFYDIEERLGSGKFGQVFRLVEKKTGKIWAGKFFKAYSAKEKENIPAEIGIMNCLHHPK----LVQCVDAFEEKANIVMVL-EIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPISYATDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLM----KDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 993          
BLAST of Myosin, light chain kinase a vs. UniProt/SwissProt
Match: sp|Q6PDN3|MYLK_MOUSE (Myosin light chain kinase, smooth muscle OS=Mus musculus OX=10090 GN=Mylk PE=1 SV=3)

HSP 1 Score: 226.868 bits (577), Expect = 2.693e-61
Identity = 126/320 (39.38%), Postives = 188/320 (58.75%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +S  Y  E R+G GKFG+V R+   +T K +A K     S K +DNI  EI I++CLH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+  I  M QI +GV +IH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YEP GY TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS+LL ++   RL  ++CL+H WL     K      ++ +S  RMK Y+A  KWQK   A++++    ++
Sbjct: 1482 VSDVYDIEERLGSGKFGQVFRLVEKKTGKIWAGKFFKAYSAKEKDNIRQEISIMNCLHHPK----LVQCVDAFEEKANIVMVL-EIVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTRIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEPIGYATDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKNRLDCTQCLQHPWLM----KDTKNMEAKKLSKDRMKKYMARRKWQKTGNAVRAIGRLSSM 1783          
BLAST of Myosin, light chain kinase a vs. UniProt/SwissProt
Match: sp|P11799|MYLK_CHICK (Myosin light chain kinase, smooth muscle OS=Gallus gallus OX=9031 GN=Mylk PE=1 SV=2)

HSP 1 Score: 225.328 bits (573), Expect = 8.451e-61
Identity = 125/320 (39.06%), Postives = 190/320 (59.38%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +S  Y  E R+G GKFG+V R+   +T K +A K     S K ++NI +EI I++CLH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+  I  M QI +GV +IH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YEP GY TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS++AK FIS+LL ++   RL+ ++CL+H WL     K      ++ +S  RMK Y+A  KWQK   A++++    ++
Sbjct: 1449 VSDVYNIEERLGSGKFGQVFRLVEKKTGKVWAGKFFKAYSAKEKENIRDEISIMNCLHHPK----LVQCVDAFEEKANIVMVL-EMVSGGELFERIIDEDFELTERECIKYMRQISEGVEYIHKQGIVHLDLKPENIMCVNKTGTSIKLIDFGLARRLESAGSLKVLFGTPEFVAPEVINYEPIGYETDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFDDEAFDEISDDAKDFISNLLKKDMKSRLNCTQCLQHPWL----QKDTKNMEAKKLSKDRMKKYMARRKWQKTGHAVRAIGRLSSM 1750          
BLAST of Myosin, light chain kinase a vs. TrEMBL
Match: A0A5C6PK07 (Myosin light chain kinase, smooth muscle OS=Takifugu flavidus OX=433684 GN=D4764_01G0000170 PE=3 SV=1)

HSP 1 Score: 240.736 bits (613), Expect = 4.290e-68
Identity = 129/337 (38.28%), Postives = 196/337 (58.16%), Query Frame = 2
Query:  833 NNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
             +L H   S      + + + Y  E R+G GKFG+V ++    TKK +A K I   S K +DN+  EI I++ LH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+ VI  M QI+DGVNFIH + ++H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YE  GY TD+WS+GVI + LL+G++PF     GD     +D E + N+    +DF DE F  ISE AK FI++LL ++   RL+ ++C +H WL     +  NT  ++ +S +RMK Y+   KWQK   A++++    ++
Sbjct:    8 GSLGHAKPSTTIRTDVKVKELYDVEERLGTGKFGQVFKLVEKATKKVWAGKFIKAYSAKEKDNVRQEISIMNSLHHPK----LVQCVDAFEGKSDIVMVL-EMISGGELFERIIDEDFELTEREVIKYMLQIVDGVNFIHKQGVVHLDLKPENIMCVNKTGSKIKLIDFGLARRLENAGTLKVLFGTPEFVAPEVINYEAIGYATDMWSIGVICYILLSGLSPF----MGD-----NDNETLSNVTSATWDFEDEAFDEISENAKDFITNLLKKDMKARLTCAQCFEHTWL----KQDTNTMKAKKLSKERMKKYILRRKWQKTGHAVRAIGRLSSM 326          
BLAST of Myosin, light chain kinase a vs. TrEMBL
Match: K1QCF7 (Myosin light chain kinase, smooth muscle OS=Crassostrea gigas OX=29159 GN=CGI_10010738 PE=3 SV=1)

HSP 1 Score: 229.95 bits (585), Expect = 1.922e-65
Identity = 127/350 (36.29%), Postives = 205/350 (58.57%), Query Frame = 2
Query:  767 NSLLPSFKSVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTE-LLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAI 1813
            NS +     V+ ++S     +     H    IK    ++  ++   ++ +G+GKFG+V +    +T +  A+K I     + RD++INE++I+  L   R +++L +A +    K   F I++E + GGELF+++ N + +LTEK  I  M QI +G+ F+H R ++H DLKPENI+  ++  +++KIIDFG A KFD     + + GT  F+APEV+ ++P    TD+WS+GVI + LL+G++PF     GDT     D E + N+   ++DFS E F  IS+EAK FIS LL+++P KR+++ +CL H WL     +       RS+S +R+K +V   KWQK   A+
Sbjct:    5 NSKMKKSCKVHVDESEPSGADEMTFEHRNVCIKKSKWVT-EEYDVTDLLLGRGKFGEVKKCKEKKTGRFLAAKFIAVNGLQERDDVINEVDIMKTLQHPR-LLQLYDAFE----KKDTFCIVTELISGGELFERVINDDFILTEKACIMFMRQICEGIAFMHCREVLHLDLKPENILCLTREGNIIKIIDFGLARKFDPSGDLRILFGTPEFMAPEVVNFDPASPATDMWSIGVICYVLLSGLSPF----VGDT-----DAETLVNVTSAKWDFSAEEFESISKEAKDFISRLLVKDPRKRMTSRQCLDHIWLRRSQKREAKLP-ERSLSKKRLKKFVFRRKWQKAVNAM 338          
BLAST of Myosin, light chain kinase a vs. TrEMBL
Match: A0A1B6HUF1 (Protein kinase domain-containing protein (Fragment) OS=Homalodisca liturata OX=320908 GN=g.53578 PE=3 SV=1)

HSP 1 Score: 228.024 bits (580), Expect = 3.393e-65
Identity = 121/315 (38.41%), Postives = 191/315 (60.63%), Query Frame = 2
Query:  857 SIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQI-ANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLS-RSISLQRMKNYVAVHKWQ 1795
             +   PG    Q Y+    +GKG++G V +VT + T+   A+K +    ++ R+ +  EI+I++CL   + +++L+ A +     PK   +I EY+ GGELF+++ A+   LTE++ I  + QI +GV+++H   ++H DLKPENI+  ++ +  +KIIDFG A K +   P + + GT  F+ PE++ YEP G  +D+WSVGVI + LL+G++PF     GD     +D E   NI R  YDF DE F  IS++AK FIS+LLI+   KRL+A ECL+HKWL+ C     +  +S   +S  ++K ++   KWQ
Sbjct:   14 QVSLEPGEQFLQRYSVHEELGKGRYGVVHKVTDLRTQHTMAAKFVRCIKKQDREKVQEEIDIMNCLRHSK-LLQLVAAFE----NPKDIIMIMEYISGGELFERVVADDFTLTERDCILFLRQICEGVSYMHQSHVVHLDLKPENIMCHTRTSHRIKIIDFGLAQKLESGTPVRVLFGTPEFIPPEIINYEPIGVESDMWSVGVICYVLLSGLSPF----MGD-----NDAETFANITRADYDFDDEAFDAISQDAKDFISALLIKRKEKRLTAEECLQHKWLTQC-----DMTMSCVKLSTDKLKKFIIRRKWQ 309          
BLAST of Myosin, light chain kinase a vs. TrEMBL
Match: A0A3B1JU63 (Myosin light chain kinase b OS=Astyanax mexicanus OX=7994 PE=4 SV=1)

HSP 1 Score: 235.728 bits (600), Expect = 5.675e-65
Identity = 129/322 (40.06%), Postives = 197/322 (61.18%), Query Frame = 2
Query:  881 SISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNL-SRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            S+  FY+ E R+G GKFG+V ++    TKK +A K I   S+K ++N+  EI I++ LH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+ VI  M QI+DGV FIH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YE   Y TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  ISE+AK+FISSLL ++   RL+ ++CL+H WL     K    N+ ++ +S +RMK Y+   +WQK   A++++S F ++
Sbjct:  233 SVKDFYSVEDRLGTGKFGQVFKLVEKSTKKMWAGKFIKAFSQKEKENVRQEISIMNSLHHPK----LVQCVDAFEGKSDIVMVM-EMISGGELFERIVDEDFELTEREVIKYMLQIIDGVQFIHKQGIVHLDLKPENIMCVNKTGSKIKLIDFGLARRLENSGSLKVLFGTPEFVAPEVINYEEISYPTDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFEDEAFDEISEQAKNFISSLLKKDMKARLTCAQCLEHTWL-----KQDTKNMEAKQLSKERMKKYILRRRWQKTGNAVRAISRFSSM 535          
BLAST of Myosin, light chain kinase a vs. TrEMBL
Match: A0A0L8FZ45 (Protein kinase domain-containing protein (Fragment) OS=Octopus bimaculoides OX=37653 GN=OCBIM_22003654mg PE=3 SV=1)

HSP 1 Score: 225.713 bits (574), Expect = 3.397e-64
Identity = 124/323 (38.39%), Postives = 202/323 (62.54%), Query Frame = 2
Query:  857 SIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSV 1822
            +IKT   ++   +   +V +G+GKFG+V   T  +T + FA+K +  R  + R +I NEI+I+  L   R    L++  D    + K F +I E + GGELF+++ N +  LTE+  +  + QI +GV FIHS++I+H D+KPENI+  ++  + +KIIDFG A +FD +   + + GT  F+APEV+ +EP  + TD+WSVGVI + LL+G++PF     GD     +D + + N+   ++DF  E F  IS EAK FI+ LL++ P+KRLSA++CL+H WL    +++ + +  R++S +R+K +V+  KWQK   A+ ++
Sbjct:   13 TIKTDLWVT-DNYEISDVLLGRGKFGEVKVCTERQTGQEFAAKFLSVRGMQGRKDIRNEIDIMKSLRHPR----LLQMYDAYERRDK-FCLILELVSGGELFERVINEDFYLTERACVIFLRQICEGVEFIHSKNILHLDMKPENILCMTRTGNRIKIIDFGLARRFDPRDDMRVLFGTPEFIAPEVVNFEPISHRTDMWSVGVITYILLSGLSPF----LGD-----NDNQTLSNVTCAQWDFDAEEFESISAEAKDFITKLLVKRPTKRLSATDCLEHTWLKRSTSETASHD--RTLSKKRLKKFVSRRKWQKATNAMVAL 318          
BLAST of Myosin, light chain kinase a vs. Ensembl Cavefish
Match: mylkb (myosin light chain kinase, smooth muscle-like [Source:NCBI gene;Acc:103040564])

HSP 1 Score: 235.728 bits (600), Expect = 2.149e-68
Identity = 129/322 (40.06%), Postives = 197/322 (61.18%), Query Frame = 2
Query:  881 SISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNL-SRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            S+  FY+ E R+G GKFG+V ++    TKK +A K I   S+K ++N+  EI I++ LH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+ VI  M QI+DGV FIH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YE   Y TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  ISE+AK+FISSLL ++   RL+ ++CL+H WL     K    N+ ++ +S +RMK Y+   +WQK   A++++S F ++
Sbjct:  233 SVKDFYSVEDRLGTGKFGQVFKLVEKSTKKMWAGKFIKAFSQKEKENVRQEISIMNSLHHPK----LVQCVDAFEGKSDIVMVM-EMISGGELFERIVDEDFELTEREVIKYMLQIIDGVQFIHKQGIVHLDLKPENIMCVNKTGSKIKLIDFGLARRLENSGSLKVLFGTPEFVAPEVINYEEISYPTDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFEDEAFDEISEQAKNFISSLLKKDMKARLTCAQCLEHTWL-----KQDTKNMEAKQLSKERMKKYILRRRWQKTGNAVRAISRFSSM 535          
BLAST of Myosin, light chain kinase a vs. Ensembl Cavefish
Match: mylkb (myosin light chain kinase, smooth muscle-like [Source:NCBI gene;Acc:103040564])

HSP 1 Score: 235.728 bits (600), Expect = 8.755e-66
Identity = 129/322 (40.06%), Postives = 197/322 (61.18%), Query Frame = 2
Query:  881 SISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNL-SRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            S+  FY+ E R+G GKFG+V ++    TKK +A K I   S+K ++N+  EI I++ LH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+ VI  M QI+DGV FIH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YE   Y TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  ISE+AK+FISSLL ++   RL+ ++CL+H WL     K    N+ ++ +S +RMK Y+   +WQK   A++++S F ++
Sbjct:  560 SVKDFYSVEDRLGTGKFGQVFKLVEKSTKKMWAGKFIKAFSQKEKENVRQEISIMNSLHHPK----LVQCVDAFEGKSDIVMVM-EMISGGELFERIVDEDFELTEREVIKYMLQIIDGVQFIHKQGIVHLDLKPENIMCVNKTGSKIKLIDFGLARRLENSGSLKVLFGTPEFVAPEVINYEEISYPTDMWSIGVICYILVSGLSPF----MGD-----NDNETLANVTSATWDFEDEAFDEISEQAKNFISSLLKKDMKARLTCAQCLEHTWL-----KQDTKNMEAKQLSKERMKKYILRRRWQKTGNAVRAISRFSSM 862          
BLAST of Myosin, light chain kinase a vs. Ensembl Cavefish
Match: mylka (myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8207])

HSP 1 Score: 226.483 bits (576), Expect = 4.477e-63
Identity = 128/330 (38.79%), Postives = 195/330 (59.09%), Query Frame = 2
Query:  857 SIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNL-SRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +IKT   + +   Y  E R+G GKFG V ++    TKK +A K I   S K +DN+  EI I++ LH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+ VI  M QI+DGV+FIH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YE   Y TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS+EAK FIS+LL ++ + RL+  +C +H WL     K   +N+ ++ +S +RMK Y+   KWQK   A++++    ++
Sbjct:  458 TIKTD--VKVKDLYDVEDRLGSGKFGTVFKLIEKATKKVWAGKFIKAYSAKEKDNVRQEIGIMNDLHHPK----LVQCVDAFEGKTDIVMVL-EMISGGELFERIIDEDFELTEREVIKYMLQIVDGVSFIHKKGIVHLDLKPENIMCVNKTGSKIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEAISYPTDMWSIGVICYILVSGLSPF----MGD-----NDNETLSNVTSATWDFEDEAFDEISDEAKDFISNLLKKDMTARLTCEQCFQHPWL-----KQDTSNMEAKKLSKERMKKYILRRKWQKTGHAVRAIGRLSSM 766          
BLAST of Myosin, light chain kinase a vs. Ensembl Cavefish
Match: mylka (myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8207])

HSP 1 Score: 226.868 bits (577), Expect = 1.834e-62
Identity = 128/330 (38.79%), Postives = 195/330 (59.09%), Query Frame = 2
Query:  857 SIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNL-SRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            +IKT   + +   Y  E R+G GKFG V ++    TKK +A K I   S K +DN+  EI I++ LH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+ VI  M QI+DGV+FIH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YE   Y TD+WS+GVI + L++G++PF     GD     +D E + N+    +DF DE F  IS+EAK FIS+LL ++ + RL+  +C +H WL     K   +N+ ++ +S +RMK Y+   KWQK   A++++    ++
Sbjct:  682 TIKTD--VKVKDLYDVEDRLGSGKFGTVFKLIEKATKKVWAGKFIKAYSAKEKDNVRQEIGIMNDLHHPK----LVQCVDAFEGKTDIVMVL-EMISGGELFERIIDEDFELTEREVIKYMLQIVDGVSFIHKKGIVHLDLKPENIMCVNKTGSKIKLIDFGLARRLENAGSLKVLFGTPEFVAPEVINYEAISYPTDMWSIGVICYILVSGLSPF----MGD-----NDNETLSNVTSATWDFEDEAFDEISDEAKDFISNLLKKDMTARLTCEQCFQHPWL-----KQDTSNMEAKKLSKERMKKYILRRKWQKTGHAVRAIGRLSSM 990          
BLAST of Myosin, light chain kinase a vs. Ensembl Cavefish
Match: mylk5 (myosin light chain kinase, smooth muscle-like [Source:NCBI gene;Acc:103036671])

HSP 1 Score: 211.846 bits (538), Expect = 3.298e-58
Identity = 120/311 (38.59%), Postives = 186/311 (59.81%), Query Frame = 2
Query:  911 RIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELL-TEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            ++G GKFG+V R+TH ET +  A K    R  K RD    EIE+++ LH  +    L++ +    +KP+   ++ E++ GGELF++I +     TE + +G M QI+ G+ ++H ++I+H DLKPENIV   +    +KIIDFG A K D  +P K M GT  FVAPEV+ YEP    TD+WS+GVI + LL+G +PF     GD     SD E +  +   +++F +E F  I+++AK FISSLL ++  +RLS  E L H W+ +   +S N + ++++S  +MK ++A  KW+K   A+ ++     L
Sbjct:  405 KLGVGKFGQVFRLTHKETGRVCAGKFYKGRRAKERDAAKKEIELMNFLHHPK----LVQCLAAYDNKPEIVMVM-EFIAGGELFERIVDDNYEHTEPSSVGYMRQIVQGIQYMHQQNIVHLDLKPENIVCVDRTGIQIKIIDFGLAAKLDPSNPVKVMHGTPEFVAPEVINYEPICLATDMWSIGVICYILLSGESPF----LGD-----SDSETLALVTAAQWEFDEESFEDITDQAKDFISSLLHKDVRRRLSCEEALSHSWMVAF--ESANPSSAKNLSKDKMKKFLARQKWKKTGKAVLALKRMALL 699          
BLAST of Myosin, light chain kinase a vs. Ensembl Sea Lamprey
Match: mylka (myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-GENE-030131-8207])

HSP 1 Score: 217.624 bits (553), Expect = 7.966e-60
Identity = 124/350 (35.43%), Postives = 202/350 (57.71%), Query Frame = 2
Query:  800 FEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTN--LSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            F      + E+ +  H    +  +P   ++  Y  + R+G G+FG+V ++   ++ K FA K I   + K +++I  EI +++ LH  +    L++ +D   SK     ++ E + GGELF++I + +  LTE+  I  M QI++GV F+H + I+H DLKPENI+  ++  + +KIIDFG A K +     K M GT  FVAPEV+ YEP GY TD+WSVGVI + L++G++    PL GD     +D E + N+    +DF DE F  ISE++K FIS LL +   +RL+ ++C++H WL       ++T    ++ +S +RMK Y+   KWQK   A++++    ++
Sbjct: 1366 FSDDDEKENETRDYGH----VSINPNKKLNDLYDVKERLGTGRFGQVFKLVEKKSGKTFAGKFIKALTAKDKESIHQEIALMNSLHHPK----LVQCVDAFESKTDIIMVL-ELISGGELFERIIDEDFELTERECIKYMRQIVEGVQFMHRQGIVHLDLKPENIMCLNQTGNRIKIIDFGLARKLENVKNLKVMFGTPEFVAPEVINYEPIGYATDMWSVGVICYILVSGLS----PLMGD-----NDNETLANVTSATWDFDDEAFDEISEDSKDFISHLLQKNMKERLTCTQCVEHPWL------QMDTEHMAAKKLSKERMKRYLTKRKWQKTGNAVRALGRLSSM 1691          
BLAST of Myosin, light chain kinase a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000000175.1 (pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 gene:ENSPMAG00000000155.1 transcript:ENSPMAT00000000175.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 199.519 bits (506), Expect = 2.845e-58
Identity = 117/335 (34.93%), Postives = 189/335 (56.42%), Query Frame = 2
Query:  848 HTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
            H   +     +S S     +  +G G+FG+V +     +    A+K I  +  K +D + NEI I++ L    ++++L +A +        F +I EY+ GGELFD+I + +  LTE + I  + QI +G++++H + I+H DLKPENI+  ++  + +KIIDFG A ++  +   K   GT  F+APEV+ Y+   + TD+WS+GVIA+ LL+G++PF     G+      D E + NI    +DF DE F  +SEEAK FIS LLI+E S R+SAS+CLKH WL +   ++    + R  S   +  Y+    W+K   A+ + +  + + +S
Sbjct:   17 HRMVVPQSEAVSTSYSIKQKDVLGGGRFGRVHKCVERTSGMTLAAKVIKAKGVKEKDEVNNEISIMNQLKHN-NLLQLYDAYESKND----FVLIMEYIHGGELFDRIVSEDYNLTELDAIIFIRQICEGIHYMHQQYILHLDLKPENILCVNRKGNQIKIIDFGLARRYKPREKLKVHFGTPEFLAPEVVNYDYVSFPTDMWSLGVIAYMLLSGLSPF----MGE-----DDNETLTNIVNVNWDFDDEAFENVSEEAKDFISRLLIKEKSGRMSASQCLKHNWLVNLSERAKKCKV-RLKSQLLLHTYMVRRMWKKNFFAVTAANRLRKISSS 336          
BLAST of Myosin, light chain kinase a vs. Ensembl Sea Lamprey
Match: ENSPMAT00000003997.1 (pep scaffold:Pmarinus_7.0:GL489063:434:4002:1 gene:ENSPMAG00000003652.1 transcript:ENSPMAT00000003997.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 188.348 bits (477), Expect = 2.132e-55
Identity = 93/234 (39.74%), Postives = 143/234 (61.11%), Query Frame = 2
Query: 1142 LDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            + GGELF+++++ +  LTE+  +  M QILDGV FIH + I+H DLKPENI+  ++    +KIIDFG A + +   P K M GT  FVAPEV+ +EP  + TD+WS+GVI + L++GI+    PL GDT     D E + N+  C +DF D+GF  ISE+ K  I  ++ ++  KR +  +C++H W+ S   +     L++    +RM++Y+   KWQK   A+++V     L
Sbjct:    1 VSGGELFERVSDDDFELTERECVEYMRQILDGVGFIHRQRIVHLDLKPENIMCVNRTGTCIKIIDFGLARRIEPGVPLKVMFGTPEFVAPEVIAFEPVTFVTDMWSIGVICYILVSGIS----PLAGDT-----DVETMANVTSCNWDFDDDGFADISEDCKDLIGKMIEKDVKKRWTCEQCVQHPWVQSSPERLEPKQLNK----ERMRSYITRRKWQKTVHAVRAVGRLAAL 221          
BLAST of Myosin, light chain kinase a vs. Ensembl Sea Lamprey
Match: mylk3 (myosin light chain kinase 3 [Source:NCBI gene;Acc:561635])

HSP 1 Score: 174.481 bits (441), Expect = 1.853e-49
Identity = 103/284 (36.27%), Postives = 170/284 (59.86%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSK-RLSASECLKHKWLSSCYNKSLNTNLSRSISLQR 1762
            +G G+FG+V R     +    A+K I  +S K ++ + NEI I++ L+   H+  L++  D   S+     +I EY++GGELF++I +   L+E + +  + QI +GV+++H + I+H DLKPENI+  S+    +KIIDFG A ++  +   K   GT+ F+APEV+ YE   + TD+WSVGVI + LL+G++PF     GD      + E + NI    ++F  E F  +SE+AK FI++LL++   + RLSA   L+H+WL      +L++ L++ +  +R
Sbjct:   33 LGGGRFGRVMRCQEKSSGLTLAAKVIRVKSPKEKEEVKNEINIMNQLN---HV-NLVQLFDAYESR-SDITLIMEYVEGGELFNRIIDQSGLSELDTVLFVRQICEGVHYMHQQYILHLDLKPENILCLSRWGYQIKIIDFGLARRYKPREKLKVSFGTSEFLAPEVVNYEFVSFPTDMWSVGVITYMLLSGLSPF----LGD-----DESETLNNIVTSNWEFDGEVFSEVSEDAKDFITNLLVKGKKRWRLSAKGALQHQWL---LKSNLHSRLTKQLQGKR 299          
BLAST of Myosin, light chain kinase a vs. Ensembl Sea Lamprey
Match: stk17b (serine/threonine kinase 17b (apoptosis-inducing) [Source:ZFIN;Acc:ZDB-GENE-040426-1499])

HSP 1 Score: 165.622 bits (418), Expect = 1.130e-45
Identity = 96/270 (35.56%), Postives = 153/270 (56.67%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHIETKKHFASKTIIYR--SEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQ-IANTE-LLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNN-DLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSS 1708
            + +GKF  V R   + T   FA+K +  R   +  R ++ +E+ IL+      HI++L +A +     P    ++ EY  GGE+F+Q +A  E   TE +V  +M QIL+GV F+H   ++H DLKP+NI+  S +    +KI+DFG + + +     + ++GT  +VAPEVL YEP    TD+WSVGV+A+ +L G +PF     G+  +     E   N+ +    +  E F G+S +A +FI  LL++ P +R +A  CL+H WLS+
Sbjct:    1 LPRGKFAVVRRCVEVATGIEFAAKFLRKRRKGQDCRADVTHEMAILEAARSCPHIIDLHDAFE----TPTEIILVLEYAVGGEIFNQCVAEGEDAFTEVDVRRLMRQILEGVAFLHRNDVVHLDLKPQNILLTSASPLGDIKIVDFGLSRRVNSAEELREIMGTPEYVAPEVLNYEPISKATDMWSVGVLAYVMLTGESPF----LGEDKQ-----ETFLNVSQLNVSYEPEVFEGVSVQAVAFIQQLLVKAPHRRATAEHCLRHPWLSA 257          
BLAST of Myosin, light chain kinase a vs. Ensembl Yeast
Match: CMK1 (Calmodulin-dependent protein kinase; may play a role in stress response, many Ca++/calmodulin dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK1 has a paralog, CMK2, that arose from the whole genome duplication [Source:SGD;Acc:S000001910])

HSP 1 Score: 144.436 bits (363), Expect = 9.456e-38
Identity = 96/272 (35.29%), Postives = 148/272 (54.41%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTR----DNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNND-LLKIIDFGFA--VKFDEK--HPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWL 1702
            +G G FG V +  + ET +  A K +I ++ K      + + +E++IL  LH       ++   D   SK K F+II++   GGELFD+I      TE++ + I+ +IL  V ++HS++I+HRDLKPEN++Y  K+++  L + DFG A  +K DE+  + P   +G   +VAPEVL  +  G   DIWS+GVI + LL G + F      D   E +  E      R  +D        +S +AK FI   L  +PSKR +A+E L+  W+
Sbjct:   43 LGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLEALYDELDILQRLHHPN----IVAFKDWFESKDK-FYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLG---YVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSAFRAERVQDFLDECTTGEYPVKFHRPYWD-------SVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299          
BLAST of Myosin, light chain kinase a vs. Ensembl Yeast
Match: CMK2 (Calmodulin-dependent protein kinase; may play a role in stress response, many CA++/calmodulan dependent phosphorylation substrates demonstrated in vitro, amino acid sequence similar to mammalian Cam Kinase II; CMK2 has a paralog, CMK1, that arose from the whole genome duplication [Source:SGD;Acc:S000005376])

HSP 1 Score: 126.716 bits (317), Expect = 1.322e-31
Identity = 92/274 (33.58%), Postives = 141/274 (51.46%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEI-EILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKN-NDLLKIIDFGFAVKFD-EKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIEN-IERC---RY--DFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSS 1708
            +G G FG V +   + T +  A K ++ ++ +  +  +  + E L  L    H   ++   D   SK K F+I+++   GGELFD+I +    TE + + I+ QIL  V ++HS++++HRDLKPEN++Y  K+ N  L I DFG A +   E+       G+  +VAPEVL  +  G   DIWS+GVI + LL G +PF               E +E  +E C   RY   F    +  IS + K FI   L   P+ R +A+E L   W++S
Sbjct:   53 LGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQMLYEELSILQKLSH-PNIVSFKDWFESKDK-FYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILGAVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVAPEVLTQDGHGKPCDIWSIGVITYTLLCGYSPF-------------IAESVEGFMEECTASRYPVTFHMPYWDNISIDVKRFILKALRLNPADRPTATELLDDPWITS 311          
BLAST of Myosin, light chain kinase a vs. Ensembl Yeast
Match: RAD53 (DNA damage response protein kinase; required for cell-cycle arrest, regulation of copper genes in response to DNA damage; phosphorylates nuclear pores to counteract gene gating, preventing aberrant transitions at forks approaching transcribed genes; activates downstream kinase Dun1p; differentially senses mtDNA depletion, mitochondrial ROS; relocalizes to cytosol under hypoxia; human homolog CHEK2 implicated in breast cancer can complement yeast null mutant [Source:SGD;Acc:S000006074])

HSP 1 Score: 126.716 bits (317), Expect = 1.335e-30
Identity = 92/281 (32.74%), Postives = 138/281 (49.11%), Query Frame = 2
Query:  902 DEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSE-KTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLR----------YEPQGYFT---DIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWL 1702
            DEV +G+G F  V +     T K FA K I  R      D +  E+E+L  L+  R     I  +       ++++++ E++ GG+L D +A    + E     I  QIL  + +IHS  I HRDLKP+NI+    +  L+KI DFG A         K+  GT  +VAPEV+R          YE +  ++   D+WS+G + + +L G  PF    +G T  +L      + I R  Y         ISEEA+ FI SLL  +P+ R +A++ L H W+
Sbjct:  201 DEV-VGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMDGVTRELEVLQKLNHPR-----IVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILTAIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVIRGKDTSVSPDEYEERNEYSSLVDMWSMGCLVYVILTGHLPF----SGSTQDQL-----YKQIGRGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWI 466          
BLAST of Myosin, light chain kinase a vs. Ensembl Yeast
Match: STE20 (Cdc42p-activated signal transducing kinase; involved in pheromone response, pseudohyphal/invasive growth, vacuole inheritance, down-regulation of sterol uptake; GBB motif binds Ste4p; member of the PAK (p21-activated kinase) family [Source:SGD;Acc:S000000999])

HSP 1 Score: 120.939 bits (302), Expect = 1.074e-28
Identity = 88/305 (28.85%), Postives = 152/305 (49.84%), Query Frame = 2
Query:  887 SQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRH--IMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPK-SMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPF--EIPLTG------DTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMK 1768
            S  Y + V+IG+G  G V     I T    A K +    +  ++ IINEI ++    G +H  I+  I++    G       +I EY++GG L D + +  +LTE  +  +  + L G+ F+HS+ ++HRD+K +NI+   + +  +K+ DFGF  + +E +  + +MVGT  ++APEV+  +  G   DIWS+G++   ++ G  P+  E PL        + T +L +PE                   +S   K F+   L  EP  R SA+E L  ++++       N++L+  + L R+K
Sbjct:  617 STKYANLVKIGQGASGGVYTAYEIGTNVSVAIKQMNLEKQPKKELIINEILVM---KGSKHPNIVNFIDSYVLKGD----LWVIMEYMEGGSLTDVVTHC-ILTEGQIGAVCRETLSGLEFLHSKGVLHRDIKSDNILLSMEGD--IKLTDFGFCAQINELNLKRTTMVGTPYWMAPEVVSRKEYGPKVDIWSLGIMIIEMIEGEPPYLNETPLRALYLIATNGTPKLKEPE------------------NLSSSLKKFLDWCLCVEPEDRASATELLHDEYITEIA--EANSSLAPLVKLARLK 891          
BLAST of Myosin, light chain kinase a vs. Ensembl Yeast
Match: HSL1 (Nim1p-related protein kinase; septin-binding kinase that localizes to the bud neck septin ring and regulates the morphogenesis checkpoint; phosphorylates Hsl7p and cooperates with Elm1p to recruit Hsl7p to the mother-bud neck, as a prerequisite for the subsequent recruitment, phosphorylation, and degradation of Swe1p; autophosphorylation enhances interactions with Hsl7p [Source:SGD;Acc:S000001584])

HSP 1 Score: 117.087 bits (292), Expect = 1.965e-27
Identity = 67/192 (34.90%), Postives = 105/192 (54.69%), Query Frame = 2
Query: 1121 FHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEP-QGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKH 1693
             +++ EY+DGGELFD + +   L E+  I    QI++GV++ HS +I HRDLKPEN++   K N  +KI DFG A         K+  G+  + +PE++   P  G  +D+WS G++ F LL G  PF      D  ++L     +  ++  +Y         +S EA+  IS +L+ +P KR++  E LKH
Sbjct:  189 LYLVLEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLL-LDKKNRRIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF----NDDNIKKL-----LLKVQSGKYQMPS----NLSSEARDLISKILVIDPEKRITTQEILKH 366          
BLAST of Myosin, light chain kinase a vs. Ensembl Nematostella
Match: OBSCURIN (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RGL2])

HSP 1 Score: 215.698 bits (548), Expect = 1.618e-64
Identity = 113/313 (36.10%), Postives = 189/313 (60.38%), Query Frame = 2
Query:  881 SISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKS 1819
            +I+++YT +  +GKG+FG V +  + +T K FA+K I     + R+++I+E+EI++ +   R ++ L +A +    +     ++ E + GGELF+++   E ++E +V   M QIL+G+  +H + ++H DLKPENI+   +++  +K+IDFG A K++ K   K M GT  FVAPEVL Y+     TD+WS+GVIA+ LL+G++PF     GD     +D E + N++   +DF D  F  IS+EAK FI  LL+ + + R+S ++C++H WL++           + I   R+K + A  KW+K   AI+S
Sbjct:   16 AITKYYTIKDELGKGRFGVVCKCVNKKTGKQFAAKFIKCSKPQDREDVIHEMEIMNTIRHKR-LLRLADAFETPSQQ--EMILVMELVTGGELFEKVVEEEFISENDVTHYMKQILEGLEHMHKQEVLHLDLKPENIMIVKQDSRQIKLIDFGLARKYNPKENLKVMFGTPEFVAPEVLTYDRITPATDMWSIGVIAYVLLSGLSPF----MGD-----NDAETLANVQTAEWDFDDPVFDDISDEAKDFIEKLLVLKATARISVAKCMEHPWLTT------KKETGKRIKTDRLKAFTARRKWKKALTAIRS 310          
BLAST of Myosin, light chain kinase a vs. Ensembl Nematostella
Match: EDO42837 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0H1])

HSP 1 Score: 181.03 bits (458), Expect = 1.943e-52
Identity = 102/251 (40.64%), Postives = 156/251 (62.15%), Query Frame = 2
Query:  908 VRIGKGKFGKVSRVTHIETKKHFASKTIIYR---SEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIR 1651
            + I +GKFG V RVT  +T   +A+K I      S  +RD+++ EI+I+  +H  R ++ L++A D N    +   +I E++ GGELF+++ + + LTEK     M Q+L G+  +H ++++H DLKPENIV  SK++  +K+IDFG A ++ E     ++ GT  F+APE   +EP    TD+WSVGVIA+ LL+G++PF     GD      + E + N+  C +DF DE F  IS++AK FISSLLI+
Sbjct:    2 IVIVRGKFGVVKRVTDKKTGTVYAAKYIKTSGALSGSSRDDVMREIDIMSRMHHKR-LVGLLDAYDAN----RNIVMIMEFISGGELFERVVDEDCLTEKEAAYYMHQLLQGIEHVHKKNVLHLDLKPENIVCVSKDSWDIKLIDFGLAQEYKEGFKMTALKGTPEFMAPEAANFEPISKATDMWSVGVIAYILLSGLSPF----MGD-----DNNETLSNVNMCEWDFDDESFDVISDQAKDFISSLLIK 238          
BLAST of Myosin, light chain kinase a vs. Ensembl Nematostella
Match: EDO35611 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7SL08])

HSP 1 Score: 167.162 bits (422), Expect = 6.989e-46
Identity = 103/305 (33.77%), Postives = 167/305 (54.75%), Query Frame = 2
Query:  878 ISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRH--IMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNND-LLKIIDFGFAVKFDEKHPP----KSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKN 1771
            I +++ Y  +  IG+G F +V RV H +TK+ +A K +    E+ +D   +E+ +L  +   +H  ++ L E  +C        +++ E   GG L D+I +    TE++   ++  +L+GV ++HS  I HRDLKPEN++Y    ND  + I DFG +     KHP     ++  GT  ++APEVL  +P     DIWS+GVI FN+L+G  PF      D  R      + + I R ++ FS E +  +++ AK FI+ L++ EP  RL+A + +KH W++S    S   NL +SIS   +K+
Sbjct:   64 IRVTKEYEIKALIGRGSFSRVVRVEHYQTKQPYAIKMM--EIEQGKDEFQSELAVLRRV---KHEFVVRLYEVFECRNR----VYLVMELATGGVLLDRILSKGFFTERDATRVIYMVLEGVRYLHSLGITHRDLKPENLLYYHPGNDSKIMITDFGLSNL--RKHPDDRTMETTCGTPGYMAPEVLLSKPYTNSVDIWSIGVITFNVLSGQMPF-----ADDHRS----RLYKKILRGKFSFSGEPWDDVTDMAKDFINKLIVYEPEMRLTAEQGIKHPWIASSAATSSLKNLHKSISQNLLKS 348          
BLAST of Myosin, light chain kinase a vs. Ensembl Nematostella
Match: EDO49090 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7RI47])

HSP 1 Score: 160.614 bits (405), Expect = 7.546e-45
Identity = 89/258 (34.50%), Postives = 149/258 (57.75%), Query Frame = 2
Query:  881 SISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIRE 1654
            S  +FY     IGKG +G V +     T + +A+K +   +   R   + EIE++  L   + ++ LI+A       P    +I E++ GGELF++I   + L E++ I  + Q+L  ++++H  +I+H DLKPENI+  S N++ +K++DFG A +  +    KS  GT  FVAPEV+R +P    +D+WS+GV+ + LL+G+ PF    +GD     +D + +  + +  +DF DE F  +SE+AK FI  LL+++
Sbjct:    7 SADEFYDMNEEIGKGAYGIVKKCVDKATGQTYAAKVVTTSNSNLRKETMREIEVMRKLGSHKKLVGLIDAY----HTPFEIVMILEFIPGGELFERIIEEDYLMEEDAIYYVHQVLLALDYMHGNNIVHLDLKPENIMCESINSNQIKLVDFGLARELKKDEEVKSSFGTPDFVAPEVIRMKPVSTASDMWSLGVVTYVLLSGLMPF----SGD-----NDHDTLVKVAKAEWDFDDECFDEVSEDAKDFIEGLLVKD 251          
BLAST of Myosin, light chain kinase a vs. Ensembl Nematostella
Match: EDO42287 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S1Z6])

HSP 1 Score: 153.68 bits (387), Expect = 2.969e-42
Identity = 95/256 (37.11%), Postives = 142/256 (55.47%), Query Frame = 2
Query:  914 IGKGKFGKVSRVTHIETKKHFASKTIIYRSEK------TRDNIINEIEILDCL-HGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDL-LKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREP 1657
            IG G+F  V + +   +   FA+K +  R  K      T + II E  +L  + H G     +I   D   +K + F +I E L GGELF+ ++  + LTE   +G + Q++  + ++H  SI+H D+KPENIV  ++   L LK+IDFG A K  +  P + M+GT  FVAPE++ +E  G+ TD+WS+GV+ + +L+G +PF     GD        E   NI    Y+F DE F  IS+ AK FI  LLI++P
Sbjct:   23 IGSGQFAVVKKCSEKSSGLEFAAKFMKKRRSKALRRGVTLEQIIREATVLRSVAHQG-----IIYLHDIYETKME-FVLILELLSGGELFEFLSEQDFLTEDEAVGFLIQVIRAIEYLHDLSIVHLDIKPENIVLKNRTRPLHLKLIDFGLARKISKGEPVREMMGTPEFVAPEIIDFEVVGFPTDMWSIGVLTYIMLSGASPF----LGDDNN-----ETFSNISHVDYEFDDEYFKEISQPAKDFIEGLLIKKP 263          
BLAST of Myosin, light chain kinase a vs. Ensembl Medaka
Match: mylka (myosin light chain kinase [Source:NCBI gene;Acc:101167024])

HSP 1 Score: 232.646 bits (592), Expect = 2.750e-65
Identity = 126/322 (39.13%), Postives = 191/322 (59.32%), Query Frame = 2
Query:  878 ISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            + + + Y  E R+G GKFG+V ++    TKK +A K I   S K ++N+  EI I++ LH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+ VI  M QI+DGVNFIH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YE   Y TD+WS+GVI + LL+G++PF     GD     SD E + N+    +DF DE F  ISE AK FI++LL ++   RL+ ++C +H WL     +  NT  ++ +S +RMK Y+   KWQK   A++++    ++
Sbjct:  445 MKVKELYDVEERLGTGKFGQVFKLVEKATKKVWAGKFIKAYSAKEKENVRQEISIMNSLHHPK----LVQCVDAFEGKSDMVMVL-EMISGGELFERIIDEDFELTEREVIKYMLQIIDGVNFIHKQGIVHLDLKPENIMCINKTGSKIKLIDFGLARRLENAGTLKVLFGTPEFVAPEVINYEAISYPTDMWSIGVICYILLSGLSPF----MGD-----SDNETLSNVTSASWDFEDEAFDEISENAKDFITNLLKKDMRARLTCAQCFEHPWL----KQDTNTMKAKKLSKERMKKYILRRKWQKTGHAVRAIGRLSSM 748          
BLAST of Myosin, light chain kinase a vs. Ensembl Medaka
Match: mylka (myosin light chain kinase [Source:NCBI gene;Acc:101167024])

HSP 1 Score: 232.261 bits (591), Expect = 3.167e-65
Identity = 126/322 (39.13%), Postives = 191/322 (59.32%), Query Frame = 2
Query:  878 ISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            + + + Y  E R+G GKFG+V ++    TKK +A K I   S K ++N+  EI I++ LH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+ VI  M QI+DGVNFIH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YE   Y TD+WS+GVI + LL+G++PF     GD     SD E + N+    +DF DE F  ISE AK FI++LL ++   RL+ ++C +H WL     +  NT  ++ +S +RMK Y+   KWQK   A++++    ++
Sbjct:  439 MKVKELYDVEERLGTGKFGQVFKLVEKATKKVWAGKFIKAYSAKEKENVRQEISIMNSLHHPK----LVQCVDAFEGKSDMVMVL-EMISGGELFERIIDEDFELTEREVIKYMLQIIDGVNFIHKQGIVHLDLKPENIMCINKTGSKIKLIDFGLARRLENAGTLKVLFGTPEFVAPEVINYEAISYPTDMWSIGVICYILLSGLSPF----MGD-----SDNETLSNVTSASWDFEDEAFDEISENAKDFITNLLKKDMRARLTCAQCFEHPWL----KQDTNTMKAKKLSKERMKKYILRRKWQKTGHAVRAIGRLSSM 742          
BLAST of Myosin, light chain kinase a vs. Ensembl Medaka
Match: mylka (myosin light chain kinase [Source:NCBI gene;Acc:101167024])

HSP 1 Score: 232.261 bits (591), Expect = 4.700e-65
Identity = 126/322 (39.13%), Postives = 191/322 (59.32%), Query Frame = 2
Query:  878 ISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL 1840
            + + + Y  E R+G GKFG+V ++    TKK +A K I   S K ++N+  EI I++ LH  +    L++ +D    K     ++ E + GGELF++I + +  LTE+ VI  M QI+DGVNFIH + I+H DLKPENI+  +K    +K+IDFG A + +     K + GT  FVAPEV+ YE   Y TD+WS+GVI + LL+G++PF     GD     SD E + N+    +DF DE F  ISE AK FI++LL ++   RL+ ++C +H WL     +  NT  ++ +S +RMK Y+   KWQK   A++++    ++
Sbjct:  445 MKVKELYDVEERLGTGKFGQVFKLVEKATKKVWAGKFIKAYSAKEKENVRQEISIMNSLHHPK----LVQCVDAFEGKSDMVMVL-EMISGGELFERIIDEDFELTEREVIKYMLQIIDGVNFIHKQGIVHLDLKPENIMCINKTGSKIKLIDFGLARRLENAGTLKVLFGTPEFVAPEVINYEAISYPTDMWSIGVICYILLSGLSPF----MGD-----SDNETLSNVTSASWDFEDEAFDEISENAKDFITNLLKKDMRARLTCAQCFEHPWL----KQDTNTMKAKKLSKERMKKYILRRKWQKTGHAVRAIGRLSSM 748          
BLAST of Myosin, light chain kinase a vs. Ensembl Medaka
Match: ENSORLT00000032394.1 (myosin light chain kinase, smooth muscle [Source:NCBI gene;Acc:101169741])

HSP 1 Score: 208.379 bits (529), Expect = 1.013e-56
Identity = 124/315 (39.37%), Postives = 185/315 (58.73%), Query Frame = 2
Query:  911 RIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNII--NEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELL-TEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQK---LCMAIKSVSNFKN 1837
            ++G GKFG V RVTH ET +  A K   YR+   +D +    EI I++ LH  + +++ + A +          ++ EY++GGELF++I +     TE      M QIL+G+ ++H + IIH DLKPENIV    N   +KIIDFG A + DE  P   + GT  FVAPEV+ YEP G  TD+WS+GVI + LL+G +PF+    G+     SD E +  +    Y+F  E F  IS+EAK FISSLL ++   RLS +E L H W++S     LN   ++S++ +++K ++A  KW+K     +A+K +++F N
Sbjct:  459 KLGVGKFGDVFRVTHKETGQVCAGK--FYRARTFKDKVAARKEIRIMNKLHHPK-LVQCLAAYEARS----GIVMVMEYIEGGELFERIVDDNFEHTELTSARYMRQILEGMQYMHKQKIIHLDLKPENIVCVDTNGTQIKIIDFGLAAELDEGKPLMVLHGTPEFVAPEVISYEPVGVETDMWSIGVICYILLSGESPFQ----GN-----SDAETLALVTAAHYEFDPESFEDISDEAKDFISSLLKKDRRARLSCTEALSHIWMASF--TPLNRRATKSLNKEKIKRFLAKQKWKKTGQAVLALKRMAHFSN 755          
BLAST of Myosin, light chain kinase a vs. Ensembl Medaka
Match: mylk5 (myosin light chain kinase, smooth muscle [Source:NCBI gene;Acc:101171917])

HSP 1 Score: 202.986 bits (515), Expect = 6.573e-55
Identity = 123/311 (39.55%), Postives = 185/311 (59.49%), Query Frame = 2
Query:  884 ISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTEL-LTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAI 1813
            ++  Y  + ++G GKFG V ++TH ET    A K    R    R+    EIE+++ LH  +    L++ +     KP+   ++ E++ GGELF++I +     TE   +  M QIL+GV +IH + I+H DLKPENIV    N   +KIIDFG A K D+K P K M GT  FVAPEV+ YEP    TD+WSVGVI + LL+G +PF+    G+     SD E +  +   +++F +E F  I+EEAK FISSLL++ P +R+S  E L H W+++  +  L +  ++S+S ++MK ++A  KW+K   A+
Sbjct:  428 VTDHYILQEKLGMGKFGLVFKLTHKETGHVCAGKFYKGRRAAEREAARREIELMNHLHHPK----LVQCLAAYDHKPEMVMVM-EFIPGGELFERIVDDNFEHTELASVRYMQQILEGVAYIHQQKIVHLDLKPENIVCVDTNGHSIKIIDFGLASKIDDKTPLKVMHGTPEFVAPEVINYEPVHLATDMWSVGVICYILLSGESPFQ----GE-----SDAETLALVTSAQWEFDEESFSDITEEAKHFISSLLVKVPRRRMSCEEALAHPWIAAFDSGDLTS--TKSLSKEKMKRFLARQKWKKAGKAM 722          
BLAST of Myosin, light chain kinase a vs. Planmine SMEST
Match: SMESG000081274.1 (SMESG000081274.1)

HSP 1 Score: 1094.72 bits (2830), Expect = 0.000e+0
Identity = 549/553 (99.28%), Postives = 550/553 (99.46%), Query Frame = 2
Query:  191 MELIHTNKIPAMNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISSCEEEIKPEVRILNFSKFQXXXXXXXXXXXXXXGPSRSNSDDGNNSLDQINSLLPSFKSVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
            MELIHTNKIPAMNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKIS CEEEIKPEVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQI+SLLPSFKSVNFEK THFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFG VSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS
Sbjct:    1 MELIHTNKIPAMNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISFCEEEIKPEVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQIDSLLPSFKSVNFEKFTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGNVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 553          
BLAST of Myosin, light chain kinase a vs. Planmine SMEST
Match: SMESG000081274.1 (SMESG000081274.1)

HSP 1 Score: 1072.77 bits (2773), Expect = 0.000e+0
Identity = 535/540 (99.07%), Postives = 537/540 (99.44%), Query Frame = 2
Query:  179 VNDFMELIHTNKIPAMNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISSCEEEIKPEVRILNFSKFQXXXXXXXXXXXXXXGPSRSNSDDGNNSLDQINSLLPSFKSVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQK 1798
            +NDFMELIHTNKIPAMNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKIS CEEEIKPEVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQI+SLLPSFKSVNFEK THFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFG VSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQK
Sbjct:  516 INDFMELIHTNKIPAMNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISFCEEEIKPEVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQIDSLLPSFKSVNFEKFTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGNVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQK 1055          
BLAST of Myosin, light chain kinase a vs. Planmine SMEST
Match: SMESG000081274.1 (SMESG000081274.1)

HSP 1 Score: 1072 bits (2771), Expect = 0.000e+0
Identity = 535/540 (99.07%), Postives = 537/540 (99.44%), Query Frame = 2
Query:  179 VNDFMELIHTNKIPAMNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISSCEEEIKPEVRILNFSKFQXXXXXXXXXXXXXXGPSRSNSDDGNNSLDQINSLLPSFKSVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQK 1798
            +NDFMELIHTNKIPAMNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKIS CEEEIKPEVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQI+SLLPSFKSVNFEK THFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFG VSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQK
Sbjct:  512 INDFMELIHTNKIPAMNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISFCEEEIKPEVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQIDSLLPSFKSVNFEKFTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGNVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQK 1051          
BLAST of Myosin, light chain kinase a vs. Planmine SMEST
Match: SMESG000081274.1 (SMESG000081274.1)

HSP 1 Score: 1071.61 bits (2770), Expect = 0.000e+0
Identity = 538/542 (99.26%), Postives = 539/542 (99.45%), Query Frame = 2
Query:  224 MNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISSCEEEIKPEVRILNFSKFQXXXXXXXXXXXXXXGPSRSNSDDGNNSLDQINSLLPSFKSVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
            MNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKIS CEEEIKPEVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQI+SLLPSFKSVNFEK THFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFG VSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS
Sbjct:    1 MNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISFCEEEIKPEVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQIDSLLPSFKSVNFEKFTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGNVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 542          
BLAST of Myosin, light chain kinase a vs. Planmine SMEST
Match: SMESG000081274.1 (SMESG000081274.1)

HSP 1 Score: 1042.72 bits (2695), Expect = 0.000e+0
Identity = 525/529 (99.24%), Postives = 526/529 (99.43%), Query Frame = 2
Query:  263 MPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISSCEEEIKPEVRILNFSKFQXXXXXXXXXXXXXXGPSRSNSDDGNNSLDQINSLLPSFKSVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 1849
            MPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKIS CEEEIKPEVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQI+SLLPSFKSVNFEK THFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFG VSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS
Sbjct:    1 MPRTHNLRYLKDKNEIRVNDYDETSLCNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYISELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISFCEEEIKPEVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQIDSLLPSFKSVNFEKFTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGNVSRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEAIDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVNFIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGTTIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELSDPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLKHKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNLITS 529          
The following BLAST results are available for this feature:
BLAST of Myosin, light chain kinase a vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYLK9.623e-6339.38myosin light chain kinase [Source:HGNC Symbol;Acc:... [more]
MYLK9.623e-6339.38myosin light chain kinase [Source:HGNC Symbol;Acc:... [more]
MYLK1.150e-6239.38myosin light chain kinase [Source:HGNC Symbol;Acc:... [more]
MYLK1.150e-6239.38myosin light chain kinase [Source:HGNC Symbol;Acc:... [more]
MYLK34.603e-6039.68myosin light chain kinase 3 [Source:HGNC Symbol;Ac... [more]
back to top
BLAST of Myosin, light chain kinase a vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 5
Match NameE-valueIdentityDescription
ttn-12.751e-5034.97Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-12.853e-5034.97Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-12.853e-5034.97Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-17.869e-5034.97Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
ttn-17.869e-5034.97Titin homolog [Source:UniProtKB/Swiss-Prot;Acc:G4... [more]
back to top
BLAST of Myosin, light chain kinase a vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Strn-Mlck2.621e-6137.90gene:FBgn0265045 transcript:FBtr0336643[more]
Strn-Mlck1.969e-6037.90gene:FBgn0265045 transcript:FBtr0336646[more]
Strn-Mlck2.134e-6037.90gene:FBgn0265045 transcript:FBtr0336644[more]
Strn-Mlck1.044e-5937.90gene:FBgn0265045 transcript:FBtr0336649[more]
Strn-Mlck1.124e-5937.90gene:FBgn0265045 transcript:FBtr0336651[more]
back to top
BLAST of Myosin, light chain kinase a vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mylka2.528e-6640.61myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-... [more]
mylkb5.588e-6338.82myosin light chain kinase b [Source:ZFIN;Acc:ZDB-G... [more]
mylk21.879e-5534.51myosin light chain kinase 2 [Source:ZFIN;Acc:ZDB-G... [more]
mylk51.018e-5438.61myosin, light chain kinase 5 [Source:ZFIN;Acc:ZDB-... [more]
mylk32.418e-5437.97myosin light chain kinase 3 [Source:NCBI gene;Acc:... [more]
back to top
BLAST of Myosin, light chain kinase a vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MYLK46.065e-5740.07myosin light chain kinase family member 4 [Source:... [more]
nek23.498e-5440.13NIMA-related kinase 2 [Source:NCBI gene;Acc:407849... [more]
nek28.569e-5440.13NIMA-related kinase 2 [Source:NCBI gene;Acc:407849... [more]
nek29.440e-5440.13NIMA-related kinase 2 [Source:NCBI gene;Acc:407849... [more]
ENSXETT00000029423.13.683e-5337.04serine/threonine-protein kinase 17A-like [Source:N... [more]
back to top
BLAST of Myosin, light chain kinase a vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mylk3.115e-6239.38myosin, light polypeptide kinase [Source:MGI Symbo... [more]
Mylk38.022e-6240.62myosin light chain kinase 3 [Source:MGI Symbol;Acc... [more]
Mylk35.528e-6139.64myosin light chain kinase 3 [Source:MGI Symbol;Acc... [more]
Mylk35.414e-6040.81myosin light chain kinase 3 [Source:MGI Symbol;Acc... [more]
Mylk41.905e-5643.02myosin light chain kinase family, member 4 [Source... [more]
back to top
BLAST of Myosin, light chain kinase a vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q28824|MYLK_BOVIN3.554e-6239.38Myosin light chain kinase, smooth muscle OS=Bos ta... [more]
sp|Q15746|MYLK_HUMAN4.621e-6239.38Myosin light chain kinase, smooth muscle OS=Homo s... [more]
sp|P29294|MYLK_RABIT1.590e-6139.06Myosin light chain kinase, smooth muscle OS=Orycto... [more]
sp|Q6PDN3|MYLK_MOUSE2.693e-6139.38Myosin light chain kinase, smooth muscle OS=Mus mu... [more]
sp|P11799|MYLK_CHICK8.451e-6139.06Myosin light chain kinase, smooth muscle OS=Gallus... [more]
back to top
BLAST of Myosin, light chain kinase a vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A5C6PK074.290e-6838.28Myosin light chain kinase, smooth muscle OS=Takifu... [more]
K1QCF71.922e-6536.29Myosin light chain kinase, smooth muscle OS=Crasso... [more]
A0A1B6HUF13.393e-6538.41Protein kinase domain-containing protein (Fragment... [more]
A0A3B1JU635.675e-6540.06Myosin light chain kinase b OS=Astyanax mexicanus ... [more]
A0A0L8FZ453.397e-6438.39Protein kinase domain-containing protein (Fragment... [more]
back to top
BLAST of Myosin, light chain kinase a vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mylkb2.149e-6840.06myosin light chain kinase, smooth muscle-like [Sou... [more]
mylkb8.755e-6640.06myosin light chain kinase, smooth muscle-like [Sou... [more]
mylka4.477e-6338.79myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-... [more]
mylka1.834e-6238.79myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-... [more]
mylk53.298e-5838.59myosin light chain kinase, smooth muscle-like [Sou... [more]
back to top
BLAST of Myosin, light chain kinase a vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mylka7.966e-6035.43myosin, light chain kinase a [Source:ZFIN;Acc:ZDB-... [more]
ENSPMAT00000000175.12.845e-5834.93pep scaffold:Pmarinus_7.0:GL476590:10927:25170:1 g... [more]
ENSPMAT00000003997.12.132e-5539.74pep scaffold:Pmarinus_7.0:GL489063:434:4002:1 gene... [more]
mylk31.853e-4936.27myosin light chain kinase 3 [Source:NCBI gene;Acc:... [more]
stk17b1.130e-4535.56serine/threonine kinase 17b (apoptosis-inducing) [... [more]
back to top
BLAST of Myosin, light chain kinase a vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 5
Match NameE-valueIdentityDescription
CMK19.456e-3835.29Calmodulin-dependent protein kinase; may play a ro... [more]
CMK21.322e-3133.58Calmodulin-dependent protein kinase; may play a ro... [more]
RAD531.335e-3032.74DNA damage response protein kinase; required for c... [more]
STE201.074e-2828.85Cdc42p-activated signal transducing kinase; involv... [more]
HSL11.965e-2734.90Nim1p-related protein kinase; septin-binding kinas... [more]
back to top
BLAST of Myosin, light chain kinase a vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
OBSCURIN1.618e-6436.10Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO428371.943e-5240.64Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO356116.989e-4633.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO490907.546e-4534.50Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO422872.969e-4237.11Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Myosin, light chain kinase a vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mylka2.750e-6539.13myosin light chain kinase [Source:NCBI gene;Acc:10... [more]
mylka3.167e-6539.13myosin light chain kinase [Source:NCBI gene;Acc:10... [more]
mylka4.700e-6539.13myosin light chain kinase [Source:NCBI gene;Acc:10... [more]
ENSORLT00000032394.11.013e-5639.37myosin light chain kinase, smooth muscle [Source:N... [more]
mylk56.573e-5539.55myosin light chain kinase, smooth muscle [Source:N... [more]
back to top
BLAST of Myosin, light chain kinase a vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 5
Match NameE-valueIdentityDescription
SMESG000081274.10.000e+099.28SMESG000081274.1[more]
SMESG000081274.10.000e+099.07SMESG000081274.1[more]
SMESG000081274.10.000e+099.07SMESG000081274.1[more]
SMESG000081274.10.000e+099.26SMESG000081274.1[more]
SMESG000081274.10.000e+099.24SMESG000081274.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023471 ID=SMED30023471|Name=Myosin, light chain kinase a|organism=Schmidtea mediterranea sexual|type=transcript|length=2071bp
AATGCAATTACTGGTTATTTTAAATTTACAGACTTAAGAAGCGTATCAGA
TATAAGTTTGTTTTTTTAATATTCTTTTAAATACTATTCAATTTCTAAAT
TGTTATCAAATTATGCTTTGCAGTTAATGTATTGTGTGTAGAAATGCATG
ATCATATAATTTATTTAAAACAATCACAGTAAATGATTTTATGGAGTTAA
TTCACACCAACAAAATCCCAGCAATGAACGAATACGGCAATCCAACAGTG
GGCTATTTGAGAATGCCTCGAACTCACAACTTGCGTTATTTGAAAGACAA
AAATGAAATACGCGTCAATGACTATGACGAGACTTCATTGTGTAACAGTT
GTAGAAAGCCCCTAAATTCCACCGAGTTTCTCAACCAAAGTAGTGGACTG
TCACATCATTTATGCGAATCATGCACTACAGATATTTTGGTGGATGAAAT
TGTAAATAAAGTCTTAAGGAATGTGTTTTGCTATATCTCAGAATTATTTG
CAGAAAAATTTCTTAATAATCAGTCTGAAAATATTAAAAATGAGTTTAGT
AACACTTTATGTAATGGCAGTGCAAACCTGGAAAAATCTAATATTCAGAG
GTTTCCTAAAATCAGTTCCTGTGAGGAAGAAATAAAACCGGAAGTTAGAA
TTTTAAATTTTAGTAAATTTCAATCAGAAAGCTCTGAACGAAGCAAAGAA
GAATGTGAAAATAGTGGGCCATCTAGAAGTAATTCAGATGATGGAAATAA
TTCTCTGGATCAAATAAACTCACTTTTGCCTAGTTTTAAGTCTGTTAACT
TTGAAAAATCTACACATTTCCAACAAGAATCTAACAATTTAGCTCATCAC
ACTAAAAGCATTAAAACTCATCCCGGAATTTCAATTTCCCAATTTTATAC
GGACGAAGTGCGAATTGGAAAAGGAAAATTTGGAAAAGTCTCACGAGTTA
CTCACATTGAAACAAAAAAACATTTTGCTTCGAAAACCATTATTTACCGC
AGTGAAAAAACTAGAGACAACATCATAAATGAAATTGAAATACTTGATTG
TCTTCATGGTGGTCGGCATATTATGGAACTAATTGAGGCCATAGATTGTA
ACGGTTCCAAACCTAAAGCTTTTCATATTATTTCCGAATATCTTGACGGA
GGGGAATTATTTGATCAAATTGCAAATACGGAATTGTTGACAGAGAAAAA
TGTGATCGGCATTATGTGCCAAATATTAGATGGGGTGAATTTCATCCACT
CCAGGAGCATTATTCACAGAGATTTGAAGCCGGAAAATATTGTCTATTGT
TCTAAAAATAATGATCTTTTAAAAATTATCGATTTTGGATTTGCTGTAAA
ATTTGATGAAAAACACCCACCAAAATCGATGGTCGGAACAACGATTTTTG
TTGCTCCTGAAGTTCTTCGATATGAACCACAAGGTTATTTTACTGACATA
TGGAGTGTTGGGGTTATTGCTTTCAATTTATTAGCCGGAATTACCCCGTT
CGAAATACCGCTCACTGGCGACACCACACGCGAATTGAGTGACCCTGAAA
TTATTGAAAACATTGAAAGATGCAGATATGATTTCAGTGATGAAGGATTT
ATTGGTATATCAGAGGAAGCTAAAAGTTTCATTTCAAGTCTTCTTATCAG
AGAACCAAGTAAAAGGCTGTCAGCATCAGAATGTCTAAAACACAAATGGT
TATCTTCGTGTTACAACAAAAGTTTAAACACAAATTTATCGAGATCCATT
TCTTTGCAAAGAATGAAAAATTACGTCGCAGTTCACAAGTGGCAGAAACT
TTGCATGGCCATCAAATCAGTTTCAAATTTCAAGAACTTGATCACCTCAT
AATTGTAACATAGAAGACAGATATAAATCAGAGCAAATTGTTTGTTGATA
TTATTTTTTAAAACTGTTAATATAAATTTTTATTTTGGTTTTTTATCTTA
AAAGTCTTATTGAAATATTTCAATGACTTTTTTTCAAGCAAAACCTACAA
ATGTATTAGATTGTTTTTATTTACAAAATTATCAATGAATCAAATATAAA
ATGAATTGAATAAAATACCAT
back to top

protein sequence of SMED30023471-orf-1

>SMED30023471-orf-1 ID=SMED30023471-orf-1|Name=SMED30023471-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=554bp
MELIHTNKIPAMNEYGNPTVGYLRMPRTHNLRYLKDKNEIRVNDYDETSL
CNSCRKPLNSTEFLNQSSGLSHHLCESCTTDILVDEIVNKVLRNVFCYIS
ELFAEKFLNNQSENIKNEFSNTLCNGSANLEKSNIQRFPKISSCEEEIKP
EVRILNFSKFQSESSERSKEECENSGPSRSNSDDGNNSLDQINSLLPSFK
SVNFEKSTHFQQESNNLAHHTKSIKTHPGISISQFYTDEVRIGKGKFGKV
SRVTHIETKKHFASKTIIYRSEKTRDNIINEIEILDCLHGGRHIMELIEA
IDCNGSKPKAFHIISEYLDGGELFDQIANTELLTEKNVIGIMCQILDGVN
FIHSRSIIHRDLKPENIVYCSKNNDLLKIIDFGFAVKFDEKHPPKSMVGT
TIFVAPEVLRYEPQGYFTDIWSVGVIAFNLLAGITPFEIPLTGDTTRELS
DPEIIENIERCRYDFSDEGFIGISEEAKSFISSLLIREPSKRLSASECLK
HKWLSSCYNKSLNTNLSRSISLQRMKNYVAVHKWQKLCMAIKSVSNFKNL
ITS*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000016pharynx
PLANA:0000034epidermis
PLANA:0000070intestinal phagocyte
PLANA:0002032epidermal cell
PLANA:0003116parenchymal cell
Vocabulary: INTERPRO
TermDefinition
IPR000719Prot_kinase_dom
IPR008271Ser/Thr_kinase_AS
IPR011009Kinase-like_dom_sf
Vocabulary: molecular function
TermDefinition
GO:0005524ATP binding
GO:0004672protein kinase activity
GO:0000166nucleotide binding
GO:0016301kinase activity
GO:0016740transferase activity
Vocabulary: biological process
TermDefinition
GO:0006468protein phosphorylation
GO:0007596blood coagulation
GO:0016310phosphorylation
GO:2000145regulation of cell motility
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR000719Protein kinase domainSMARTSM00220serkin_6coord: 236..504
e-value: 2.7E-74
score: 262.8
IPR000719Protein kinase domainPFAMPF00069Pkinasecoord: 236..504
e-value: 2.0E-65
score: 220.8
IPR000719Protein kinase domainPROSITEPS50011PROTEIN_KINASE_DOMcoord: 236..504
score: 43.962
NoneNo IPR availableGENE3DG3DSA:1.10.510.10coord: 321..510
e-value: 8.5E-81
score: 274.0
NoneNo IPR availableGENE3DG3DSA:3.30.200.20coord: 236..320
e-value: 8.5E-81
score: 274.0
NoneNo IPR availableGENE3DG3DSA:1.10.238.10coord: 511..541
e-value: 8.5E-81
score: 274.0
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 165..187
NoneNo IPR availablePANTHERPTHR24347:SF393MYOSIN, LIGHT CHAIN KINASE 5coord: 136..548
NoneNo IPR availablePANTHERPTHR24347SERINE/THREONINE-PROTEIN KINASEcoord: 136..548
IPR008271Serine/threonine-protein kinase, active sitePROSITEPS00108PROTEIN_KINASE_STcoord: 357..369
IPR011009Protein kinase-like domain superfamilySUPERFAMILYSSF56112Protein kinase-like (PK-like)coord: 223..524