Protein mab-21-like

Overview
NameProtein mab-21-like
Smed IDSMED30023465
Length (bp)1357
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Protein mab-21-like (SMED30023465) t-SNE clustered cells

Violin plots show distribution of expression levels for Protein mab-21-like (SMED30023465) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Protein mab-21-like (SMED30023465) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Protein mab-21-like (SMED30023465) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023465

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 7

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
nervous systemSMED30023465SMESG000070861.1 dd_Smed_v4_14783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cephalic gangliaSMED30023465SMESG000070861.1 dd_Smed_v4_14783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
muscle cellSMED30023465SMESG000070861.1 dd_Smed_v4_14783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
cilated neuronSMED30023465SMESG000070861.1 dd_Smed_v4_14783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
non-ciliated neuronSMED30023465SMESG000070861.1 dd_Smed_v4_14783_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
head regionSMED30023465SMESG000070861.1 dd_Smed_v6_14783_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
enteric muscle cellSMED30023465SMESG000070861.1 dd_Smed_v4_14783_0_1dd_Smed_v4PMID:30471994
Scimone et al., 2018
FACS sorted cell population asexual adult single-cell RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Protein mab-21-like vs. Ensembl Human
Match: MAB21L1 (mab-21 like 1 [Source:HGNC Symbol;Acc:HGNC:6757])

HSP 1 Score: 473.781 bits (1218), Expect = 2.112e-166
Identity = 229/362 (63.26%), Postives = 283/362 (78.18%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    +  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RL     R+ CLS+LKT  +R L   G  P+ NYHMKTL+ YECEKHP +SDW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----NEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGK--QSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. Ensembl Human
Match: MAB21L2 (mab-21 like 2 [Source:HGNC Symbol;Acc:HGNC:6758])

HSP 1 Score: 471.085 bits (1211), Expect = 2.633e-165
Identity = 230/362 (63.54%), Postives = 282/362 (77.90%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L +  NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    S  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV++IAD++EVKLR+ +RY +Q+TPAF+C+G+WPRSA+ WP+  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL    R  CLSVLKT  +R L   G  P+ NYHMKTLLLYECEKHP ++DW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SL+KL
Sbjct:    5 QAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----SEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGK--QSSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPG-QPLNNYHMKTLLLYECEKHPRETDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALESAAKQTWRLAREILTNPKSLDKL 359          
BLAST of Protein mab-21-like vs. Ensembl Human
Match: MAB21L3 (mab-21 like 3 [Source:HGNC Symbol;Acc:HGNC:26787])

HSP 1 Score: 88.5817 bits (218), Expect = 1.092e-18
Identity = 82/364 (22.53%), Postives = 149/364 (40.93%), Query Frame = 3
Query:  240 RKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFN---------FVDDGSVPGC------GVLKLSDGRKRSMSLWVEF---ITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHD---RYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIG-----RRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSP 1253
            R+   ++ V E+ K+   +   + NQ+ RF  ++ Y    S+   E ++VL+P+ F + + +  +  +          +   G+   C      G+ +  +  +   SLW      +   G +   K+   F+ LV  AV        V L+ + + V + V     +  L++ PA      W + A  WP     WP       +K+ GFNLL+    +              W L F  AE+ LL  +      RR C  V++   E          +T++H++T+L + CEK+P   DW           ++ +L  C+      HYF+ + +LF+   P  LD  A+++   L++    P
Sbjct:   20 RRQQISQAVEEVQKVVHHLTTNISNQDIRF-QAVPY----SDTYNENIKVLAPSQFLVTVPIKGLAGYREAREQHWRYYTLQGTRLPCPLRDPEGLQQWLEVEQFMKSLWQWHETDVNIDGDIVPAKVLLVFRKLVENAVRTCHLSGKVSLLGNRSAVWVAVETSAYQVELELVPAVEIPTTWSKKAR-WPRCLQRWPSQERVECIKSFGFNLLACSNYH--------------WQLSFLRAEQVLLEQLDEDGGCRRKCFQVMRHLKEDIWCPGNRPVITSHHLQTVLFWTCEKYPHFKDW--QVFSKAFLRLVRKLHKCVSQHFLKHYFVRNSNLFQCTNPTELDTVAQKLATFLKNPQIGP 361          
BLAST of Protein mab-21-like vs. Ensembl Human
Match: CGAS (cyclic GMP-AMP synthase [Source:HGNC Symbol;Acc:HGNC:21367])

HSP 1 Score: 65.4698 bits (158), Expect = 8.861e-11
Identity = 62/303 (20.46%), Postives = 133/303 (43.89%), Query Frame = 3
Query:  372 YEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLS-DGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVV--QLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGR----------RCCLS--------VLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQ 1217
            YE +++ +PN+F+++  L ++      +  +      +K   + ++  +S ++E       LSA K+ S+F+ ++ + +      DV+  +    S  V L + ++ ++ +T A      WP S     L   +W    +   ++ + F L+ +       K G+   E + W L F   E+ +L++ G+          +CC          +L+   ER  +       ++YH+KT   + C ++P DS W   +L    +  +   + CL+  +  +YF+   +LF   L   +D+ +K+
Sbjct:  215 YEHVKISAPNEFDVMFKL-EVPRIQLEEYSNTRAYYFVKFKRNPKENPLSQFLE----GEILSASKMLSKFRKIIKEEINDIKDTDVIMKRKRGGSPAVTLLISEKISVDITLALESKSSWPASTQEG-LRIQNWLSAKVRKQLRLKPFYLVPKHA-----KEGNGFQE-ETWRLSFSHIEKEILNNHGKSKTCCENKEEKCCRKDCLKLMKYLLEQLKERFKDKKHLDKFSSYHVKTAFFHVCTQNPQDSQWDRKDLGLCFDNCVTYFLQCLRTEKLENYFIPEFNLFSSNL---IDKRSKE 502          
BLAST of Protein mab-21-like vs. Ensembl Celegans
Match: mab-21 (Protein male abnormal 21 [Source:UniProtKB/Swiss-Prot;Acc:Q20054])

HSP 1 Score: 393.66 bits (1010), Expect = 4.096e-135
Identity = 194/366 (53.01%), Postives = 259/366 (70.77%), Query Frame = 3
Query:  183 HQAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAY-MRDKPG--SSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            H   + +  N +  E+V  RK    K V+ + K+  +ILKEVE QEPRFI++L     T+ G ++G+ V SP+++E +L+LNQMGVFNFVDDG++ GC VLKLSDGRKRSMSLWVEFITASGYLSARKIR RFQ++VAQ ++   + D  +L+ D+T+V++RV D+YT+Q+T AFRC+G+WPRSASHWP+ GL WP   LA   KAEGF+L SRETA   ++ P   +SS E DAW +  + AE  LL+  GRR  LS+LK   +  ++  G +PVTNY +KTL+LYECEKH  + +W D N+ DR+ GILLQL+ CLQ RRC HYFL SLDL R K    ++ +A+  W L+R L+  P +L+ L
Sbjct:    4 HNQNVVYQVNNYFNEKVQHRKVRVTKTVQRIAKVVQEILKEVEAQEPRFINTL---SETTTGRFDGIVVHSPSEYEAVLYLNQMGVFNFVDDGTIQGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRHRFQNIVAQVLQTPQFSDYCKLLQDNTDVRVRVDDKYTVQITCAFRCNGIWPRSASHWPIAGLPWPNAALANQTKAEGFDLTSRETAITQQNNPNKQASSMEADAWAMKMHGAENMLLTG-GRRKTLSILKCLRDAHMDFPG-TPVTNYILKTLVLYECEKHCSEYEWEDPNIGDRLVGILLQLVSCLQCRRCAHYFLPSLDLLRSKPVHSIEHSAQLAWHLVRKLMIDPNALQSL 364          
BLAST of Protein mab-21-like vs. Ensembl Fly
Match: CG4766 (gene:FBgn0027546 transcript:FBtr0070891)

HSP 1 Score: 463.766 bits (1192), Expect = 1.529e-162
Identity = 219/363 (60.33%), Postives = 284/363 (78.24%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDK-PGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            Q ++ +  N+F  E+V +R   T   +RE+ KI  DILKEVE QEPRFISSL       NG +EG+ V+SPN+FEI+L+LNQMGVFNFVDDG++PGC VLKLSDGRKRSMSLWVEFITASGYLS+RKIR+RFQ+LVAQA + S YRD+V+++ D++EVKLR+ +R+ +Q+TPAF+CSG+WPRSA+HWP+  L WP  N+  +VK EGF+LLS+E+  M++K   ++S EGDAW+L F+EAE RLL    RR CLS+LKT  +R L+  G +P++ YH+K LLLYECEKHP D +W +  + DRINGI LQLI CLQ RRCPHYFL +LD+F+GK P+ L+QAAKQVW L R+L+T+  + EKL
Sbjct:   11 QTRMVYQMNRFCTERVQARMYKTATAIREICKIVQDILKEVELQEPRFISSL----VECNGRFEGVEVISPNEFEIVLYLNQMGVFNFVDDGTLPGCAVLKLSDGRKRSMSLWVEFITASGYLSSRKIRARFQTLVAQACDKSVYRDMVKMVGDTSEVKLRIRERFVVQITPAFKCSGIWPRSAAHWPVPHLPWPHPNIVAEVKTEGFDLLSKESVIMQNKNNNAASMEGDAWVLSFFEAENRLLQGGCRRRCLSMLKTLRDRHLDLPG-NPISAYHLKNLLLYECEKHPRDFEWDEGCIADRINGIFLQLISCLQYRRCPHYFLPALDMFKGKSPSALEQAAKQVWRLTRELLTNANAFEKL 368          
BLAST of Protein mab-21-like vs. Ensembl Fly
Match: mab-21 (gene:FBgn0029003 transcript:FBtr0070890)

HSP 1 Score: 459.144 bits (1180), Expect = 7.003e-161
Identity = 218/362 (60.22%), Postives = 283/362 (78.18%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            Q+++ +  NK+  ++V  RK   +K ++E+ +I  D+LKEVE QEPRFISSL    +  NG +EGL V+SP +FEII++LNQMGV NFVDDG++PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQA +   YRD+V++IAD+TEVKLR+ +R  +Q+TPAF+C+G+WPRSASHWPL G+ WP  N+  +VK EGF++LS+E   ++ K  +S+ EGDAW+L F +AE RLL    RR CLS+LKT  +R L+  G +PVT+YH+KTLLLYECEKHP + +W ++ + DRINGI LQLI CLQ RRCPHYFL ++DLF+GK P  L+ AAKQVW L R ++T+ R LE+L
Sbjct:   11 QSKMVYQMNKYCADRVQVRKAQIHKQIQEVCRIVQDVLKEVEVQEPRFISSL----NDYNGRFEGLEVISPTEFEIIIYLNQMGVLNFVDDGTLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQACDKCAYRDIVKMIADTTEVKLRIRERIIVQITPAFKCAGLWPRSASHWPLPGIPWPHPNIVAEVKTEGFDMLSKECIALQGK--NSAMEGDAWVLSFTDAENRLLQGASRRRCLSILKTLRDRHLDLPG-NPVTSYHLKTLLLYECEKHPREMEWEENCIADRINGIFLQLISCLQCRRCPHYFLPNMDLFKGKSPGALENAAKQVWRLTRIMLTNVRCLEEL 365          
BLAST of Protein mab-21-like vs. Ensembl Zebrafish
Match: mab21l1 (mab-21-like 1 [Source:NCBI gene;Acc:246091])

HSP 1 Score: 473.396 bits (1217), Expect = 1.927e-166
Identity = 229/362 (63.26%), Postives = 285/362 (78.73%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  SRK A +K +RE+ K+  D+LKEVE QEPRFISSL    +  +  +EGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL    R+ CLS+LKT  +R L   G  P+ NYHMKTL+ YECEKHP +SDW ++ L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLVYHLNKYYNEKCQSRKAAISKTIREVCKVVSDVLKEVEVQEPRFISSL----NEMDNRFEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECYSLNGK--QSSAESDAWVLQFAEAENRLLLGGCRKKCLSLLKTLRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDENCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. Ensembl Zebrafish
Match: mab21l2 (mab-21-like 2 [Source:NCBI gene;Acc:117234])

HSP 1 Score: 471.855 bits (1213), Expect = 9.187e-166
Identity = 228/362 (62.98%), Postives = 284/362 (78.45%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L +  NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    S  +  YEG+ V++PN+FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ +RY +Q+TPAF+C+G+WPRSA+ WP+  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL S  R+ CLSVLKT  +R L   G  P+ NYHMKTLLLYECEKHP ++DW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+ +SL+KL
Sbjct:    5 QAKLVYQLNKYYNERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----SEIDARYEGMEVIAPNEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGK--QSSAESDAWVLQFAEAENRLLMSGCRKKCLSVLKTLRDRHLELPG-QPLNNYHMKTLLLYECEKHPRETDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALETAAKQTWRLAREILTNAKSLDKL 359          
BLAST of Protein mab-21-like vs. Ensembl Zebrafish
Match: mab21l3 (mab-21-like 3 [Source:NCBI gene;Acc:558164])

HSP 1 Score: 87.0409 bits (214), Expect = 3.475e-18
Identity = 99/384 (25.78%), Postives = 162/384 (42.19%), Query Frame = 3
Query:  228 QVISRKNATNKVVREMLKIADDILKEVENQEPRFIS---------SLKYDG---STSNGIYEG-------LRVLSPNDFEIILFLNQMGVFNFVDDGS-----VPGCGVLKLSDGRK-RSMSLWVEF--------------ITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIAD-STEVKLRVHD---RYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIG-----RRCCLSVLKTFCERCLNSSGSSPV-TNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLI----CCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQV 1220
            QV  R    +K V ++ KI  D+  EV +++ RF S         SLK      S  + +  G       ++VLSP  + I + L   G+  + +  +         G   LS  R+   +  W+E               +T  G +   K+ + F+ L+  +++  G  + V ++    T V++ V     +  +++ P       WP+ A  WP     WP    A  +K+ GFNL++    +              WLL F  AE+ LLS+I      RR C  V++   E      GS PV T +H++TLL + CEK+P   DW D        G +L+L+     C+      HYF+ S +L +      LD+ AK++
Sbjct:   16 QVDLRHRQVSKCVEDVQKIIKDLTTEVSSKDARFQSIANAGVHNASLKDQPALMSKWSALLRGRCAYNPAIQVLSPTLYLISVPLQ--GLMGYKERRTRQWRYYTLTGSRLLSPVREPEKLHQWLELESFVNPSQEWHDARMTIEGDIVPAKVVNVFKDLLETSIKTRGLTNKVSVLESVGTAVRVAVETSEAQIEVKLVPTVELMNYWPKRA-RWPRLFRRWPSTERARCIKSFGFNLMASSNYH--------------WLLSFSRAEQVLLSNIDEDGGCRRKCYRVVRQLKEDGW-CPGSKPVITAFHLQTLLFWTCEKYPCTRDWKD------FRGCVLRLVQKLHKCVSQHYLRHYFIRSHNLLKYSNTNELDEVAKKI 375          
BLAST of Protein mab-21-like vs. Ensembl Zebrafish
Match: mab21l3 (mab-21-like 3 [Source:NCBI gene;Acc:558164])

HSP 1 Score: 86.6557 bits (213), Expect = 4.010e-18
Identity = 99/384 (25.78%), Postives = 162/384 (42.19%), Query Frame = 3
Query:  228 QVISRKNATNKVVREMLKIADDILKEVENQEPRFIS---------SLKYDG---STSNGIYEG-------LRVLSPNDFEIILFLNQMGVFNFVDDGS-----VPGCGVLKLSDGRK-RSMSLWVEF--------------ITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIAD-STEVKLRVHD---RYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIG-----RRCCLSVLKTFCERCLNSSGSSPV-TNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLI----CCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQV 1220
            QV  R    +K V ++ KI  D+  EV +++ RF S         SLK      S  + +  G       ++VLSP  + I + L   G+  + +  +         G   LS  R+   +  W+E               +T  G +   K+ + F+ L+  +++  G  + V ++    T V++ V     +  +++ P       WP+ A  WP     WP    A  +K+ GFNL++    +              WLL F  AE+ LLS+I      RR C  V++   E      GS PV T +H++TLL + CEK+P   DW D        G +L+L+     C+      HYF+ S +L +      LD+ AK++
Sbjct:   16 QVDLRHRQVSKCVEDVQKIIKDLTTEVSSKDARFQSIANAGVHNASLKDQPALMSKWSALLRGRCAYNPAIQVLSPTLYLISVPLQ--GLMGYKERRTRQWRYYTLTGSRLLSPVREPEKLHQWLELESFVNPSQEWHDARMTIEGDIVPAKVVNVFKDLLETSIKTRGLTNKVSVLESVGTAVRVAVETSEAQIEVKLVPTVELMNYWPKRA-RWPRLFRRWPSTERARCIKSFGFNLMASSNYH--------------WLLSFSRAEQVLLSNIDEDGGCRRKCYRVVRQLKEDGW-CPGSKPVITAFHLQTLLFWTCEKYPCTRDWKD------FRGCVLRLVQKLHKCVSQHYLRHYFIRSHNLLKYSNTNELDEVAKKI 375          
BLAST of Protein mab-21-like vs. Ensembl Zebrafish
Match: cgas (cyclic GMP-AMP synthase [Source:ZFIN;Acc:ZDB-GENE-090313-23])

HSP 1 Score: 55.0694 bits (131), Expect = 1.231e-7
Identity = 72/322 (22.36%), Postives = 132/322 (40.99%), Query Frame = 3
Query:  372 YEGLRVLSPNDFEIILFL--NQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASG---YRDVVQLIADSTEVKLRVHDRYTLQVTPAFR------CSGMWPRSASHWP---LGGL---SWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEG----DAWLLDFYEAEERLLSSIG--RRCCLSVLKTFCER-CL---------------NSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQV 1220
            YE L++  P++F+++L +   ++ + NF + G+        ++  R  +     +F+     + A ++ S F+  V +AVE +    Y+  +Q                TL+VT   +        G+    AS WP     G     W G  + + +K + F L+ +         G++  +G    D+W + F   E+ +L S G  + CC    +  C + CL                S+  S   +YH KT LL  C     D +W  S L +    +L   +  L+N + P++F+ S +L      +  D  AK++
Sbjct:  277 YENLKICEPDEFDVMLTVPVERVDIQNFDEAGAF-----YSIALKRHPNKHPLDKFLNEDKTIQASEMLSEFRDGVKKAVEKATDLPYKIKIQRKKPKCPA-------VTLEVTEGRKNISVDFVLGLKVHRAS-WPELTKDGFRVEHWLGRKVKSTMKRQPFYLVPKYEGI-----GNAEHDGVVARDSWRISFSHIEKEILKSHGHTKTCCEGREQKCCRKECLKLLKYLLQQLKNDESKSNKMSSFCSYHAKTTLLQACASRGTDIEWAYSELANCFQQLLEDFVKHLKNHQLPNFFIPSHNLLHHVSTSNCDFLAKEI 580          
BLAST of Protein mab-21-like vs. Ensembl Xenopus
Match: crtc3 (CREB regulated transcription coactivator 3 [Source:Xenbase;Acc:XB-GENE-5787077])

HSP 1 Score: 472.626 bits (1215), Expect = 6.724e-166
Identity = 229/362 (63.26%), Postives = 283/362 (78.18%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    +  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RL     R+ CLS+LKT  +R L   G  P+ NYHMKTL+ YECEKHP +SDW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----NEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHTLAGK--QSSAESDAWVLQFAEAENRLQLGGCRKKCLSLLKTLRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. Ensembl Xenopus
Match: mab21l2 (mab-21-like 2 [Source:NCBI gene;Acc:100125071])

HSP 1 Score: 469.159 bits (1206), Expect = 1.297e-164
Identity = 229/362 (63.26%), Postives = 282/362 (77.90%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L +  NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    +  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV++IAD++EVKLR+ +RY +Q+TPAF+C+G+WPRSA+ WPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL    R  CLSVLKT  +R L   G  P+ NYHMKTLLLYECEKHP ++DW ++ L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SL+KL
Sbjct:    5 QAKLVYQLNKYYSERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----TEIDARYEGLEVVSPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYIVQITPAFKCTGIWPRSAAQWPLPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGK--QSSAESDAWVLQFAEAENRLLLGGCRSKCLSVLKTLRDRHLELPG-QPLNNYHMKTLLLYECEKHPRETDWDEACLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALESAAKQTWRLAREILTNPKSLDKL 359          
BLAST of Protein mab-21-like vs. Ensembl Xenopus
Match: ttc22 (tetratricopeptide repeat domain 22 [Source:Xenbase;Acc:XB-GENE-948278])

HSP 1 Score: 83.5741 bits (205), Expect = 1.096e-16
Identity = 78/329 (23.71%), Postives = 151/329 (45.90%), Query Frame = 3
Query:  270 EMLKIADDILKEVENQEPRFISSLK---YDGS---TSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIG--------------RRCCLSVLKTFCERCLNSSGSSPVTN---YHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKL 1187
            E+ K A+ + K V++ + +FI S K   ++G     +   YE +++  PN+F+I+L +   G     +  +      L ++   K  ++ +VE    +G +S +++  R + L+   +      +V +  A S  V +++ +  ++ +  A    G WP S S   +   +W G  +  D K E    ++++           + E   W + F   E+ +L + G              R+ CL ++K   E+ L S G+  +T+   YH KT LL+ C  +P D DW   +L    +  +   + CL++ R P++F+ SL+LF  +L
Sbjct:  157 EISKAAEQVKKLVKDLD-KFIKSSKDPAFEGMEILNTGSYYEKVKISKPNEFDIMLKI-PCGRLRISESDASGSFYTLTINRNPKHPLTNYVE----NGKISGQQMLDRLRELIKSKLRTG--INVERRNAASPAVTIKIGE-ISVDLVLALEVEGSWPSSTSEG-MKIETWLGAKVKRDYKFEPMYFVAKQL---------KNTEEILWRISFSHIEKEILKNHGNAKTCCETEGVKCCRKQCLKLMKYLLEQ-LKSKGNRNMTHFCSYHAKTALLHSCTLYPKDDDWRPKDLAACFDRYIEDFMKCLKDARLPNFFIPSLNLFSEEL 465          
BLAST of Protein mab-21-like vs. Ensembl Xenopus
Match: ttc22 (tetratricopeptide repeat domain 22 [Source:Xenbase;Acc:XB-GENE-948278])

HSP 1 Score: 82.8037 bits (203), Expect = 2.507e-16
Identity = 78/329 (23.71%), Postives = 149/329 (45.29%), Query Frame = 3
Query:  270 EMLKIADDILKEVENQEPRFISSLK---YDGS---TSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIG--------------RRCCLSVLKTFCERCLNSSGSSPVTN---YHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKL 1187
            E+ K A+ + K V++ + +FI S K   ++G     +   YE +++  PN+F+I+L +   G     +  +      L ++   K  ++ +VE    +G +S +++  R + L+   +      +V +  A S  V +++ +  ++ +  A    G WP S S   +   +W G  +  D K E    + +   +M             W + F   E+ +L + G              R+ CL ++K   E+ L S G+  +T+   YH KT LL+ C  +P D DW   +L    +  +   + CL++ R P++F+ SL+LF  +L
Sbjct:  250 EISKAAEQVKKLVKDLD-KFIKSSKDPAFEGMEILNTGSYYEKVKISKPNEFDIMLKI-PCGRLRISESDASGSFYTLTINRNPKHPLTNYVE----NGKISGQQMLDRLRELIKSKLRTG--INVERRNAASPAVTIKIGE-ISVDLVLALEVEGSWPSSTSEG-MKIETWLGAKVKRDYKFEPMYFVHQANTFMEI----------LWRISFSHIEKEILKNHGNAKTCCETEGVKCCRKQCLKLMKYLLEQ-LKSKGNRNMTHFCSYHAKTALLHSCTLYPKDDDWRPKDLAACFDRYIEDFMKCLKDARLPNFFIPSLNLFSEEL 557          
BLAST of Protein mab-21-like vs. Ensembl Mouse
Match: Mab21l1 (mab-21-like 1 [Source:MGI Symbol;Acc:MGI:1333773])

HSP 1 Score: 473.781 bits (1218), Expect = 1.450e-166
Identity = 229/362 (63.26%), Postives = 283/362 (78.18%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    +  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RL     R+ CLS+LKT  +R L   G  P+ NYHMKTL+ YECEKHP +SDW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----NEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGK--QSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. Ensembl Mouse
Match: Mab21l2 (mab-21-like 2 [Source:MGI Symbol;Acc:MGI:1346022])

HSP 1 Score: 470.315 bits (1209), Expect = 3.481e-165
Identity = 229/362 (63.26%), Postives = 282/362 (77.90%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L +  NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    S  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV++IAD++EVKLR+ +RY +Q+TPAF+C+G+WPRSA+ WP+  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL    R  CLSVLKT  +R L   G  P+ NYHMKTLLLYECEKHP ++DW ++ L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SL+KL
Sbjct:    5 QAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----SEIDARYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGK--QSSAESDAWVLQFGEAENRLLMGGCRNKCLSVLKTLRDRHLELPG-QPLNNYHMKTLLLYECEKHPRETDWDEACLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALESAAKQTWRLAREILTNPKSLDKL 359          
BLAST of Protein mab-21-like vs. Ensembl Mouse
Match: Mab21l3 (mab-21-like 3 [Source:MGI Symbol;Acc:MGI:2446273])

HSP 1 Score: 85.5001 bits (210), Expect = 1.599e-17
Identity = 81/359 (22.56%), Postives = 146/359 (40.67%), Query Frame = 3
Query:  240 RKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVD---------DGSVPGC------GVLKLSDGRKRSMSLWVEF---ITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHD---RYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIG-----RRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRD 1238
            R+   ++ + E+ KI   +  E+  Q+ RF +        S+   E ++VL+P+ F + + L  +  +  V           G+   C      G+ +  +      +LW      +   G +   K+   F++LV  AV        V ++   T V + +     +  L++ P       WP  A  WP     WP       +K+ GFNL++ ++AY              W L F +AE+ L   +      RR C  VL+   E          +T +H++T+L + CEK+P   DW        +  ++ +L  C+      HYF+   +L +   P+ LD  A++V   L++
Sbjct:   87 RRQQISQTMEEVQKIIHLLTTEISRQDSRFEAV-----PVSDTHNESIKVLAPSLFHVTVPLKGLAGYKGVQRQRWRYYNVQGAKLTCPLRDPEGLQQWLETEMFMKTLWQWHKADVNIEGDIVPAKVLQVFRTLVENAVRTCHLSGKVTVLEKRTTVWVAMETSTGQVELELAPTVEIPTTWPEKAQ-WPRCLKRWPSPERVECIKSFGFNLVA-QSAYH-------------WQLSFSQAEQVLFEQLDEDGGCRRQCFQVLRQLKEDVWCPGRRPVITTHHLQTVLFWTCEKYPHLKDW--QVFHQALLRLVRKLHRCVSQHFLKHYFVPKSNLLQSANPSELDAVAQKVAFFLKN 423          
BLAST of Protein mab-21-like vs. Ensembl Mouse
Match: Mab21l3 (mab-21-like 3 [Source:MGI Symbol;Acc:MGI:2446273])

HSP 1 Score: 85.5001 bits (210), Expect = 1.599e-17
Identity = 81/359 (22.56%), Postives = 146/359 (40.67%), Query Frame = 3
Query:  240 RKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVD---------DGSVPGC------GVLKLSDGRKRSMSLWVEF---ITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHD---RYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIG-----RRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRD 1238
            R+   ++ + E+ KI   +  E+  Q+ RF +        S+   E ++VL+P+ F + + L  +  +  V           G+   C      G+ +  +      +LW      +   G +   K+   F++LV  AV        V ++   T V + +     +  L++ P       WP  A  WP     WP       +K+ GFNL++ ++AY              W L F +AE+ L   +      RR C  VL+   E          +T +H++T+L + CEK+P   DW        +  ++ +L  C+      HYF+   +L +   P+ LD  A++V   L++
Sbjct:   87 RRQQISQTMEEVQKIIHLLTTEISRQDSRFEAV-----PVSDTHNESIKVLAPSLFHVTVPLKGLAGYKGVQRQRWRYYNVQGAKLTCPLRDPEGLQQWLETEMFMKTLWQWHKADVNIEGDIVPAKVLQVFRTLVENAVRTCHLSGKVTVLEKRTTVWVAMETSTGQVELELAPTVEIPTTWPEKAQ-WPRCLKRWPSPERVECIKSFGFNLVA-QSAYH-------------WQLSFSQAEQVLFEQLDEDGGCRRQCFQVLRQLKEDVWCPGRRPVITTHHLQTVLFWTCEKYPHLKDW--QVFHQALLRLVRKLHRCVSQHFLKHYFVPKSNLLQSANPSELDAVAQKVAFFLKN 423          
BLAST of Protein mab-21-like vs. Ensembl Mouse
Match: Cgas (cyclic GMP-AMP synthase [Source:MGI Symbol;Acc:MGI:2442261])

HSP 1 Score: 78.9518 bits (193), Expect = 2.633e-15
Identity = 77/351 (21.94%), Postives = 146/351 (41.60%), Query Frame = 3
Query:  279 KIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLN----------QMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAV------------EASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASH-WPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIG--------------RRCCLSVLKTFCERCLNSSGS-SPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQ 1217
            K+ + +L+ ++ +E  F    + +   +   YE +++ +PN+F+++  L           + G F  V    +P          R   +S ++E       LSA K+ S+F+ ++ + V            E  G   V  LI +  E+        ++ +  A    G WP S     P+ G  W G  + T+++ E F L+ +           +S +G+ W L F   E+ +L++ G              R+ CL ++K   E+            +YH+KT + +   + P DS W   NL    + +L   + CL+  +  HYF+   +LF  +L   +D+ +K+
Sbjct:  173 KVVERLLRRMQKRESEFKGVEQLN---TGSYYEHVKISAPNEFDVMFKLEVPRIELQEYYETGAFYLVKFKRIP----------RGNPLSHFLE----GEVLSATKMLSKFRKIIKEEVKEIKDIDVSVEKEKPGSPAVTLLIRNPEEI--------SVDIILALESKGSWPISTKEGLPIQG--WLGTKVRTNLRREPFYLVPKNAK------DGNSFQGETWRLSFSHTEKYILNNHGIEKTCCESSGAKCCRKECLKLMKYLLEQLKKEFQELDAFCSYHVKTAIFHMWTQDPQDSQWDPRNLSSCFDKLLAFFLECLRTEKLDHYFIPKFNLFSQEL---IDRKSKE 487          
BLAST of Protein mab-21-like vs. UniProt/SwissProt
Match: sp|O70299|MB211_MOUSE (Putative nucleotidyltransferase MAB21L1 OS=Mus musculus OX=10090 GN=Mab21l1 PE=2 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 1.014e-165
Identity = 229/362 (63.26%), Postives = 283/362 (78.18%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    +  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RL     R+ CLS+LKT  +R L   G  P+ NYHMKTL+ YECEKHP +SDW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----NEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGK--QSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. UniProt/SwissProt
Match: sp|Q13394|MB211_HUMAN (Putative nucleotidyltransferase MAB21L1 OS=Homo sapiens OX=9606 GN=MAB21L1 PE=1 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 1.014e-165
Identity = 229/362 (63.26%), Postives = 283/362 (78.18%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    +  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RL     R+ CLS+LKT  +R L   G  P+ NYHMKTL+ YECEKHP +SDW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----NEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGK--QSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. UniProt/SwissProt
Match: sp|Q8AY65|MB211_CHICK (Putative nucleotidyltransferase MAB21L1 OS=Gallus gallus OX=9031 GN=MAB21L1 PE=2 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 1.014e-165
Identity = 229/362 (63.26%), Postives = 283/362 (78.18%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    +  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RL     R+ CLS+LKT  +R L   G  P+ NYHMKTL+ YECEKHP +SDW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----NEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGK--QSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. UniProt/SwissProt
Match: sp|A4FV14|MB211_BOVIN (Putative nucleotidyltransferase MAB21L1 OS=Bos taurus OX=9913 GN=MAB21L1 PE=2 SV=1)

HSP 1 Score: 473.781 bits (1218), Expect = 1.014e-165
Identity = 229/362 (63.26%), Postives = 283/362 (78.18%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    +  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RL     R+ CLS+LKT  +R L   G  P+ NYHMKTL+ YECEKHP +SDW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLVYHLNKYYNEKCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----NEMDNRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECHSLAGK--QSSAESDAWVLQFAEAENRLQMGGCRKKCLSILKTLRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. UniProt/SwissProt
Match: sp|Q6NYB4|MB211_DANRE (Putative nucleotidyltransferase MAB21L1 OS=Danio rerio OX=7955 GN=mab21l1 PE=2 SV=1)

HSP 1 Score: 473.396 bits (1217), Expect = 1.455e-165
Identity = 229/362 (63.26%), Postives = 285/362 (78.73%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  SRK A +K +RE+ K+  D+LKEVE QEPRFISSL    +  +  +EGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL    R+ CLS+LKT  +R L   G  P+ NYHMKTL+ YECEKHP +SDW ++ L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLVYHLNKYYNEKCQSRKAAISKTIREVCKVVSDVLKEVEVQEPRFISSL----NEMDNRFEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECYSLNGK--QSSAESDAWVLQFAEAENRLLLGGCRKKCLSLLKTLRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDENCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. TrEMBL
Match: A0A1S3KBM7 (protein mab-21-like 2 isoform X1 OS=Lingula unguis OX=7574 GN=LOC106180566 PE=4 SV=1)

HSP 1 Score: 493.812 bits (1270), Expect = 1.374e-170
Identity = 237/362 (65.47%), Postives = 291/362 (80.39%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            Q++L F  NK+  E+V SRK AT K VRE+ K+  D+LKEVE QEPRFISSL    S  NG +EGL VLSP +FE++L+LNQMGVFNFVDDG+VPGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRD V+++AD+TEVKLR+ DR+ +Q+T AFRC+G+WPRSA+HWP+  + WP  NL  +VK EGF+LLS+E+ YM+DK   SSAEGDAW+L F +AE +LL    R+ CLS+LKT  +R L+  G  PV NY++KTLLLYECEKHP + +W ++ + DRINGILLQLI CLQNRRCPHYFL  LDLF+GK P+ +D AAKQVW +LR+L+T+ RSLEKL
Sbjct:   40 QSKLLFQLNKYYNERVQSRKGATTKTVREVCKVVQDVLKEVEVQEPRFISSL----SEVNGRFEGLEVLSPTEFEVVLYLNQMGVFNFVDDGTVPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCAYRDCVKMVADTTEVKLRIRDRFVVQITTAFRCAGIWPRSAAHWPIPHIPWPNPNLVAEVKTEGFDLLSKESIYMKDK--QSSAEGDAWVLSFNQAENKLLRGGSRKRCLSILKTLRDRHLDIPG-QPVCNYNLKTLLLYECEKHPRELEWDETCIGDRINGILLQLISCLQNRRCPHYFLPHLDLFKGKSPSAMDTAAKQVWRILRELLTNSRSLEKL 394          
BLAST of Protein mab-21-like vs. TrEMBL
Match: A0A0L8GZW1 (Mab-21 domain-containing protein OS=Octopus bimaculoides OX=37653 GN=OCBIM_22025229mg PE=4 SV=1)

HSP 1 Score: 491.886 bits (1265), Expect = 3.157e-170
Identity = 232/362 (64.09%), Postives = 290/362 (80.11%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            Q++L F  NK+  E+V +RK    K VRE+ K+  D+LKEVE QEPRFISSL     ++ G YEG+ V+SP ++E++L+LNQMGVFNFVDDG++PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YR+VV+++AD+TEVKLR+ +RY +Q+TPAFRC G+W RSA+HWP+  + WP  NL  +VK EGF+LLS+E+ YM+DK   S+AEGDAW++ F  AE+RLL    RR CLS+LK   +R L    S P+TNYHMKTLLLYECEKHP + +W D+ L DRINGILLQLI CLQNRRCPHYFL +LDLF+G+ P+ +D AAKQVW +LR+L+T+PRSLEKL
Sbjct:   12 QSKLLFQLNKYYNERVQTRKANIAKTVREVCKVVQDVLKEVEVQEPRFISSL---NESNTGRYEGMEVISPTEYEVVLYLNQMGVFNFVDDGTIPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYREVVKMVADTTEVKLRIKERYVVQITPAFRCGGIWSRSAAHWPVPHIPWPSPNLIAEVKTEGFDLLSKESIYMKDK--QSAAEGDAWVMSFKYAEDRLLCGGCRRKCLSILKAMRDRHLELP-SQPITNYHMKTLLLYECEKHPREVEWDDTCLGDRINGILLQLISCLQNRRCPHYFLPNLDLFKGRSPSAMDSAAKQVWRILRELLTNPRSLEKL 367          
BLAST of Protein mab-21-like vs. TrEMBL
Match: K1R2P9 (Protein mab-21-like 2-B OS=Crassostrea gigas OX=29159 GN=CGI_10022555 PE=4 SV=1)

HSP 1 Score: 490.73 bits (1262), Expect = 7.472e-170
Identity = 230/362 (63.54%), Postives = 293/362 (80.94%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            Q+++ F  NK+  E+V +R+  T K +RE+ K+  D+LKEVE QEPRFISSL    +  NG +EGL ++SPN+FE++L+LNQMGVFNFVDDG++PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRD+V+++AD+TEVKLR+ +RY +Q+ PAFRC+G+W RSA+HWP+    WP  NL  +VK EGF+LLSRE+ YM+DK   S+AEGDAW++ F  AE+RLL    RR CLS+LKT  ER L+  G +P+TNYH KTLLLYECEKHP + +W D++L DR+NGILLQ I CLQNRRCPHYFL ++DLF+GK P+ +D AAKQVW +LR+L+T+P+SLEKL
Sbjct:    5 QSKILFQLNKYYNERVQTRQGNTIKTIREVCKVVQDVLKEVEVQEPRFISSL----NEVNGRFEGLDIVSPNEFEVVLYLNQMGVFNFVDDGTIPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDIVKMVADTTEVKLRIKERYVVQIIPAFRCAGIWCRSAAHWPVPHTQWPNPNLVAEVKTEGFDLLSRESIYMKDK--QSAAEGDAWVMSFKYAEDRLLYGGCRRRCLSILKTLRERHLDLPG-NPITNYHFKTLLLYECEKHPREMEWDDTSLGDRLNGILLQTISCLQNRRCPHYFLPNVDLFKGKAPSSMDYAAKQVWRILRELLTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. TrEMBL
Match: V4AJF2 (Mab-21 domain-containing protein OS=Lottia gigantea OX=225164 GN=LOTGIDRAFT_182097 PE=4 SV=1)

HSP 1 Score: 483.797 bits (1244), Expect = 4.782e-167
Identity = 228/362 (62.98%), Postives = 288/362 (79.56%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            Q++L F  NKF  E+V +RK+  NK +RE+ K+  D+LKEVE QEPRFISSL    +  N  YEGL V+SP +FE++L+LNQMGVFNFVDDG++PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV++I D+TEV+LR+ +R+ +Q+TPAFRC G+W RSA+HWP+  + WP  NL  +VK EGF+LLS+E+ YM+DK   S+AEGDAW++ F  AE+RLL    RR CLS+LK   ++  +  G  P+ NYHMKTLLLYECEKHP +S+W D+ L DR+NGILLQLI CLQNR+CPHYFL S+DLF+GK  + +D AAKQ W +LR+L+T+PRSLE+L
Sbjct:   14 QSKLLFQLNKFYNERVAARKSNVNKTIREVCKVVQDVLKEVEVQEPRFISSL----TEVNQRYEGLEVISPTEFEVVLYLNQMGVFNFVDDGTIPGCSVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIPDTTEVRLRIKERFIVQITPAFRCGGIWCRSAAHWPIPQIPWPNPNLVAEVKTEGFDLLSKESIYMKDK--QSAAEGDAWVMSFRYAEDRLLYGGCRRKCLSILKALKDKHFDVPG-QPILNYHMKTLLLYECEKHPRESEWDDTCLGDRLNGILLQLISCLQNRKCPHYFLPSVDLFKGKSTSGMDNAAKQAWRILRELLTNPRSLERL 368          
BLAST of Protein mab-21-like vs. TrEMBL
Match: A0A2C9JDZ2 (Mab-21 domain-containing protein OS=Biomphalaria glabrata OX=6526 GN=106054627 PE=4 SV=1)

HSP 1 Score: 482.256 bits (1240), Expect = 1.833e-166
Identity = 230/362 (63.54%), Postives = 286/362 (79.01%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            Q++L F  NK+  E+V +RK + NK  RE+ K+  D+LKEVE QEPRFISSL    +  N  YEG+ V+SP +FE++L+LNQMGVFNFVDDG++PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV++I D+TEVKLR+ +RY +Q+TPAFRC G+W RSA+HWP+  +SWP  NL  +VK EGF+LLS+E+ YM+DK   S+AEGDAW++ F  AE+RLL    RR CLS+LKT  +R L+  G  P+ NYHMKTLLLYECEKHP + +W D+ + DRINGILLQLI CLQNRRCP YFL ++DLF+GK  A +D  AKQVW L+R+L+T+PRS E L
Sbjct:   14 QSKLLFQINKYYNERVHARKASINKTTREVCKVVQDVLKEVEVQEPRFISSL----TEVNMRYEGVEVISPTEFEVVLYLNQMGVFNFVDDGTIPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMIPDTTEVKLRIKERYIVQITPAFRCGGIWCRSAAHWPVPHVSWPNPNLVAEVKTEGFDLLSKESIYMKDK--QSAAEGDAWVMSFRYAEDRLLYGGCRRRCLSILKTLRDRHLDIPG-QPILNYHMKTLLLYECEKHPREIEWDDTCIGDRINGILLQLISCLQNRRCPQYFLPTVDLFKGKSAAAMDNVAKQVWRLVRELLTNPRSFEAL 368          
BLAST of Protein mab-21-like vs. Ensembl Cavefish
Match: MAB21L1 (putative nucleotidyltransferase MAB21L1 [Source:NCBI gene;Acc:103037879])

HSP 1 Score: 473.396 bits (1217), Expect = 2.010e-166
Identity = 229/362 (63.26%), Postives = 285/362 (78.73%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  +RK A +K +R++ K+  D+LKEVE QEPRFISSL    +  +  YEGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL    R+ CLSVLKT  +R L   G  P+ NYHMKTL+ YECEKHP +SDW ++ L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLAYHLNKYYTEKCQARKAAVSKTIRDVCKVVSDVLKEVEVQEPRFISSL----NELDNRYEGLEVVSPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECYSLNGK--QSSAESDAWVLQFAEAENRLLLGGCRKKCLSVLKTLRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDENCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. Ensembl Cavefish
Match: mab21l2 (mab-21 like 2 [Source:NCBI gene;Acc:103037944])

HSP 1 Score: 468.774 bits (1205), Expect = 1.261e-164
Identity = 227/362 (62.71%), Postives = 282/362 (77.90%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L +  NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    S     YEG+ V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EV+LR+ +RY +Q+TPAF+C+G+WPRSA+ WP+  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL S  R+ CLS+LKT  +R L   G  P+ NYHMKTLLLYECEKHP +SDW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+ +SL+KL
Sbjct:    5 QAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----SEIEARYEGMEVVSPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVRLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGK--QSSAESDAWVLQFAEAENRLLLSGCRKKCLSILKTLRDRHLELPG-QPLNNYHMKTLLLYECEKHPRESDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALEAAAKQTWRLAREILTNAKSLDKL 359          
BLAST of Protein mab-21-like vs. Ensembl Cavefish
Match: mab21l3 (mab-21 like 3 [Source:NCBI gene;Acc:103024440])

HSP 1 Score: 80.8777 bits (198), Expect = 3.066e-16
Identity = 89/390 (22.82%), Postives = 156/390 (40.00%), Query Frame = 3
Query:  222 QEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYE--------------------GLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGR-------KRSMSLWVEF--------------ITASGYLSARKIRSRFQSLVAQAVEASGYR----------DVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIG-----RRCCLSVLKTFCERCLNSSGSSPV-TNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQV 1220
            Q QV  R    +K V E+ KI  D+  EV +++ RF  S+   G  ++   +                     ++VL+P  F I + +  +  +    +          LS  R          +  W+E               +   G +   K+ + F+  V  A++   +            VV++  ++++V++ V      ++ P       WP+ A  WP     WP    +  VK+ GFNL++  + +              WLL F  AE+ LL S+      R+ C  V++   E      GS PV T +H++ LL + CEK+P   DW   NL + +  ++ +L  C+  R   HYF+ + +L +      LD  AK++
Sbjct:   14 QNQVDLRHRQVSKSVEEVQKIIKDLTTEVSSKDARF-QSISNSGVHNDCFKDQPALASKWAALLRGRCTLNPAIQVLTPTLFLISVPVRGLMAYK---ERQARQWRYYTLSGSRLLSPVRDPEKLHQWLELESFANASQEWHDSRVIMEGDIVPAKVVTVFKEQVQAAIKTCKFTAKVSILESVGSVVRVAVETSDVQVEV------ELVPTVELMNCWPKRA-RWPHLLQRWPSAERSRSVKSFGFNLMAMSSYH--------------WLLSFSRAEQVLLGSMDEDGGCRKKCYMVVRQLKEDVW-CPGSKPVITAHHLQMLLFWTCEKYPSSRDW--RNLRECVLRLVQKLHKCVSQRYIRHYFVRTYNLLKYTNTNELDDMAKKI 375          
BLAST of Protein mab-21-like vs. Ensembl Cavefish
Match: cgas (cyclic GMP-AMP synthase [Source:NCBI gene;Acc:103037406])

HSP 1 Score: 51.9878 bits (123), Expect = 9.707e-7
Identity = 74/350 (21.14%), Postives = 148/350 (42.29%), Query Frame = 3
Query:  225 EQVISRKNATNKVVREMLKIADDILKEVENQEP--RFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFL--NQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVE--ASGYRDVVQ-LIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPL---GGL---SWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEG----DAWLLDFYEAEERLLSSIG-------------RRCCLSVLKTFCE--RCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFR 1178
            E++  +K   N+  R + +I  +I K ++      + I  LK     +    E +++   ++F+++L +  +++ +  F  DG+     +      ++ S     +F+     + A ++ + F+  V + V    S Y   V+        V L+V  +    ++  F   G+   S+S WP     G    +W G  + TD+K + F L+ +         G++  +G    DAW + F   E+ +L + G             R+ CL +LK      +  +   +  + +YH KT LL+ C +   DS+W  S L      +L      L+ +  P++F+ S +L +
Sbjct:  128 EKLKIKKTERNEATRCVNEIQKEIAKHLKESLDWCKEIQELK-----TGSHVENVKICESDEFDVMLVISVDRVDIQPFRGDGAFYSVAL------KRNSCKSLDKFLNKDKIIEASEMLTEFRKKVKECVPKLTSKYNITVEGKKPGCPAVTLQVKGKDGRIISLDF-VLGLEVHSSS-WPAITKDGFKIDNWLGKKVKTDLKRKPFYLVPKYEGK-----GTTECDGVKAKDAWRISFSHVEKEVLKNHGQSKTCCEGRPSCCRKQCLKLLKYLVRGLKEHHPKEAGKLCSYHAKTTLLHACAERGGDSEWEISQLSHCFQQVLSDFENYLRKQDLPNFFIPSHNLLK 459          
BLAST of Protein mab-21-like vs. Ensembl Cavefish
Match: mb21d2 (Mab-21 domain containing 2 [Source:NCBI gene;Acc:103025359])

HSP 1 Score: 50.447 bits (119), Expect = 2.539e-6
Identity = 42/168 (25.00%), Postives = 70/168 (41.67%), Query Frame = 3
Query:  678 RYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSI--GRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLF 1175
            R    + P     G WP  A  W +    W G     +V + GF LL   +A  R +        + W L F  +E +L   I  G        K    + L    S  V+ YH+++++L+ C++ P      +      + G++  L  CL N+ CP+YF+   ++F
Sbjct:  246 RMLYDIVPVVSFKG-WPAVAQSWLMENHFWDGKITEEEVIS-GFYLLPACSASGRRE--------NEWRLSFARSEVQLKKCISPGLMQAFQACKAILVKLLGQPSS--VSPYHLRSIMLWACDRLPATYLGQEDFAAHFLLGLIDDLQHCLVNKTCPNYFIPQCNMF 401          
BLAST of Protein mab-21-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000010941.1 (pep scaffold:Pmarinus_7.0:GL486525:1595:2674:-1 gene:ENSPMAG00000009914.1 transcript:ENSPMAT00000010941.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 470.7 bits (1210), Expect = 3.910e-166
Identity = 228/362 (62.98%), Postives = 283/362 (78.18%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L +  NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    S  +G +EGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ +RY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL    R+ CLSVLK   +R L   G +P+ NYHMKTLL+YECEKHP +SDW +  L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+ +SL+KL
Sbjct:    5 QAKLVYQLNKYYTERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----SEIDGRFEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRERYVVQITPAFKCAGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECYALAGK--QSSAESDAWVLQFAEAENRLLLGGCRKKCLSVLKALRDRHLELPG-TPLNNYHMKTLLMYECEKHPRESDWDECTLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNTKSLDKL 359          
BLAST of Protein mab-21-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006356.1 (pep scaffold:Pmarinus_7.0:GL479339:17263:18667:-1 gene:ENSPMAG00000005723.1 transcript:ENSPMAT00000006356.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 223.402 bits (568), Expect = 1.985e-69
Identity = 152/372 (40.86%), Postives = 205/372 (55.11%), Query Frame = 3
Query:  174 LTPHQAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLN---QMGVFNFVD-DGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYR-DVVQLIADSTEVKLRVHDRYTLQVTPAFRCSG-MWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            + P Q  L    + F+++    R        R++ +    +L+EV  +EPRFI S    G            +   +FE++L+LN     GVF+  D D    G  +LKL+DGR+RSMS WVEFITASG LSA K+RSR ++LV QA+   G R    +    S EV + V D   ++VTPAFRCSG +WPR AS W    L WPG     ++KA GF LL  E A +     + +  GDAWLL F EAEE LL    RR CLSVL    ER L       +    ++TL    CEKHP D++W D+ L +R+ G LL+L  CL+ RRCPH+F+   +L RG     L++AA++ W L R LI  P S++ L
Sbjct:    1 MMPWQQSLSVRLDAFHRQHCAPRPQLPCGAARDIARAVSTVLREVGAREPRFIIS---PGEHHPHRSPHQLAVDACEFEMLLYLNLQTSSGVFSLADEDDEGGGRALLKLADGRERSMSPWVEFITASGSLSASKLRSRLRALVTQAL---GRRLPCGRTTCASGEVLIGVPDNGVVKVTPAFRCSGAVWPRCASQW-FPHLQWPGPRRMAEIKAAGFTLLPAEEAKLPGA--AGAGHGDAWLLRFTEAEEPLLEGGCRRKCLSVLSALRERHLPGVPGGCL----VRTL----CEKHPRDAEWADTCLGERLLGALLRL-SCLRCRRCPHFFVRGAELLRG-----LERAAERAWRLARPLIAGPASVDTL 349          
BLAST of Protein mab-21-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006344.1 (pep scaffold:Pmarinus_7.0:GL479339:17263:18667:-1 gene:ENSPMAG00000005723.1 transcript:ENSPMAT00000006344.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 222.631 bits (566), Expect = 5.186e-69
Identity = 153/383 (39.95%), Postives = 209/383 (54.57%), Query Frame = 3
Query:  174 LTPHQAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFI----------SSLKYDGSTSNGIYEGLRVLSPN-DFEIILFLN---QMGVFNFVD-DGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYR-DVVQLIADSTEVKLRVHDRYTLQVTPAFRCSG-MWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            + P Q  L    + F+++    R        R++ +    +L+EV  +EPRFI          S  +       G+        P+ +FE++L+LN     GVF+  D D    G  +LKL+DGR+RSMS WVEFITASG LSA K+RSR ++LV QA+   G R    +    S EV + V D   ++VTPAFRCSG +WPR AS W    L WPG     ++KA GF LL  E A +     + +  GDAWLL F EAEE LL    RR CLSVL    ER L       +    ++TL   +CEKHP D++W D+ L +R+ G LL+L  CL+ RRCPH+F+   +L RG     L++AA++ W L R LI  P S++ L
Sbjct:    1 MMPWQQSLSVRLDAFHRQHCAPRPQLPCGAARDIARAVSTVLREVGAREPRFIISPGEHHPHRSPHQLAVDACGGLLPVTDGAPPSSEFEMLLYLNLQTSSGVFSLADEDDEGGGRALLKLADGRERSMSPWVEFITASGSLSASKLRSRLRALVTQAL---GRRLPCGRTTCASGEVLIGVPDNGVVKVTPAFRCSGAVWPRCASQW-FPHLQWPGPRRMAEIKAAGFTLLPAEEAKLPGA--AGAGHGDAWLLRFTEAEEPLLEGGCRRKCLSVLSALRERHLPGVPGGCL----VRTL---QCEKHPRDAEWADTCLGERLLGALLRL-SCLRCRRCPHFFVRGAELLRG-----LERAAERAWRLARPLIAGPASVDTL 364          
BLAST of Protein mab-21-like vs. Ensembl Sea Lamprey
Match: ENSPMAT00000006197.1 (pep scaffold:Pmarinus_7.0:GL476624:333660:337604:-1 gene:ENSPMAG00000005596.1 transcript:ENSPMAT00000006197.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 58.9214 bits (141), Expect = 7.433e-10
Identity = 78/339 (23.01%), Postives = 147/339 (43.36%), Query Frame = 3
Query:  279 KIADDILKEVENQEPRFISSLKYDGS-------TSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEA-SGYRDVVQLI-----ADSTEVK-LRVHDRYTLQVTPAFRC-SGMWPRSASHWPLGGLSWPGH-NLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIG--------------RRCCLSVLKTFCE---RCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRC---PHYFLTSLDLFRGKL 1187
            K+ +DIL+ +       + ++K DG         +   YE L++  P++F+++L L +      V+   VPG G        KR+ +L  +      ++S  KI    ++++ + +      R+ ++       A + ++K +   D   + + PA +  +  WP  A    +   SW G  ++A    ++ F L+ ++    R+   +   E  AW + F E E+ ++ + G              R+ CL +LK   E   +C  S   + + +YH KT+ L+ C   P DS W   NL +R+   ++ L    +  R     H+FL   +LF  KL
Sbjct:    3 KVINDILRTI-------MDAVKKDGQLPVDKLLNTGSYYEKLKISEPDEFDVMLVLVER-----VNLEEVPGLGGAFYLVTPKRNSAL--QKFAVGNFISPAKIIKVLENIIKRLLPTLDSIRERLKPASKGCPAVTIQLKPMEAEDDVCVDLVPAIKVQNSSWPPEAKT--INTSSWLGRKHMAKLFTSKSFYLVGKKPP--RNAKVAGVIEDRAWRISFSEVEKDIVLNHGNKNTCCEKGQAHCCRKECLKLLKWLLESFKKCTPSMQDN-LCSYHAKTVWLHACAGWPNDSHW---NLKNRLLCFIILLEDFAEAARTGILSHFFLPRYNLFDQKL 319          
BLAST of Protein mab-21-like vs. Ensembl Nematostella
Match: EDO41756 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S3D7])

HSP 1 Score: 353.214 bits (905), Expect = 8.115e-120
Identity = 180/351 (51.28%), Postives = 235/351 (66.95%), Query Frame = 3
Query:  216 FNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLI-ADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLE 1265
            F    V  RK+ T + +  + ++  ++LK VE  EPRFISSLK      +G Y GL V+SP  FE+ L+LNQMGVFNF+DDG   GC +LKLSD RKRSMSLW EFITASGYLSARK+RSRF SLV +A+     +  VQ++ A+S    L ++D YT+++ PAFRC  +WP++   WP     WP      ++K  GFNLL+++  Y   KP ++  EGDAW+L F ++EE LL+   RR C+S+LK  C++ LN  G   +   H+K L+LYECEKHP D +W D  L DRINGILLQL+ CLQ R+CPH+FL  ++LF GK   +LDQAAKQVW L RDL T+P S E
Sbjct:    4 FVSNIVHRRKSETYQAIANVCRVVPEVLKHVEALEPRFISSLK----QLDGRYLGLYVVSPKRFEVCLYLNQMGVFNFIDDGCPSGCAMLKLSDERKRSMSLWTEFITASGYLSARKMRSRFTSLVGEAIRRGNLQSQVQMVGANSHSTVLSINDTYTVELIPAFRCGAIWPQNTCSWPSPDSYWPSQAAVANIKLRGFNLLAKD-PYPSVKPVNT--EGDAWVLSFTDSEELLLAGGCRRLCVSMLKALCDKHLNVPGDC-IEYIHLKNLVLYECEKHPRDFEWFDEALFDRINGILLQLVSCLQCRKCPHFFLKGVELFAGKSRTVLDQAAKQVWNLARDLATNPSSFE 346          
BLAST of Protein mab-21-like vs. Ensembl Nematostella
Match: EDO42726 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0T1])

HSP 1 Score: 96.2857 bits (238), Expect = 4.721e-22
Identity = 84/333 (25.23%), Postives = 154/333 (46.25%), Query Frame = 3
Query:  210 NKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNG-IYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPL---GGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLL-------SSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLF 1175
            N++  +++   ++A  K +         ILK VE ++  +    K+D     G  YE  +V +P++F++++ +++  +         PG  V   +     S+   V     +  ++A  I+S    LV QAV+   Y     LI D           Y + +T AF+ +  WP +A+ W     GG  WP  +L  ++  +G ++++++    +     +S     W   F  AE++L        +    +  L +LK+  E  +   G  P+T+YH+KT++ YECE+ P  SDW  S L +R    +L L   ++ +  PHYF+ +L+LF
Sbjct:   10 NQYFSQKITIHQDAKQKALAAWQPPVQKILKFVEERDTYY----KFDRLLMTGSYYERAKVKNPDEFDLMIEIDKEQLLK-----KKPGAEVYPENPPLGYSLLRGVSH-GQTVVINATGIKSTASGLVNQAVQNYQY----GLIIDGKT--------YAVDLTFAFKVN-EWPSAANEWARRCRGG--WPSRDLIEEIVKDGCHVVAKKPEIFQ----GTSKGSLCWRYSFSTAEKKLFQKGFSGDAGTCMKQVLRLLKSLREDYMKYMG--PLTSYHLKTIVFYECERFPDPSDWDSSKLAERFKSAVLLLQYFIKKKYLPHYFIQNLNLF 311          
BLAST of Protein mab-21-like vs. Ensembl Nematostella
Match: EDO41925 (Mab21-like protein; Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S337])

HSP 1 Score: 82.4185 bits (202), Expect = 4.696e-17
Identity = 51/192 (26.56%), Postives = 93/192 (48.44%), Query Frame = 3
Query:  669 VHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGR--RCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRD 1238
            ++ +++  +  A  CSG WP  A  +      WP  ++   ++ +GF        ++ +K    +  G  W L F  AE+ L + +    R C  V K    + L +     +++Y++KT+ L++CE+ P++  W + N+   I G+L  L+ CL N+ CPHYF+ + +L        L   A+ V  + RD
Sbjct:  252 IYRKFSTDLVAAMYCSG-WPSIADGFFHRERRWPTPSILDQIRNDGF--------FIVNKSPFKNPTGLEWRLSFSNAEKTLFAHMTELMRHCFCVFKGIYYQELTTPNV--LSSYYLKTIFLWKCERMPMNV-WVERNVAQVIMGLLDDLLHCLVNKHCPHYFMPTCNLLENAHGDFLLHLARTVLQIRRD 431          
BLAST of Protein mab-21-like vs. Ensembl Nematostella
Match: EDO40733 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S6E3])

HSP 1 Score: 78.5666 bits (192), Expect = 9.638e-16
Identity = 58/199 (29.15%), Postives = 94/199 (47.24%), Query Frame = 3
Query:  684 TLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRC--CLSVLKT--FCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEK 1268
            +L    +  C+G WP  AS +     +WP       ++ +GF+L+ +      DK  + S E   W + F +AE  L +S+      C  + KT  +CE  L       + +Y+MKT+ L+ CE+ P D  W +SNL   + G+L +L+ CL  + CPHYF+   +L        L   A++V  +       P+S  K
Sbjct:  254 SLDFVFSLECTG-WPEIASEYFNRDRNWPPPATLNKIRNDGFHLVYKPL----DKDCADSVE---WRISFSKAEAALFNSMSPPMMHCYRIFKTIYYCELTLPKV----LCSYYMKTIFLWVCERLPEDV-WDESNLAQVVLGLLDELVHCLVTKSCPHYFIPECNLLEHAHQDFLLDLARKVLEIRTHPDRYPKSPTK 439          
BLAST of Protein mab-21-like vs. Ensembl Nematostella
Match: EDO42711 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S0Q2])

HSP 1 Score: 75.8702 bits (185), Expect = 7.813e-15
Identity = 43/168 (25.60%), Postives = 75/168 (44.64%), Query Frame = 3
Query:  681 YTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRC---CLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLF 1175
            Y + + P   C  +WP+ AS        WP   L   +  +G +L +             S   D W + F   +  L+   G      CL ++K  CE  ++ S    +   +++ +L++   K+  DSDWT++NLP R   ++  L  C++N  C  +FL S++L 
Sbjct:  381 YVINLIPTIECPRLWPKCASWLKTCSRRWPSEKLKRKIVTQGIHLAAL----------PPSKNSDLWQIKFLNGQRALIHHEGNEAKAKCLRIVKVLCE--VDLSYPKAIRPQYLENILMWASRKYWSDSDWTEANLPARFLDLMAGLHKCMKNGDCHDFFLPSVNLL 536          
BLAST of Protein mab-21-like vs. Ensembl Medaka
Match: mab21l1 (mab-21 like 1 [Source:NCBI gene;Acc:101155620])

HSP 1 Score: 474.167 bits (1219), Expect = 8.803e-167
Identity = 230/362 (63.54%), Postives = 284/362 (78.45%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L ++ NK+  E+  SRK A +K +RE+ K+  D+LKEVE QEPRFISSL    S  +  +EGL V+SP +FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ DRY +Q+TPAF+C+G+WPRSA+HWPL  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL    R+ CLSVLK   +R L   G  P+ NYHMKTL+ YECEKHP +SDW ++ L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+P+SLEKL
Sbjct:    5 QAKLVYHLNKYYNEKCQSRKAAISKTIREVCKVVSDVLKEVEVQEPRFISSL----SEMDNRFEGLEVISPTEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRDRYVVQITPAFKCTGIWPRSAAHWPLPHIPWPGPNRVAEVKAEGFNLLSKECYSLNGK--QSSAESDAWVLQFAEAENRLLLGGCRKKCLSVLKALRDRHLELPG-QPLNNYHMKTLVSYECEKHPRESDWDENCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALENAAKQTWRLAREILTNPKSLEKL 359          
BLAST of Protein mab-21-like vs. Ensembl Medaka
Match: mab21l2 (mab-21 like 2 [Source:NCBI gene;Acc:101157187])

HSP 1 Score: 470.315 bits (1209), Expect = 2.572e-165
Identity = 228/362 (62.98%), Postives = 283/362 (78.18%), Query Frame = 3
Query:  186 QAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            QA+L +  NK+  E+  +RK A  K +RE+ K+  D+LKEVE QEPRFISSL    S  +  YEG+ V+SPN+FE++L+LNQMGVFNFVDDGS+PGC VLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQ+LVAQAV+   YRDVV+++AD++EVKLR+ +RY +Q+TPAF+C+G+WPRSA+ WP+  + WPG N   +VKAEGFNLLS+E   +  K   SSAE DAW+L F EAE RLL    R+ CLSVLKT  +R L   G  P+ NYHMKTLLLYECEKHP ++DW +S L DR+NGILLQLI CLQ RRCPHYFL +LDLF+GK  + L+ AAKQ W L R+++T+ +SL+KL
Sbjct:    5 QAKLVYQLNKYYNERCQARKAAIAKTIREVCKVVSDVLKEVEVQEPRFISSL----SEIDARYEGMEVISPNEFEVVLYLNQMGVFNFVDDGSLPGCAVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQTLVAQAVDKCSYRDVVKMVADTSEVKLRIRERYVVQITPAFKCTGIWPRSAAQWPMPHIPWPGPNRVAEVKAEGFNLLSKECYSLTGK--QSSAESDAWVLQFSEAENRLLMGGCRKKCLSVLKTLRDRHLELPG-QPLNNYHMKTLLLYECEKHPRETDWDESCLGDRLNGILLQLISCLQCRRCPHYFLPNLDLFQGKPHSALEAAAKQTWRLAREILTNAKSLDKL 359          
BLAST of Protein mab-21-like vs. Planmine SMEST
Match: SMESG000070861.1 (SMESG000070861.1)

HSP 1 Score: 825.083 bits (2130), Expect = 0.000e+0
Identity = 416/416 (100.00%), Postives = 416/416 (100.00%), Query Frame = 3
Query:   24 MYENSLPLTGYLSSINSCQTTQLLSSRSLDSQGXXXXXXXXXXXXXXXCVLTPHQAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 1271
            MYENSLPLTGYLSSINSCQTTQLLSSRSLDSQGSPSLSYPSPTTSYQSCVLTPHQAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL
Sbjct:    1 MYENSLPLTGYLSSINSCQTTQLLSSRSLDSQGSPSLSYPSPTTSYQSCVLTPHQAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEPRFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPGCGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYRDVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPGHNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSSIGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTDSNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVWALLRDLITSPRSLEKL 416          
The following BLAST results are available for this feature:
BLAST of Protein mab-21-like vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 4
Match NameE-valueIdentityDescription
MAB21L12.112e-16663.26mab-21 like 1 [Source:HGNC Symbol;Acc:HGNC:6757][more]
MAB21L22.633e-16563.54mab-21 like 2 [Source:HGNC Symbol;Acc:HGNC:6758][more]
MAB21L31.092e-1822.53mab-21 like 3 [Source:HGNC Symbol;Acc:HGNC:26787][more]
CGAS8.861e-1120.46cyclic GMP-AMP synthase [Source:HGNC Symbol;Acc:HG... [more]
back to top
BLAST of Protein mab-21-like vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
mab-214.096e-13553.01Protein male abnormal 21 [Source:UniProtKB/Swiss-... [more]
back to top
BLAST of Protein mab-21-like vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 2
Match NameE-valueIdentityDescription
CG47661.529e-16260.33gene:FBgn0027546 transcript:FBtr0070891[more]
mab-217.003e-16160.22gene:FBgn0029003 transcript:FBtr0070890[more]
back to top
BLAST of Protein mab-21-like vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
mab21l11.927e-16663.26mab-21-like 1 [Source:NCBI gene;Acc:246091][more]
mab21l29.187e-16662.98mab-21-like 2 [Source:NCBI gene;Acc:117234][more]
mab21l33.475e-1825.78mab-21-like 3 [Source:NCBI gene;Acc:558164][more]
mab21l34.010e-1825.78mab-21-like 3 [Source:NCBI gene;Acc:558164][more]
cgas1.231e-722.36cyclic GMP-AMP synthase [Source:ZFIN;Acc:ZDB-GENE-... [more]
back to top
BLAST of Protein mab-21-like vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 4
Match NameE-valueIdentityDescription
crtc36.724e-16663.26CREB regulated transcription coactivator 3 [Source... [more]
mab21l21.297e-16463.26mab-21-like 2 [Source:NCBI gene;Acc:100125071][more]
ttc221.096e-1623.71tetratricopeptide repeat domain 22 [Source:Xenbase... [more]
ttc222.507e-1623.71tetratricopeptide repeat domain 22 [Source:Xenbase... [more]
back to top
BLAST of Protein mab-21-like vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Mab21l11.450e-16663.26mab-21-like 1 [Source:MGI Symbol;Acc:MGI:1333773][more]
Mab21l23.481e-16563.26mab-21-like 2 [Source:MGI Symbol;Acc:MGI:1346022][more]
Mab21l31.599e-1722.56mab-21-like 3 [Source:MGI Symbol;Acc:MGI:2446273][more]
Mab21l31.599e-1722.56mab-21-like 3 [Source:MGI Symbol;Acc:MGI:2446273][more]
Cgas2.633e-1521.94cyclic GMP-AMP synthase [Source:MGI Symbol;Acc:MGI... [more]
back to top
BLAST of Protein mab-21-like vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|O70299|MB211_MOUSE1.014e-16563.26Putative nucleotidyltransferase MAB21L1 OS=Mus mus... [more]
sp|Q13394|MB211_HUMAN1.014e-16563.26Putative nucleotidyltransferase MAB21L1 OS=Homo sa... [more]
sp|Q8AY65|MB211_CHICK1.014e-16563.26Putative nucleotidyltransferase MAB21L1 OS=Gallus ... [more]
sp|A4FV14|MB211_BOVIN1.014e-16563.26Putative nucleotidyltransferase MAB21L1 OS=Bos tau... [more]
sp|Q6NYB4|MB211_DANRE1.455e-16563.26Putative nucleotidyltransferase MAB21L1 OS=Danio r... [more]
back to top
BLAST of Protein mab-21-like vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A1S3KBM71.374e-17065.47protein mab-21-like 2 isoform X1 OS=Lingula unguis... [more]
A0A0L8GZW13.157e-17064.09Mab-21 domain-containing protein OS=Octopus bimacu... [more]
K1R2P97.472e-17063.54Protein mab-21-like 2-B OS=Crassostrea gigas OX=29... [more]
V4AJF24.782e-16762.98Mab-21 domain-containing protein OS=Lottia gigante... [more]
A0A2C9JDZ21.833e-16663.54Mab-21 domain-containing protein OS=Biomphalaria g... [more]
back to top
BLAST of Protein mab-21-like vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
MAB21L12.010e-16663.26putative nucleotidyltransferase MAB21L1 [Source:NC... [more]
mab21l21.261e-16462.71mab-21 like 2 [Source:NCBI gene;Acc:103037944][more]
mab21l33.066e-1622.82mab-21 like 3 [Source:NCBI gene;Acc:103024440][more]
cgas9.707e-721.14cyclic GMP-AMP synthase [Source:NCBI gene;Acc:1030... [more]
mb21d22.539e-625.00Mab-21 domain containing 2 [Source:NCBI gene;Acc:1... [more]
back to top
BLAST of Protein mab-21-like vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000010941.13.910e-16662.98pep scaffold:Pmarinus_7.0:GL486525:1595:2674:-1 ge... [more]
ENSPMAT00000006356.11.985e-6940.86pep scaffold:Pmarinus_7.0:GL479339:17263:18667:-1 ... [more]
ENSPMAT00000006344.15.186e-6939.95pep scaffold:Pmarinus_7.0:GL479339:17263:18667:-1 ... [more]
ENSPMAT00000006197.17.433e-1023.01pep scaffold:Pmarinus_7.0:GL476624:333660:337604:-... [more]
back to top
BLAST of Protein mab-21-like vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Protein mab-21-like vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 5
Match NameE-valueIdentityDescription
EDO417568.115e-12051.28Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427264.721e-2225.23Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO419254.696e-1726.56Mab21-like protein; Predicted protein [Source:Uni... [more]
EDO407339.638e-1629.15Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO427117.813e-1525.60Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Protein mab-21-like vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 2
Match NameE-valueIdentityDescription
mab21l18.803e-16763.54mab-21 like 1 [Source:NCBI gene;Acc:101155620][more]
mab21l22.572e-16562.98mab-21 like 2 [Source:NCBI gene;Acc:101157187][more]
back to top
BLAST of Protein mab-21-like vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 1
Match NameE-valueIdentityDescription
SMESG000070861.10.000e+0100.00SMESG000070861.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023465 ID=SMED30023465|Name=Protein mab-21-like|organism=Schmidtea mediterranea sexual|type=transcript|length=1357bp
CTCTTGATTAAATTTAATAAAAAATGTATGAGAATTCTTTACCATTAACA
GGCTATCTTTCTTCAATAAATTCTTGTCAGACAACTCAGCTATTATCTTC
CAGATCATTAGATTCCCAAGGTTCACCTTCATTAAGTTATCCAAGTCCGA
CAACTAGCTATCAGTCGTGTGTTTTAACTCCACACCAAGCTCAACTTTGT
TTTTATTTTAATAAATTTAATCAAGAGCAAGTAATATCAAGAAAGAATGC
TACTAATAAAGTTGTTAGAGAAATGCTAAAGATAGCGGATGATATTTTAA
AAGAAGTGGAAAATCAAGAACCGAGATTCATTAGCAGCTTGAAATATGAT
GGATCAACGAGTAATGGAATCTATGAAGGATTGAGAGTTTTAAGTCCAAA
TGATTTTGAAATTATATTATTTTTAAATCAAATGGGAGTTTTCAATTTTG
TTGATGACGGCAGTGTACCAGGATGTGGGGTTTTAAAATTGAGTGATGGA
AGAAAACGATCCATGTCATTATGGGTTGAATTTATTACTGCATCAGGGTA
TTTATCGGCTAGAAAAATCCGATCTCGTTTTCAGAGTTTAGTTGCCCAAG
CAGTAGAAGCGAGTGGATATAGAGATGTTGTTCAATTAATTGCTGATTCC
ACAGAAGTGAAACTAAGAGTTCATGATCGCTATACTCTTCAAGTTACTCC
AGCTTTTAGATGCAGTGGAATGTGGCCTCGTTCTGCTTCACATTGGCCTT
TAGGTGGTCTTTCGTGGCCTGGGCATAATTTAGCTACAGATGTGAAGGCA
GAAGGATTTAATCTTTTAAGTAGAGAAACTGCTTACATGAGAGATAAACC
CGGATCAAGTTCGGCTGAAGGAGATGCTTGGTTATTAGATTTTTATGAAG
CCGAAGAGCGTCTACTTTCCAGTATTGGTAGAAGATGTTGCCTCAGTGTT
CTTAAAACGTTCTGCGAACGTTGTTTAAATTCCTCTGGGTCAAGTCCAGT
CACCAATTATCATATGAAAACCCTATTATTGTATGAATGTGAAAAGCATC
CTTTAGATTCAGATTGGACAGATTCGAATTTACCAGACCGCATCAATGGA
ATTCTATTGCAATTAATTTGTTGCTTACAAAATAGACGATGTCCTCATTA
TTTTCTAACATCATTGGATTTATTTCGAGGAAAATTGCCGGCAATTTTGG
ACCAAGCAGCAAAACAAGTTTGGGCATTGCTTAGAGACTTAATTACAAGT
CCAAGATCTTTAGAGAAACTGTAGAATTATTCTTTAATTGCGTCGAACAA
TTTGTAACTCACATTTGTTAATTTTATTTAAGATTATTTTGCAGTGTGAT
TTTGATG
back to top

protein sequence of SMED30023465-orf-1

>SMED30023465-orf-1 ID=SMED30023465-orf-1|Name=SMED30023465-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=417bp
MYENSLPLTGYLSSINSCQTTQLLSSRSLDSQGSPSLSYPSPTTSYQSCV
LTPHQAQLCFYFNKFNQEQVISRKNATNKVVREMLKIADDILKEVENQEP
RFISSLKYDGSTSNGIYEGLRVLSPNDFEIILFLNQMGVFNFVDDGSVPG
CGVLKLSDGRKRSMSLWVEFITASGYLSARKIRSRFQSLVAQAVEASGYR
DVVQLIADSTEVKLRVHDRYTLQVTPAFRCSGMWPRSASHWPLGGLSWPG
HNLATDVKAEGFNLLSRETAYMRDKPGSSSAEGDAWLLDFYEAEERLLSS
IGRRCCLSVLKTFCERCLNSSGSSPVTNYHMKTLLLYECEKHPLDSDWTD
SNLPDRINGILLQLICCLQNRRCPHYFLTSLDLFRGKLPAILDQAAKQVW
ALLRDLITSPRSLEKL*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: molecular function
TermDefinition
GO:0003674molecular_function
GO:0016714oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced pteridine as one donor, and incorporation of one atom of oxygen
GO:0000166nucleotide binding
GO:0016740transferase activity
GO:0016779nucleotidyltransferase activity
GO:0046872metal ion binding
Vocabulary: cellular component
TermDefinition
GO:0005575cellular_component
GO:0005634nucleus
Vocabulary: biological process
TermDefinition
GO:0008150biological_process
GO:0055114oxidation-reduction process
GO:0007275multicellular organism development
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
PLANA:0003104enteric muscle cell
Vocabulary: INTERPRO
TermDefinition
IPR024810Mab-21_dom
IPR019774Aromatic-AA_hydroxylase_C
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
IPR024810Mab-21 domainSMARTSM01265Mab_21_2coord: 115..404
e-value: 4.8E-82
score: 288.6
IPR024810Mab-21 domainPFAMPF03281Mab-21coord: 117..400
e-value: 2.1E-93
score: 312.9
NoneNo IPR availableGENE3DG3DSA:1.10.1410.40coord: 220..402
e-value: 8.4E-29
score: 102.4
NoneNo IPR availablePANTHERPTHR10656CELL FATE DETERMINING PROTEIN MAB21-RELATEDcoord: 54..416
NoneNo IPR availablePANTHERPTHR10656:SF38NUCLEOTIDYLTRANSFERASE MAB21L1-RELATEDcoord: 54..416