Synaptosomal-associated protein 25

Overview
NameSynaptosomal-associated protein 25
Smed IDSMED30023454
Length (bp)985
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of Synaptosomal-associated protein 25 (SMED30023454) t-SNE clustered cells

Violin plots show distribution of expression levels for Synaptosomal-associated protein 25 (SMED30023454) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of Synaptosomal-associated protein 25 (SMED30023454) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for Synaptosomal-associated protein 25 (SMED30023454) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023454

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 3

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
headSMED30023454SMESG000034754.1 SMESG000034721.1 SmedASXL_008829SmedAsxl_ww_GCZZ01PMID:27034770
Currie et al., 2016
whole organism asexual adult RNA-sequencing evidence
neuronSMED30023454SMESG000034754.1 SMESG000034721.1 dd_Smed_v4_13079_0_1dd_Smed_v4PMID:29674431
Fincher et al., 2018
whole organism asexual adult single-cell RNA-sequencing evidence
headSMED30023454SMESG000034754.1 SMESG000034721.1 dd_Smed_v6_13079_0_1dd_Smed_v6PMID:28171748
Stückemann et al., 2017
whole organism asexual adult RNA-sequencing evidence
Note: Hover over icons to view figure legend
Homology
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Human
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 201.445 bits (511), Expect = 1.854e-63
Identity = 107/206 (51.94%), Postives = 150/206 (72.82%), Query Frame = 1
Query:  217 ENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            E+ D+R   E E +Q +      ++L+STRRML L EE+K++G++TLVMLD+QGEQLDR+ EG++ IN+DMK+AEKNL DL KCCGL I P  K    + SD Y+K W  ++DG       R+V ++     +GG+I R+TND  ENE+D+NL++V+G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:    3 EDADMR--NELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNK---LKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 203          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Human
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 201.06 bits (510), Expect = 2.737e-63
Identity = 107/206 (51.94%), Postives = 151/206 (73.30%), Query Frame = 1
Query:  217 ENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            E+ D+R   E E +Q +      ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMK+AEKNL DL K CGLC+ P  K    + SD Y+K W  ++DG       R+V ++     +GG+I R+TND  ENE+D+NL++V+G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:    3 EDADMR--NELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNK---LKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 203          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Human
Match: SNAP23 (synaptosome associated protein 23 [Source:HGNC Symbol;Acc:HGNC:11131])

HSP 1 Score: 165.236 bits (417), Expect = 3.032e-49
Identity = 94/204 (46.08%), Postives = 136/204 (66.67%), Query Frame = 1
Query:  247 SEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTW-KGDEDGKDNGAS--PRIVVDQNGSGPT-----GGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            SE IQ +    T ++L+STRR+L L  E++++G++T+ MLD+Q EQL+RI EGLD+IN+DM++ EK L +LNKCCGLC+ P  +  NF+    Y+ TW  G E+   N  S  P  V +     PT     GGYI RITND  E+E+++NL +V  ++GNL++MA+++G+EI  QN QI +I  KA  N +RI  AN +A KL+
Sbjct:    6 SEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNRTKNFESGKAYKTTWGDGGENSPCNVVSKQPGPVTNGQLQQPTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLI 209          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Human
Match: SNAP23 (synaptosome associated protein 23 [Source:HGNC Symbol;Acc:HGNC:11131])

HSP 1 Score: 127.102 bits (318), Expect = 3.283e-35
Identity = 75/195 (38.46%), Postives = 113/195 (57.95%), Query Frame = 1
Query:  247 SEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            SE IQ +    T ++L+STRR+L L  E++++G++T+ MLD+Q EQL+RI EGLD+IN+DM++ EK L +LNKCCGLC+ P   +T                                            ND  E+E+++NL +V  ++GNL++MA+++G+EI  QN QI +I  KA  N +RI  AN +A KL+
Sbjct:    6 SEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNSIT--------------------------------------------NDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLI 156          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Human
Match: SNAP23 (synaptosome associated protein 23 [Source:HGNC Symbol;Acc:HGNC:11131])

HSP 1 Score: 127.102 bits (318), Expect = 3.283e-35
Identity = 75/195 (38.46%), Postives = 113/195 (57.95%), Query Frame = 1
Query:  247 SEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            SE IQ +    T ++L+STRR+L L  E++++G++T+ MLD+Q EQL+RI EGLD+IN+DM++ EK L +LNKCCGLC+ P   +T                                            ND  E+E+++NL +V  ++GNL++MA+++G+EI  QN QI +I  KA  N +RI  AN +A KL+
Sbjct:    6 SEEIQQRAHQITDESLESTRRILGLAIESQDAGIKTITMLDEQKEQLNRIEEGLDQINKDMRETEKTLTELNKCCGLCVCPCNSIT--------------------------------------------NDAREDEMEENLTQVGSILGNLKDMALNIGNEIDAQNPQIKRITDKADTNRDRIDIANARAKKLI 156          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Celegans
Match: ric-4 (Synaptosomal-associated protein [Source:UniProtKB/TrEMBL;Acc:A5PEW5])

HSP 1 Score: 224.172 bits (570), Expect = 1.090e-72
Identity = 105/194 (54.12%), Postives = 145/194 (74.74%), Query Frame = 1
Query:  250 EIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            E I  ++   T  +L+STRRML LCEE+KE+G++TLVMLDDQGEQL+R    LD IN+DMK+AE +L  + KCCGLC++PW K  +F+K+++ K WK D+DG      PRI V  +  GP GGYIT+ITND  E+E+D+N+Q+V+ M+GNLRNMAIDM +E++ QN+Q+D+I  KAQ NE R++ AN +A  L+
Sbjct:   12 EAINLKMNATTDDSLESTRRMLALCEESKEAGIKTLVMLDDQGEQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWNKTDDFEKTEFAKAWKKDDDGGVISDQPRITVGDSSMGPQGGYITKITNDAREDEMDENVQQVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVRVESANKRAKNLI 205          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Celegans
Match: ric-4 (Synaptosomal-associated protein [Source:UniProtKB/TrEMBL;Acc:A5PEW5])

HSP 1 Score: 224.557 bits (571), Expect = 1.569e-72
Identity = 103/184 (55.98%), Postives = 142/184 (77.17%), Query Frame = 1
Query:  280 TTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            T ++L+STRRML LCEE+KE+G++TLVMLDDQGEQL+R    LD IN+DMK+AE +L  + KCCGLC++PW K  +F+K+++ K WK D+DG      PRI V  +  GP GGYIT+ITND  E+E+D+N+Q+V+ M+GNLRNMAIDM +E++ QN+Q+D+I  KAQ NE R++ AN +A  L+
Sbjct:   49 TIESLESTRRMLALCEESKEAGIKTLVMLDDQGEQLERCEGALDTINQDMKEAEDHLKGMEKCCGLCVLPWNKTDDFEKTEFAKAWKKDDDGGVISDQPRITVGDSSMGPQGGYITKITNDAREDEMDENVQQVSTMVGNLRNMAIDMSTEVSNQNRQLDRIHDKAQSNEVRVESANKRAKNLI 232          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Celegans
Match: aex-4 (t-SNARE protein aex-4 [Source:UniProtKB/Swiss-Prot;Acc:G5EEN8])

HSP 1 Score: 65.4698 bits (158), Expect = 3.037e-12
Identity = 50/196 (25.51%), Postives = 101/196 (51.53%), Query Frame = 1
Query:  283 TQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDL-NKC-CGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRI--------VVDQNGSG---PTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
             Q+LDS+ +M+   ++     +QT   L+DQ EQLD+I   L  + +D+     N+  + + C CG   +  A    F+K + +      E+  +   SP++        ++  N S     TG ++ R+T D  E+E+++NL ++   + +++N+A+DM  ++  Q  ++++I    + N+  ++  ND+  KLL
Sbjct:   41 VQSLDSSIQMIRDIDQMNVDAVQTTAALEDQDEQLDKIEANLSNVIDDLNVVSHNITAMEHYCGCGFFRILRAPFKYFRKRERDII---KEEVLEKMTSPKLRRKEESNMMMFTNSSKRRESTGDFMKRLTCDAIEDELERNLMQIDQGLESVKNLAVDMHVQLKLQEPKLNRIEELTETNDFVVEGVNDKVKKLL 233          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Celegans
Match: snap-29 (Soluble NSF attachment protein 29 [Source:UniProtKB/Swiss-Prot;Acc:P83351])

HSP 1 Score: 55.8398 bits (133), Expect = 9.042e-9
Identity = 59/250 (23.60%), Postives = 107/250 (42.80%), Query Frame = 1
Query:  136 FSRNRFQF*KMPKKETERSLLPNEIRLENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIM---------PWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTG---------GYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
             SRN F     P   +  S +P +     G      E++  + +I+    ++LDST R     E +++ G  T   L +Q E+L+   + LD+I+   +  ++NL+ L    G             P    T  Q     +  +   +    G S         SGP+G           I     +  +N+ID+NL  ++  + NL+ +  D+G E+  QN+ +D+I +KA+ N+  ++  + Q  K+L
Sbjct:    1 MSRNPFDDDYRPSAAS--STMPVKSYTTMGHYSGEDEADYYEREIEKTLQESLDSTERSRRHLENSEKIGTSTAQQLLEQREKLENTEKNLDEIHRTTQMTQRNLNSLKSFFGGMFKNKFTKKPQEPTETPTVPQSKSASRLSETATNLSSGGGSATF------SGPSGQRTLTESSRSAIKGTRWEAMDNQIDENLDMMSANLRNLQRLGADLGKEVDSQNEMLDRIQYKAERNDGIVRDQDKQMQKIL 242          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Fly
Match: Snap25 (gene:FBgn0011288 transcript:FBtr0111143)

HSP 1 Score: 212.231 bits (539), Expect = 6.979e-68
Identity = 109/201 (54.23%), Postives = 147/201 (73.13%), Query Frame = 1
Query:  235 PMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASP-RIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            P TE E +Q   +    ++L+STRRML LCEE+KE+G++TLV LDDQGEQLDRI EG+D+IN DM++AEKNL  + KCCG+C++P  K  +F++ D   TWKG++DGK     P R++ D+NG     GYI RITND  E+E+++N+ +V  MIGNLRNMA+DMGSE+  QN+QID+I  K + NE RI  AN +A +LLK
Sbjct:   14 PKTELEELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQSFKEDD--GTWKGNDDGKVVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQRAHQLLK 212          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Fly
Match: Snap25 (gene:FBgn0011288 transcript:FBtr0304625)

HSP 1 Score: 207.608 bits (527), Expect = 3.808e-66
Identity = 106/201 (52.74%), Postives = 146/201 (72.64%), Query Frame = 1
Query:  235 PMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASP-RIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            P TE E +Q   +    ++L+STRRML LCEE+ E G++++VMLD+QGEQLDRI EG+D+IN DM++AEKNL  + KCCG+C++P  K  +F++ D   TWKG++DGK     P R++ D+NG     GYI RITND  E+E+++N+ +V  MIGNLRNMA+DMGSE+  QN+QID+I  K + NE RI  AN +A +LLK
Sbjct:   14 PKTELEELQINAQGVADESLESTRRMLALCEESAEVGMRSIVMLDEQGEQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQSFKEDD--GTWKGNDDGKVVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQRAHQLLK 212          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Fly
Match: Snap24 (gene:FBgn0266720 transcript:FBtr0082163)

HSP 1 Score: 206.068 bits (523), Expect = 1.524e-65
Identity = 104/205 (50.73%), Postives = 142/205 (69.27%), Query Frame = 1
Query:  235 PMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQN-----GSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            P TE + +Q +      ++L+STRRML L +E+KE+G++TLV LDDQGEQLDRI EG+D+IN DM++AEKNL  + KCCG+C++PW KV    K D E  WK ++DGK   + P+ V+D+      G+ P  GY+ RITND  E+E+D+NL +V  M+GNLRNMA+DMGSE+  QNKQ+D+I  K   N  R+   N +A  LLK
Sbjct:    9 PRTELQELQFKSGQVADESLESTRRMLALMDESKEAGIRTLVALDDQGEQLDRIEEGMDRINADMREAEKNLSGMEKCCGICVLPWKKVN--IKDDGESAWKANDDGKIVASQPQRVIDERERGGMGAPPQSGYVARITNDAREDEMDENLGQVNSMLGNLRNMALDMGSELENQNKQVDRINAKGDANNIRMDGVNKRANNLLK 211          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Fly
Match: Snap29 (gene:FBgn0034913 transcript:FBtr0072236)

HSP 1 Score: 66.6254 bits (161), Expect = 3.277e-12
Identity = 60/211 (28.44%), Postives = 95/211 (45.02%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKS--DYEKTWKGDEDGKDN--------------GASPRIV-----------VDQNGSGPTGGY-ITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            +TLDST + L L  E +E G  T V L  Q EQL++ +  LD+I+  ++ ++++L  L    G        + N+     D   T  G   G  +              GASP              V Q    P+  Y   R   + F+ +ID NL+E+   +  L+ +A D+G EI  QN+ +D + +K +  + +I K N   +KLLK
Sbjct:   80 RTLDSTNKSLGLLYETQEVGKATAVELAKQREQLEKTSHQLDEISSTLRFSQRHLTGLKSVFG-------GLKNYLSGNRDQPPTATGSPTGSQSSQEANSNINQGACGGASPSAPLSPAERYDNHPVSQLRGDPSSTYQPQRQAANPFQAQIDSNLEEMCSNLSVLKMLATDLGGEIESQNELLDNMNYKIEDVDLKIHKQNKDMSKLLK 283          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Zebrafish
Match: snap25a (synaptosome associated protein 25a [Source:NCBI gene;Acc:30712])

HSP 1 Score: 196.438 bits (498), Expect = 9.884e-62
Identity = 100/182 (54.95%), Postives = 138/182 (75.82%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMKDAEKNL+DL K CGLC  P  K+    KS   K W  ++DG       R+V ++     +GG+I R+T+D  ENE+D+NL++V G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:   24 ESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKM----KSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 201          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Zebrafish
Match: snap25a (synaptosome associated protein 25a [Source:NCBI gene;Acc:30712])

HSP 1 Score: 194.512 bits (493), Expect = 5.461e-61
Identity = 98/182 (53.85%), Postives = 137/182 (75.27%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            ++L+STRRML L EE+K++G++TLVMLD+QGEQLDR+ +G++ IN+DMK+AEKNL DL KCCGL I P  K+    KS   K W  ++DG       R+V ++     +GG+I R+T+D  ENE+D+NL++V G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:   24 ESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEDGMNHINQDMKEAEKNLKDLGKCCGLFICPCNKM----KSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 201          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Zebrafish
Match: zgc:101731 (zgc:101731 [Source:ZFIN;Acc:ZDB-GENE-040912-57])

HSP 1 Score: 193.741 bits (491), Expect = 1.159e-60
Identity = 101/199 (50.75%), Postives = 145/199 (72.86%), Query Frame = 1
Query:  241 TESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKS-DYEKTWKGDEDG-KDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            +E E +Q +    T ++L+ TR M  L EE+K++G++TLVMLD+QGEQLDRI EGLD+IN+DMK+AEKNL D+  CCGLCI P  K+ +F+ S  Y+K W  ++DG   +  S R+V ++     +GGYI R+TND  E+E+++NL +V  ++GNLR+MA+DMG+EI  QN QI++I  KA +NE RI +AN +ATKL+
Sbjct:    9 SEVEELQKKANQMTDESLEVTRNMKLLLEESKDAGIRTLVMLDEQGEQLDRIEEGLDQINKDMKEAEKNLTDMAMCCGLCIWPCTKLKDFEASGAYKKVWGNNQDGVVSSQPSSRVVDEREKMTMSGGYIRRVTNDAREDEMEENLAQVGSILGNLRSMALDMGNEIDTQNVQIERIQSKAVVNESRINEANQRATKLI 207          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Zebrafish
Match: zgc:101731 (zgc:101731 [Source:ZFIN;Acc:ZDB-GENE-040912-57])

HSP 1 Score: 193.741 bits (491), Expect = 1.159e-60
Identity = 101/199 (50.75%), Postives = 145/199 (72.86%), Query Frame = 1
Query:  241 TESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKS-DYEKTWKGDEDG-KDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            +E E +Q +    T ++L+ TR M  L EE+K++G++TLVMLD+QGEQLDRI EGLD+IN+DMK+AEKNL D+  CCGLCI P  K+ +F+ S  Y+K W  ++DG   +  S R+V ++     +GGYI R+TND  E+E+++NL +V  ++GNLR+MA+DMG+EI  QN QI++I  KA +NE RI +AN +ATKL+
Sbjct:    9 SEVEELQKKANQMTDESLEVTRNMKLLLEESKDAGIRTLVMLDEQGEQLDRIEEGLDQINKDMKEAEKNLTDMAMCCGLCIWPCTKLKDFEASGAYKKVWGNNQDGVVSSQPSSRVVDEREKMTMSGGYIRRVTNDAREDEMEENLAQVGSILGNLRSMALDMGNEIDTQNVQIERIQSKAVVNESRINEANQRATKLI 207          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Zebrafish
Match: snap25b (synaptosome associated protein 25b [Source:NCBI gene;Acc:30711])

HSP 1 Score: 184.111 bits (466), Expect = 6.481e-57
Identity = 95/182 (52.20%), Postives = 134/182 (73.63%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMK+AEKNL DL   CGLC  P  K+    +S     W  ++DG  +    R+V ++     +GG+I R+TND  ENE+D+NL++V  +IGNLR+MA+DMG+EI  QN+QID+IM  A  N+ RI +AN +ATK+L
Sbjct:   24 ESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLKGGGQS-----WGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQRATKML 200          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Xenopus
Match: snap25 (synaptosome associated protein 25kDa [Source:NCBI gene;Acc:549255])

HSP 1 Score: 191.815 bits (486), Expect = 8.206e-60
Identity = 96/183 (52.46%), Postives = 137/183 (74.86%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            ++L+STRRML   E +K++G++TLVMLD+QGEQL+RI EG+++IN+DMK+AEKNL DL K CGLC+ P  K    + SD Y+K W  ++DG       R+V ++     +GG++ R+TND  E E+D+NL++V+G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN  ATK+L
Sbjct:   24 ESLESTRRMLQYVEGSKDAGIRTLVMLDEQGEQLERIEEGMEQINKDMKEAEKNLTDLGKFCGLCVCPCNK---LKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFVRRVTNDARETEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKARIDEANKHATKML 203          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Xenopus
Match: snap25 (synaptosome associated protein 25kDa [Source:NCBI gene;Acc:549255])

HSP 1 Score: 182.185 bits (461), Expect = 3.890e-56
Identity = 92/177 (51.98%), Postives = 131/177 (74.01%), Query Frame = 1
Query:  304 RRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            RR   L +E+K++G++TLVMLD+QGEQL+RI EG+++IN+DMK+AEKNL DL K CGLC+ P  K    + SD Y+K W  ++DG       R+V ++     +GG++ R+TND  E E+D+NL++V+G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN  ATK+L
Sbjct:   16 RRADQLADESKDAGIRTLVMLDEQGEQLERIEEGMEQINKDMKEAEKNLTDLGKFCGLCVCPCNK---LKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFVRRVTNDARETEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKARIDEANKHATKML 189          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Xenopus
Match: znf462 (zinc finger protein 462 [Source:Xenbase;Acc:XB-GENE-976911])

HSP 1 Score: 179.104 bits (453), Expect = 9.515e-55
Identity = 98/205 (47.80%), Postives = 144/205 (70.24%), Query Frame = 1
Query:  238 MTESEIIQDQIKIG--TTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGAS--PRIVVDQNGS-GPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            MT  EI   Q+K    T  +L+STRRML L  E++++G++T+ MLD+QGEQL+RI EG+D+IN+DM++AEKNL +LNKCCGLC+ P  +  +F+  + Y+KTW   ++  +N  S  P     Q G    +G YI RIT D+ E+E+D+NL +V  ++GNL+NMAIDMG+E+   N+QID+I  KA+ N+ RI +AN +A KL++
Sbjct:   12 MTPEEI---QLKANQVTDDSLESTRRMLNLALESQDTGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKNLTELNKCCGLCVCPGKRPKDFESGENYKKTWGSKDNDSENVISKQPHQTNGQQGGVAQSGPYIKRITGDDREDEMDENLTQVGSILGNLKNMAIDMGNELESHNQQIDRINEKAETNKTRIDEANTRAKKLIE 213          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Xenopus
Match: ENSXETT00000028688.1 (synaptosomal-associated protein 25-like [Source:NCBI gene;Acc:100491227])

HSP 1 Score: 143.665 bits (361), Expect = 8.579e-41
Identity = 73/151 (48.34%), Postives = 102/151 (67.55%), Query Frame = 1
Query:  382 QLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            QLDRI+EGLD IN+DM++AEKNL D+ KCCGLC     K +    + Y   W    DG  +    R+  ++     +GGYI R+TND  E+E++ NL +V  ++GNLR+MA+D+G+EI  QNKQ++KIM K + NE+RIK AN +A K+LK
Sbjct:   78 QLDRIDEGLDHINQDMREAEKNLTDMGKCCGLCSCHRLKCS----ATYRAVWGNSHDGIISAQPSRVADEREQMMMSGGYIRRVTNDAREDEMEDNLAQVGSILGNLRSMALDVGNEIDIQNKQVEKIMEKVKANEDRIKDANTKAKKILK 224          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Xenopus
Match: ENSXETT00000012397.1 (synaptosomal-associated protein 25-like [Source:NCBI gene;Acc:100491227])

HSP 1 Score: 140.584 bits (353), Expect = 4.096e-40
Identity = 74/152 (48.68%), Postives = 102/152 (67.11%), Query Frame = 1
Query:  379 EQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            EQLDRI+EGLD IN+DM++AEKNL D+ KCCGLC     K +    + Y   W    DG  +    R+  ++     +GGYI R+TND  E+E++ NL +V  ++GNLR+MA+D+G+EI  QNKQ++KIM K   NE+RIK AN +A K+LK
Sbjct:   37 EQLDRIDEGLDHINQDMREAEKNLTDMGKCCGLCSCHRLKCS----ATYRAVWGNSHDGIISAQPSRVADEREQMMMSGGYIRRVTNDAREDEMEDNLAQVGSILGNLRSMALDVGNEIDIQNKQVEKIMEKVT-NEDRIKDANTKAKKILK 183          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Mouse
Match: Snap25 (synaptosomal-associated protein 25 [Source:MGI Symbol;Acc:MGI:98331])

HSP 1 Score: 201.445 bits (511), Expect = 1.273e-63
Identity = 107/206 (51.94%), Postives = 150/206 (72.82%), Query Frame = 1
Query:  217 ENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            E+ D+R   E E +Q +      ++L+STRRML L EE+K++G++TLVMLD+QGEQLDR+ EG++ IN+DMK+AEKNL DL KCCGL I P  K    + SD Y+K W  ++DG       R+V ++     +GG+I R+TND  ENE+D+NL++V+G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:    3 EDADMR--NELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEEGMNHINQDMKEAEKNLKDLGKCCGLFICPCNK---LKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 203          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Mouse
Match: Snap25 (synaptosomal-associated protein 25 [Source:MGI Symbol;Acc:MGI:98331])

HSP 1 Score: 201.06 bits (510), Expect = 1.879e-63
Identity = 107/206 (51.94%), Postives = 151/206 (73.30%), Query Frame = 1
Query:  217 ENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            E+ D+R   E E +Q +      ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMK+AEKNL DL K CGLC+ P  K    + SD Y+K W  ++DG       R+V ++     +GG+I R+TND  ENE+D+NL++V+G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:    3 EDADMR--NELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNK---LKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 203          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Mouse
Match: Snap23 (synaptosomal-associated protein 23 [Source:MGI Symbol;Acc:MGI:109356])

HSP 1 Score: 178.718 bits (452), Expect = 1.228e-54
Identity = 97/197 (49.24%), Postives = 136/197 (69.04%), Query Frame = 1
Query:  280 TTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKS-DYEKTWKGDEDGKDNGASPRIVVDQNGS------------GPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            T ++L+STRR+L L  E++++G++T+ MLD+QGEQL+RI EG+D+IN+DM++AEK L +LNKCCGLCI P  +  NF+   +Y+ TW    DG DN  SP  VV +  S              +GGYI RITND  E+E+++NL +V  ++GNL+NMA+DMG+EI  QN+QI KI  KA  N+ RI  AN +A KL+
Sbjct:   17 TDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRTKNFESGKNYKATWG---DGGDN--SPSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLI 208          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Mouse
Match: Snap23 (synaptosomal-associated protein 23 [Source:MGI Symbol;Acc:MGI:109356])

HSP 1 Score: 178.718 bits (452), Expect = 1.228e-54
Identity = 97/197 (49.24%), Postives = 136/197 (69.04%), Query Frame = 1
Query:  280 TTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKS-DYEKTWKGDEDGKDNGASPRIVVDQNGS------------GPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            T ++L+STRR+L L  E++++G++T+ MLD+QGEQL+RI EG+D+IN+DM++AEK L +LNKCCGLCI P  +  NF+   +Y+ TW    DG DN  SP  VV +  S              +GGYI RITND  E+E+++NL +V  ++GNL+NMA+DMG+EI  QN+QI KI  KA  N+ RI  AN +A KL+
Sbjct:   17 TDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRTKNFESGKNYKATWG---DGGDN--SPSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLI 208          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Mouse
Match: Snap23 (synaptosomal-associated protein 23 [Source:MGI Symbol;Acc:MGI:109356])

HSP 1 Score: 170.629 bits (431), Expect = 2.022e-51
Identity = 97/208 (46.63%), Postives = 137/208 (65.87%), Query Frame = 1
Query:  280 TTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVT-----------NFQKS-DYEKTWKGDEDGKDNGASPRIVVDQNGS------------GPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            T ++L+STRR+L L  E++++G++T+ MLD+QGEQL+RI EG+D+IN+DM++AEK L +LNKCCGLCI P  + +           NF+   +Y+ TW    DG DN  SP  VV +  S              +GGYI RITND  E+E+++NL +V  ++GNL+NMA+DMG+EI  QN+QI KI  KA  N+ RI  AN +A KL+
Sbjct:   17 TDESLESTRRILGLAIESQDAGIKTITMLDEQGEQLNRIEEGMDQINKDMREAEKTLTELNKCCGLCICPCNRFSVGDCFFETRTKNFESGKNYKATWG---DGGDN--SPSNVVSKQPSRITNGQPQQTTGAASGGYIKRITNDAREDEMEENLTQVGSILGNLKNMALDMGNEIDAQNQQIQKITEKADTNKNRIDIANTRAKKLI 219          
BLAST of Synaptosomal-associated protein 25 vs. UniProt/SwissProt
Match: sp|P36975|SNP25_DROME (Synaptosomal-associated protein 25 OS=Drosophila melanogaster OX=7227 GN=Snap25 PE=2 SV=1)

HSP 1 Score: 212.231 bits (539), Expect = 6.996e-67
Identity = 109/201 (54.23%), Postives = 147/201 (73.13%), Query Frame = 1
Query:  235 PMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASP-RIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            P TE E +Q   +    ++L+STRRML LCEE+KE+G++TLV LDDQGEQLDRI EG+D+IN DM++AEKNL  + KCCG+C++P  K  +F++ D   TWKG++DGK     P R++ D+NG     GYI RITND  E+E+++N+ +V  MIGNLRNMA+DMGSE+  QN+QID+I  K + NE RI  AN +A +LLK
Sbjct:   14 PKTELEELQINAQGVADESLESTRRMLALCEESKEAGIRTLVALDDQGEQLDRIEEGMDQINADMREAEKNLSGMEKCCGICVLPCNKSQSFKEDD--GTWKGNDDGKVVNNQPQRVMDDRNGMMAQAGYIGRITNDAREDEMEENMGQVNTMIGNLRNMALDMGSELENQNRQIDRINRKGESNEARIAVANQRAHQLLK 212          
BLAST of Synaptosomal-associated protein 25 vs. UniProt/SwissProt
Match: sp|P36976|SNP25_TORMA (Synaptosomal-associated protein 25 OS=Torpedo marmorata OX=7788 GN=snap25 PE=2 SV=1)

HSP 1 Score: 203.756 bits (517), Expect = 1.379e-63
Identity = 106/203 (52.22%), Postives = 146/203 (71.92%), Query Frame = 1
Query:  235 PMTESEIIQ---DQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQK-SDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            P +E E +Q   DQI   T ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMK+AEKNL DL KCCGLC  P  K+ NF+    Y+K W  ++DG       R++ D+     +GGYI RIT+D  ENE+++NL +V  +IGNLR+MA+DM +EI  QN QID+I+ K  +N+ RI +AN  ATK+L
Sbjct:   11 PRSEQEEMQRCADQI---TDESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLSDLGKCCGLCSCPCNKLKNFEAGGAYKKVWGNNQDGVVASQPARVMDDREQMAMSGGYIRRITDDARENEMEENLDQVGSIIGNLRHMALDMSNEIGSQNAQIDRIVVKGDMNKARIDEANKHATKML 210          
BLAST of Synaptosomal-associated protein 25 vs. UniProt/SwissProt
Match: sp|P60881|SNP25_RAT (Synaptosomal-associated protein 25 OS=Rattus norvegicus OX=10116 GN=Snap25 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.315e-62
Identity = 107/206 (51.94%), Postives = 151/206 (73.30%), Query Frame = 1
Query:  217 ENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            E+ D+R   E E +Q +      ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMK+AEKNL DL K CGLC+ P  K    + SD Y+K W  ++DG       R+V ++     +GG+I R+TND  ENE+D+NL++V+G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:    3 EDADMR--NELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNK---LKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 203          
BLAST of Synaptosomal-associated protein 25 vs. UniProt/SwissProt
Match: sp|Q5R1X1|SNP25_PANTR (Synaptosomal-associated protein 25 OS=Pan troglodytes OX=9598 GN=SNAP25 PE=2 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.315e-62
Identity = 107/206 (51.94%), Postives = 151/206 (73.30%), Query Frame = 1
Query:  217 ENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            E+ D+R   E E +Q +      ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMK+AEKNL DL K CGLC+ P  K    + SD Y+K W  ++DG       R+V ++     +GG+I R+TND  ENE+D+NL++V+G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:    3 EDADMR--NELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNK---LKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 203          
BLAST of Synaptosomal-associated protein 25 vs. UniProt/SwissProt
Match: sp|P60879|SNP25_MOUSE (Synaptosomal-associated protein 25 OS=Mus musculus OX=10090 GN=Snap25 PE=1 SV=1)

HSP 1 Score: 201.06 bits (510), Expect = 1.315e-62
Identity = 107/206 (51.94%), Postives = 151/206 (73.30%), Query Frame = 1
Query:  217 ENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            E+ D+R   E E +Q +      ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMK+AEKNL DL K CGLC+ P  K    + SD Y+K W  ++DG       R+V ++     +GG+I R+TND  ENE+D+NL++V+G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:    3 EDADMR--NELEEMQRRADQLADESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGKFCGLCVCPCNK---LKSSDAYKKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVSGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 203          
BLAST of Synaptosomal-associated protein 25 vs. TrEMBL
Match: A0A075A4G5 (Synaptosomal-associated protein OS=Opisthorchis viverrini OX=6198 GN=T265_00107 PE=3 SV=1)

HSP 1 Score: 301.597 bits (771), Expect = 4.320e-99
Identity = 154/244 (63.11%), Postives = 188/244 (77.05%), Query Frame = 1
Query:  112 FSEFSLVKFSRNRFQF*KMPKKETERSLLP---NEIRLENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
             +EF  +KF  N          +T   L P   +EIRLE+G +RPMTE E++  +I   T ++L+++RRM+ +CEEAKE+G+ TLVMLDDQGEQLDRINEG+D+IN+DMKDAEKNLDDLNKCCGLC++PW KV   +K DY K  K DED +  G  PRI+VDQNG GPTGGYITRITND  E+E+D NLQEV+GMIGNLRNMAIDMGSEI QQN QI++I  KA+ N ERIKKAN+QA+KLLK
Sbjct:    8 MTEFEQIKFRMN----------QTTDELPPCNDDEIRLEDGTVRPMTEVELLHKRIDDATAESLEASRRMMAMCEEAKEAGISTLVMLDDQGEQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWNKVK--KKDDYTKQLK-DEDMRGGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDNNLQEVSGMIGNLRNMAIDMGSEINQQNVQIERIQIKAKSNAERIKKANEQASKLLK 238          
BLAST of Synaptosomal-associated protein 25 vs. TrEMBL
Match: A0A4E0QZ56 (Synaptosomal-associated protein OS=Fasciola hepatica OX=6192 GN=D915_006702 PE=3 SV=1)

HSP 1 Score: 299.671 bits (766), Expect = 1.202e-98
Identity = 149/225 (66.22%), Postives = 183/225 (81.33%), Query Frame = 1
Query:  166 MPKKETERSLL--PNEIRLENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            MP+K +    L  P+E+RL++G IRPMTE E++  +I     ++L+++RRM+ LCEEAKE+G+ TLVMLDDQGEQLDRINEG+D+IN+DMKDAEKNLDDLNKCCGLC++PW KV   +K DY K  K DED +  G  PRI+VDQNG GPTGGYITRITND  E+E+D NLQEV+GMIGNLRNMAIDMGSEI QQN Q+++I  KA+ N ERIKKAN+QA+KLLK
Sbjct:    1 MPRKLSRNLPLFGPDEVRLDDGTIRPMTEVELLHRKIDETAAESLEASRRMMALCEEAKEAGISTLVMLDDQGEQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWKKVK--KKDDYTKQLK-DEDMRGGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDNNLQEVSGMIGNLRNMAIDMGSEINQQNAQVERIQIKARSNAERIKKANEQASKLLK 222          
BLAST of Synaptosomal-associated protein 25 vs. TrEMBL
Match: A0A1S8X1C4 (Synaptosomal-associated protein (Fragment) OS=Opisthorchis viverrini OX=6198 GN=X801_03603 PE=3 SV=1)

HSP 1 Score: 300.442 bits (768), Expect = 2.035e-98
Identity = 151/227 (66.52%), Postives = 185/227 (81.50%), Query Frame = 1
Query:  166 MPKKETERSLLP----NEIRLENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            MP+K + +  LP    +EIRLE+G +RPMTE E++  +I   T ++L+++RRM+ +CEEAKE+G+ TLVMLDDQGEQLDRINEG+D+IN+DMKDAEKNLDDLNKCCGLC++PW KV   +K DY K  K DED +  G  PRI+VDQNG GPTGGYITRITND  E+E+D NLQEV+GMIGNLRNMAIDMGSEI QQN QI++I  KA+ N ERIKKAN+QA+KLLK
Sbjct:    1 MPRKPSYQ--LPPCNDDEIRLEDGTVRPMTEVELLHKRIDDATAESLEASRRMMAMCEEAKEAGISTLVMLDDQGEQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWNKVK--KKDDYTKQLK-DEDMRGGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDNNLQEVSGMIGNLRNMAIDMGSEINQQNVQIERIQIKAKSNAERIKKANEQASKLLK 222          
BLAST of Synaptosomal-associated protein 25 vs. TrEMBL
Match: A0A4S2LL36 (Synaptosomal-associated protein OS=Opisthorchis felineus OX=147828 GN=CRM22_006402 PE=3 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 2.696e-98
Identity = 151/227 (66.52%), Postives = 185/227 (81.50%), Query Frame = 1
Query:  166 MPKKETERSLLP----NEIRLENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            MP+K + +  LP    +EIRLE+G +RPMTE E++  +I   T ++L+++RRM+ +CEEAKE+G+ TLVMLDDQGEQLDRINEG+D+IN+DMKDAEKNLDDLNKCCGLC++PW KV   +K DY K  K DED +  G  PRI+VDQNG GPTGGYITRITND  E+E+D NLQEV+GMIGNLRNMAIDMGSEI QQN QI++I  KA+ N ERIKKAN+QA+KLLK
Sbjct:    1 MPRKSSYQ--LPPCNDDEIRLEDGTVRPMTEVELLHKRIDDSTAESLEASRRMMAMCEEAKEAGISTLVMLDDQGEQLDRINEGMDQINQDMKDAEKNLDDLNKCCGLCVLPWNKVK--KKDDYTKQLK-DEDMRGGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDNNLQEVSGMIGNLRNMAIDMGSEINQQNVQIERIQIKAKSNAERIKKANEQASKLLK 222          
BLAST of Synaptosomal-associated protein 25 vs. TrEMBL
Match: A0A5K3F2W4 (Uncharacterized protein OS=Mesocestoides corti OX=53468 PE=4 SV=1)

HSP 1 Score: 298.901 bits (764), Expect = 2.905e-98
Identity = 145/212 (68.40%), Postives = 177/212 (83.49%), Query Frame = 1
Query:  199 PNEIRLENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            P+E+R+E+G +R MTE+E++  +I   T ++LD+TRRM+ +CEEAKE+G+ TLVMLDDQGEQLDRINEG+D+INEDMKDAEKNLDDLNKCCGLC++PW K     K D+ K  K DEDG   G  PRI+VDQNG GPTGGYITRITND  E+E+DQN+QEV GMIGNLRNMAIDMGSEITQQN Q+++I  KA+ N +RIKKAN+QA+KLLK
Sbjct:   20 PDEVRMEDGTVRIMTETELLSRRIDDATEESLDATRRMMAMCEEAKEAGISTLVMLDDQGEQLDRINEGMDQINEDMKDAEKNLDDLNKCCGLCVLPWNKRKG--KGDFAKQLK-DEDGFSGGDGPRIIVDQNGMGPTGGYITRITNDAREDEMDQNMQEVAGMIGNLRNMAIDMGSEITQQNTQVERIHLKAKANADRIKKANEQASKLLK 228          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Cavefish
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:103043918])

HSP 1 Score: 198.749 bits (504), Expect = 1.060e-62
Identity = 101/182 (55.49%), Postives = 140/182 (76.92%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMKDAEKNL+DL K CGLC  P  K+    KS   K W  ++DG  N    R+V ++     +GG+I R+T+D  ENE+D+NL++V G+IGNLR+MA+DMG+EI  QN+QID+IM KA+ N+ RI +AN +ATK+L
Sbjct:   24 ESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKM----KSGGSKAWGNNQDGVVNSQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMDKAESNKTRIDEANQRATKML 201          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Cavefish
Match: snap25b (synaptosomal-associated protein 25-B [Source:NCBI gene;Acc:103032718])

HSP 1 Score: 184.111 bits (466), Expect = 5.552e-57
Identity = 95/182 (52.20%), Postives = 134/182 (73.63%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMK+AEKNL DL   CGLC  P  K+    +S     W  ++DG  +    R+V ++     +GG+I R+TND  ENE+D+NL++V  +IGNLR+MA+DMG+EI  QN+QID+IM  A  N+ RI +AN +ATK+L
Sbjct:   24 ESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLKGGGQS-----WGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQRATKML 200          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Cavefish
Match: snap25b (synaptosomal-associated protein 25-B [Source:NCBI gene;Acc:103032718])

HSP 1 Score: 184.111 bits (466), Expect = 5.552e-57
Identity = 95/182 (52.20%), Postives = 134/182 (73.63%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMK+AEKNL DL   CGLC  P  K+    +S     W  ++DG  +    R+V ++     +GG+I R+TND  ENE+D+NL++V  +IGNLR+MA+DMG+EI  QN+QID+IM  A  N+ RI +AN +ATK+L
Sbjct:   24 ESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKEAEKNLTDLGNLCGLCPCPCNKLKGGGQS-----WGNNQDGVVSSQPARVVDEREQMAISGGFIRRVTNDARENEMDENLEQVGSIIGNLRHMALDMGNEIDTQNRQIDRIMDMADSNKTRIDEANQRATKML 200          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Cavefish
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:103043918])

HSP 1 Score: 179.104 bits (453), Expect = 4.813e-55
Identity = 91/167 (54.49%), Postives = 127/167 (76.05%), Query Frame = 1
Query:  331 AKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            +K++G++TLVMLD+QGEQL+RI EG+D+IN+DMKDAEKNL+DL K CGLC  P  K+    KS   K W  ++DG  N    R+V ++     +GG+I R+T+D  ENE+D+NL++V G+IGNLR+MA+DMG+EI  QN+QID+IM KA+ N+ RI +AN +ATK+L
Sbjct:   34 SKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKM----KSGGSKAWGNNQDGVVNSQPARVVDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMDKAESNKTRIDEANQRATKML 196          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Cavefish
Match: snap23.1 (synaptosomal-associated protein 23-like [Source:NCBI gene;Acc:103046345])

HSP 1 Score: 179.104 bits (453), Expect = 1.320e-54
Identity = 96/197 (48.73%), Postives = 138/197 (70.05%), Query Frame = 1
Query:  280 TTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQK-SDYEKTW-KGDEDGKDNGASPRIVVDQ-----NG--SGPT----GGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            T ++L+STRRML + EE+KE+G +T+ MLD QGEQL R+ +G+D+IN+DMK AEKNL DL+KCCGLC+ P  +V + +    Y++TW  G ++    G    +V  Q     NG  +GP     G YI RITND  E+E+++NL +V  +IGNL++MA+DMG+EI +QNK +D+I+ KA +N+ RI +AN +A KLL
Sbjct:   40 TDESLESTRRMLQMAEESKETGTKTMEMLDQQGEQLKRVEQGMDQINKDMKAAEKNLTDLSKCCGLCVCPCDRVRSIENDGRYKRTWGTGSDNASIEGGEGGVVSSQPTAARNGQAAGPVSSSGGPYIKRITNDAREDEMEENLDQVGSIIGNLKSMALDMGNEIDKQNKTVDRIIDKADMNKARIDEANQRANKLL 236          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Sea Lamprey
Match: ENSPMAT00000009891.1 (pep scaffold:Pmarinus_7.0:GL477783:18017:27879:1 gene:ENSPMAG00000008937.1 transcript:ENSPMAT00000009891.1 gene_biotype:protein_coding transcript_biotype:protein_coding)

HSP 1 Score: 202.986 bits (515), Expect = 5.053e-65
Identity = 101/188 (53.72%), Postives = 142/188 (75.53%), Query Frame = 1
Query:  280 TTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQG--EQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            T ++L+STRRM+ L EE+K++G++TLVMLD+QG  EQLDR+ EGLD+IN+DM++AEKNL DL+KCCGLC+ P  K+ NF+  D Y+KTW   +D   +    R++ ++     +GG+I R+TND  E+E++ NL +V+G++ NLR+MA+DMG+EI  QNKQIDKI  KA+LN  RI  AN QA K+LK
Sbjct:   22 TDESLESTRRMIRLAEESKDAGIRTLVMLDEQGDTEQLDRVEEGLDQINQDMREAEKNLTDLSKCCGLCVCPCKKIRNFEMGDAYKKTWNSGQDIVVSSQPARVMDEREQMQVSGGFIKRVTNDAREDEMEDNLVQVSGLVSNLRHMAVDMGNEIDMQNKQIDKINQKAELNRSRIDDANQQANKMLK 209          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Sea Lamprey
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 200.675 bits (509), Expect = 3.838e-64
Identity = 101/197 (51.27%), Postives = 147/197 (74.62%), Query Frame = 1
Query:  241 TESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            +E E +Q++    T ++L+STRRML L +E+KE+G++TLVMLD+QGEQLD+I EG+D+IN+DMK+AEKNL DL KCCGLC  P  K  +   + Y+K W  ++DG  +     ++ D+     +GG+I R+TND  EN++++NL++V+GMIGNLR+MA+DMG+EI  QN+Q+D+IM KA  N+ RI  AN +ATK+L
Sbjct:    9 SELEKMQERADQVTDESLESTRRMLQLVDESKEAGIRTLVMLDEQGEQLDKIEEGMDQINKDMKEAEKNLTDLGKCCGLCACPCEKKISSCDA-YKKAWGNNQDGVVSNQPAHVMDDREQMACSGGFIRRVTNDARENDMEENLEQVSGMIGNLRHMAMDMGNEIDMQNRQLDRIMEKADSNKARIDDANQRATKIL 204          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Sea Lamprey
Match: SNAP25 (synaptosome associated protein 25 [Source:HGNC Symbol;Acc:HGNC:11132])

HSP 1 Score: 186.808 bits (473), Expect = 2.344e-59
Identity = 90/161 (55.90%), Postives = 124/161 (77.02%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKI 765
            Q+L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EGLD+IN+DMK+AEKNL DL KCCGLC  P  K+ NF+  D Y+K W   EDG  +    R+  ++     +GGYI ++TND  E E+D NL++V+G+IGNLR+MA+DMG+EI  QN+Q+++I
Sbjct:    1 QSLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGLDQINKDMKEAEKNLSDLGKCCGLCSCPCEKLKNFESGDAYKKVWGKKEDGVVSSQPARVCDEREQMAMSGGYIRKVTNDARETEMDDNLEQVSGIIGNLRHMALDMGNEIDTQNRQLERI 161          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Sea Lamprey
Match: snap23.1 (synaptosome associated protein 23.1 [Source:ZFIN;Acc:ZDB-GENE-040426-883])

HSP 1 Score: 140.584 bits (353), Expect = 9.525e-41
Identity = 82/187 (43.85%), Postives = 123/187 (65.78%), Query Frame = 1
Query:  280 TTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKV-TNFQKSDYEKT-WKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            T ++L++TRRM  +  E + +G  TLVML++QGEQL+ I   LD INEDMK+A+K +  ++KCCGLCI P  K+ ++  K  Y+   W      K     P     Q     +G +I RIT+D+ E+E+++NLQE+  +IGNL+ MA++MG+E+ QQN Q++++  KA+LN  RI ++N  ATKLLK
Sbjct:   18 TDESLEATRRMRNMVVETQATGANTLVMLNEQGEQLNTIEHNLDHINEDMKEADKYIRQMSKCCGLCICPCNKMKSSDNKGAYKPAVWGSISKEKVVSEQPGKAGQQGQPQASGPFIKRITDDDREDEMEENLQEIGDIIGNLKGMALNMGNELDQQNTQLERLNEKAELNTSRINQSNQNATKLLK 204          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Nematostella
Match: EDO42967 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S070])

HSP 1 Score: 173.326 bits (438), Expect = 1.726e-53
Identity = 88/188 (46.81%), Postives = 131/188 (69.68%), Query Frame = 1
Query:  280 TTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTWKG--DEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            T ++L+STRRML + EE++++G++T+VM+D+QGEQLDR+ EGLD+IN DMK+AE+NL  + KCCGLC+ PW K   ++KSD Y+K +K   +EDG                        RITND+ E+E+D+NL +V+ +IGNL++MA+DMG E+  QN+Q+D+I  KA+ N+ RI  AN +A  +L+
Sbjct:   22 TDESLESTRRMLRMAEESQDTGIKTMVMIDEQGEQLDRVEEGLDQINADMKEAERNLTGMEKCCGLCVCPWKKSKRYEKSDTYKKAFKNNHNEDG-----------------------VRITNDDREDEMDENLGQVSNIIGNLKSMAVDMGQELETQNRQLDRINAKAESNDTRIHVANKRARDILR 186          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Nematostella
Match: EDO26910 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7TAR1])

HSP 1 Score: 83.5741 bits (205), Expect = 1.053e-20
Identity = 34/56 (60.71%), Postives = 49/56 (87.50%), Query Frame = 1
Query:  331 AKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAK 498
            ++++G++T+VM+D+QGEQLDR+ EGLD+IN DMK+AE+NL  + KCCGLC+ PW K
Sbjct:    1 SQDTGIKTMVMIDEQGEQLDRVEEGLDQINADMKEAERNLTGMEKCCGLCVCPWKK 56          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Nematostella
Match: EDO39859 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7S8P1])

HSP 1 Score: 80.4925 bits (197), Expect = 7.273e-18
Identity = 64/215 (29.77%), Postives = 98/215 (45.58%), Query Frame = 1
Query:  256 IQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDL-----------------------NKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            IQ QI+I   ++LDST+R L L +++ +  ++T   L  QGEQLDR  + LD I+ DM  A +N+  +                       NK   +  M   +   F  SD E+   G     D  A P        SG T       + D +E ++D NL  +   +  L+  A+ +G EI +QN Q+D+I  KA+  + +I KA     K+L
Sbjct:   13 IQQQIRIAQERSLDSTKRSLALIDDSHDVAIKTAEELQYQGEQLDRTEKNLDHIHNDMAVANRNIKSMKSIWGTMTNYFKKAPKQTVTENENKSSHVSHMLGKESCEFSTSDAERETYG---YGDKPARPHDTSSLQRSGLT------TSKDPYERQLDANLDLMARGLSRLKEDALCLGGEIERQNTQLDRITDKAERADFKIDKARKDIKKML 218          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Medaka
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:101165368])

HSP 1 Score: 196.052 bits (497), Expect = 1.311e-61
Identity = 100/182 (54.95%), Postives = 137/182 (75.27%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            ++L+STRRML L EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DMKDAEKNL+DL K CGLC  P  K+    KS   K W  ++DG       R+V ++     +GG+I R+T D  ENE+D+NL++V G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:   24 ESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMKDAEKNLNDLGKFCGLCSCPCNKM----KSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTEDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 201          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Medaka
Match: snap25a (synaptosome associated protein 25 [Source:NCBI gene;Acc:101165368])

HSP 1 Score: 192.2 bits (487), Expect = 4.177e-60
Identity = 97/182 (53.30%), Postives = 135/182 (74.18%), Query Frame = 1
Query:  286 QTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            ++L+STRRML L EE+K++G++TLVMLD+QGEQLDR+ +G++ IN+DMK+AEKNL DL  CCGL I P  K+    KS   K W  ++DG       R+V ++     +GG+I R+T D  ENE+D+NL++V G+IGNLR+MA+DMG+EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:   24 ESLESTRRMLQLVEESKDAGIRTLVMLDEQGEQLDRVEDGMNHINQDMKEAEKNLKDLGNCCGLFICPCNKM----KSGASKAWGNNQDGVVASQPARVVDEREQMAISGGFIRRVTEDARENEMDENLEQVGGIIGNLRHMALDMGNEIDTQNRQIDRIMEKADSNKTRIDEANQRATKML 201          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Medaka
Match: ENSORLT00000040742.1 (synaptosomal-associated protein 25-A [Source:NCBI gene;Acc:101170749])

HSP 1 Score: 185.267 bits (469), Expect = 1.662e-57
Identity = 98/191 (51.31%), Postives = 141/191 (73.82%), Query Frame = 1
Query:  262 DQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNG-ASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            DQI   T ++L+STRRML + EE+K++G++TLVMLD+QGEQL+RI EG+D+IN+DM DAEKNL++L + CGLC  P  K+    ++     W G++DG  N     R++ ++     +GG+I R+T+D  ENE+D+NL++V G+IGNLR+MA+DMG EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:   19 DQI---TDESLESTRRMLAMVEESKDAGIRTLVMLDEQGEQLERIEEGMDQINKDMMDAEKNLNNLGQFCGLCSCPCNKIKGGGQA-----WGGNQDGVVNSQPGARVMDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRIMDKADSNKTRIDEANQRATKML 201          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Medaka
Match: ENSORLT00000043933.1 (synaptosomal-associated protein 25-A [Source:NCBI gene;Acc:101170749])

HSP 1 Score: 179.489 bits (454), Expect = 3.746e-55
Identity = 94/191 (49.21%), Postives = 139/191 (72.77%), Query Frame = 1
Query:  262 DQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNG-ASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLL 831
            DQI   T ++L+STRRML + EE+K++G++TLVMLD+QGEQLDR+ EG++K+N D+K+AEK+L D+ +CCGL      K+    ++     W G++DG  N     R++ ++     +GG+I R+T+D  ENE+D+NL++V G+IGNLR+MA+DMG EI  QN+QID+IM KA  N+ RI +AN +ATK+L
Sbjct:   19 DQI---TDESLESTRRMLAMVEESKDAGIRTLVMLDEQGEQLDRVEEGMNKVNADLKEAEKDLKDIGQCCGLICPCIKKIKGGGQA-----WGGNQDGVVNSQPGARVMDEREQMAISGGFIRRVTDDARENEMDENLEQVGGIIGNLRHMALDMGQEIDTQNRQIDRIMDKADSNKTRIDEANQRATKML 201          
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Medaka
Match: ENSORLT00000014272.2 (synaptosome associated protein 23 [Source:NCBI gene;Acc:101165519])

HSP 1 Score: 178.333 bits (451), Expect = 1.303e-54
Identity = 99/203 (48.77%), Postives = 138/203 (67.98%), Query Frame = 1
Query:  280 TTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSD-YEKTW-KGDEDGKDNGASPRIVVDQ-----NG-----------SGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            T ++L+STRRM  L EE++E+G +TL MLD QGEQL R+ EG+++INEDMK AEKNL+DLNKCCGLC  P  +VT+ +    Y+KTW  G  +G+++G   ++V  Q     NG           + P+G YI R+TND  E+E+++NL+ V G+I NL+ MA+ MG EI +QN QID+I  KA +N+ RI  AN +A KL+K
Sbjct:   17 TDESLESTRRMRQLAEESQETGGKTLDMLDMQGEQLKRVEEGMEQINEDMKQAEKNLNDLNKCCGLCTCPCDRVTSLENDQRYKKTWGTGGLEGENDGDGSKVVSRQPSRTRNGQPAQTAARGTAAAPSGPYIQRVTNDAREDEMEENLEAVGGIISNLKGMAMTMGHEIDKQNVQIDRITDKADMNKMRIDDANQRANKLIK 219          
BLAST of Synaptosomal-associated protein 25 vs. Planmine SMEST
Match: SMESG000034721.1 (SMESG000034721.1)

HSP 1 Score: 317.39 bits (812), Expect = 3.146e-110
Identity = 155/155 (100.00%), Postives = 155/155 (100.00%), Query Frame = 1
Query:  166 MPKKETERSLLPNEIRLENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITR 630
            MPKKETERSLLPNEIRLENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITR
Sbjct:    1 MPKKETERSLLPNEIRLENGDIRPMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITR 155          
BLAST of Synaptosomal-associated protein 25 vs. Planmine SMEST
Match: SMESG000034282.1 (SMESG000034282.1)

HSP 1 Score: 276.944 bits (707), Expect = 1.750e-93
Identity = 136/200 (68.00%), Postives = 166/200 (83.00%), Query Frame = 1
Query:  235 PMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            P TE ++IQ ++   T ++L+STRRML +CEEAKE+G+ TLVMLDDQGEQLDRI+EG+DKIN+DMKDAEKNLDDLNKCCGLCI+PW KV   ++ DY+KTWK +E GKDN   PRIV+DQNG G  GGYIT+ITND  E+E+DQN+ EV+GM+ NL+NMAIDMGS I QQN+QIDKI  KA  N+ERI+ AN QA+KLLK
Sbjct:    9 PPTELQMIQFKMNATTDESLESTRRMLAMCEEAKEAGISTLVMLDDQGEQLDRIDEGMDKINQDMKDAEKNLDDLNKCCGLCILPWNKV---KRDDYDKTWKKEEAGKDNADGPRIVIDQNGMGVQGGYITKITNDAREDEMDQNITEVSGMVSNLKNMAIDMGSSIAQQNQQIDKINRKAVNNDERIRNANQQASKLLK 205          
BLAST of Synaptosomal-associated protein 25 vs. Planmine SMEST
Match: SMESG000005619.1 (SMESG000005619.1)

HSP 1 Score: 233.802 bits (595), Expect = 2.215e-76
Identity = 121/201 (60.20%), Postives = 149/201 (74.13%), Query Frame = 1
Query:  235 PMTESEIIQDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVT-NFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTGGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFKAQLNEERIKKANDQATKLLK 834
            P TE ++IQ +I   T ++L+STRRML LCEEAKE+G+ TLVMLDDQGEQLDR+ EG+DKINED+KDAEKNL+DLNKCCGL  +PW K   N    D      G+ DG      PR+ +D   +GP GGYIT+ITND  E E+DQNL EV G+IGNLRNMAIDMG+EI+QQ+KQID+I  +A  N  RI  A+++ TKLLK
Sbjct:   18 PPTEMQLIQLKINSTTDESLESTRRMLNLCEEAKEAGISTLVMLDDQGEQLDRLEEGMDKINEDLKDAEKNLEDLNKCCGLFTLPWKKTKRNLGSKDQNAEMNGNADG------PRVAMDCGNTGPQGGYITKITNDARETEMDQNLVEVNGVIGNLRNMAIDMGAEISQQSKQIDRINKEASENRYRIITASEKTTKLLK 212          
BLAST of Synaptosomal-associated protein 25 vs. Planmine SMEST
Match: SMESG000001576.1 (SMESG000001576.1)

HSP 1 Score: 51.2174 bits (121), Expect = 1.986e-7
Identity = 45/176 (25.57%), Postives = 83/176 (47.16%), Query Frame = 1
Query:  259 QDQIKIGTTQTLDSTRRMLTLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNKCCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPT----GGYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKIMFK 774
            Q Q++   ++ LDS +  L     +++ G+ T   L DQGE+LDR N+ LD+I+E  K ++K++ +LN           K    +K    +T    +   D    P +    +   PT       I      ++  + D NL +++  +  L  +A  +GSE+ +QNK ++++  K
Sbjct:   17 QSQLQETRSKVLDSQKNALRSLYTSEQIGVATASELMDQGEKLDRTNQRLDEISEKQKVSDKHIKNLNSGFVTSFFGLFK----KKEAPIQTVSSKDRIYDTYRDPNLSQVVSAYKPTELNKSNDIAEGDGSDYRKQFDNNLDDMSKGVNKLNTLAKGLGSELDRQNKLLEEMTPK 188          
The following BLAST results are available for this feature:
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
SNAP251.854e-6351.94synaptosome associated protein 25 [Source:HGNC Sym... [more]
SNAP252.737e-6351.94synaptosome associated protein 25 [Source:HGNC Sym... [more]
SNAP233.032e-4946.08synaptosome associated protein 23 [Source:HGNC Sym... [more]
SNAP233.283e-3538.46synaptosome associated protein 23 [Source:HGNC Sym... [more]
SNAP233.283e-3538.46synaptosome associated protein 23 [Source:HGNC Sym... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ric-41.090e-7254.12Synaptosomal-associated protein [Source:UniProtKB... [more]
ric-41.569e-7255.98Synaptosomal-associated protein [Source:UniProtKB... [more]
aex-43.037e-1225.51t-SNARE protein aex-4 [Source:UniProtKB/Swiss-Pro... [more]
snap-299.042e-923.60Soluble NSF attachment protein 29 [Source:UniProt... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 4
Match NameE-valueIdentityDescription
Snap256.979e-6854.23gene:FBgn0011288 transcript:FBtr0111143[more]
Snap253.808e-6652.74gene:FBgn0011288 transcript:FBtr0304625[more]
Snap241.524e-6550.73gene:FBgn0266720 transcript:FBtr0082163[more]
Snap293.277e-1228.44gene:FBgn0034913 transcript:FBtr0072236[more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap25a9.884e-6254.95synaptosome associated protein 25a [Source:NCBI ge... [more]
snap25a5.461e-6153.85synaptosome associated protein 25a [Source:NCBI ge... [more]
zgc:1017311.159e-6050.75zgc:101731 [Source:ZFIN;Acc:ZDB-GENE-040912-57][more]
zgc:1017311.159e-6050.75zgc:101731 [Source:ZFIN;Acc:ZDB-GENE-040912-57][more]
snap25b6.481e-5752.20synaptosome associated protein 25b [Source:NCBI ge... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap258.206e-6052.46synaptosome associated protein 25kDa [Source:NCBI ... [more]
snap253.890e-5651.98synaptosome associated protein 25kDa [Source:NCBI ... [more]
znf4629.515e-5547.80zinc finger protein 462 [Source:Xenbase;Acc:XB-GEN... [more]
ENSXETT00000028688.18.579e-4148.34synaptosomal-associated protein 25-like [Source:NC... [more]
ENSXETT00000012397.14.096e-4048.68synaptosomal-associated protein 25-like [Source:NC... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Snap251.273e-6351.94synaptosomal-associated protein 25 [Source:MGI Sym... [more]
Snap251.879e-6351.94synaptosomal-associated protein 25 [Source:MGI Sym... [more]
Snap231.228e-5449.24synaptosomal-associated protein 23 [Source:MGI Sym... [more]
Snap231.228e-5449.24synaptosomal-associated protein 23 [Source:MGI Sym... [more]
Snap232.022e-5146.63synaptosomal-associated protein 23 [Source:MGI Sym... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|P36975|SNP25_DROME6.996e-6754.23Synaptosomal-associated protein 25 OS=Drosophila m... [more]
sp|P36976|SNP25_TORMA1.379e-6352.22Synaptosomal-associated protein 25 OS=Torpedo marm... [more]
sp|P60881|SNP25_RAT1.315e-6251.94Synaptosomal-associated protein 25 OS=Rattus norve... [more]
sp|Q5R1X1|SNP25_PANTR1.315e-6251.94Synaptosomal-associated protein 25 OS=Pan troglody... [more]
sp|P60879|SNP25_MOUSE1.315e-6251.94Synaptosomal-associated protein 25 OS=Mus musculus... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A075A4G54.320e-9963.11Synaptosomal-associated protein OS=Opisthorchis vi... [more]
A0A4E0QZ561.202e-9866.22Synaptosomal-associated protein OS=Fasciola hepati... [more]
A0A1S8X1C42.035e-9866.52Synaptosomal-associated protein (Fragment) OS=Opis... [more]
A0A4S2LL362.696e-9866.52Synaptosomal-associated protein OS=Opisthorchis fe... [more]
A0A5K3F2W42.905e-9868.40Uncharacterized protein OS=Mesocestoides corti OX=... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap25a1.060e-6255.49synaptosome associated protein 25 [Source:NCBI gen... [more]
snap25b5.552e-5752.20synaptosomal-associated protein 25-B [Source:NCBI ... [more]
snap25b5.552e-5752.20synaptosomal-associated protein 25-B [Source:NCBI ... [more]
snap25a4.813e-5554.49synaptosome associated protein 25 [Source:NCBI gen... [more]
snap23.11.320e-5448.73synaptosomal-associated protein 23-like [Source:NC... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 4
Match NameE-valueIdentityDescription
ENSPMAT00000009891.15.053e-6553.72pep scaffold:Pmarinus_7.0:GL477783:18017:27879:1 g... [more]
SNAP253.838e-6451.27synaptosome associated protein 25 [Source:HGNC Sym... [more]
SNAP252.344e-5955.90synaptosome associated protein 25 [Source:HGNC Sym... [more]
snap23.19.525e-4143.85synaptosome associated protein 23.1 [Source:ZFIN;A... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 3
Match NameE-valueIdentityDescription
EDO429671.726e-5346.81Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO269101.053e-2060.71Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
EDO398597.273e-1829.77Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 5
Match NameE-valueIdentityDescription
snap25a1.311e-6154.95synaptosome associated protein 25 [Source:NCBI gen... [more]
snap25a4.177e-6053.30synaptosome associated protein 25 [Source:NCBI gen... [more]
ENSORLT00000040742.11.662e-5751.31synaptosomal-associated protein 25-A [Source:NCBI ... [more]
ENSORLT00000043933.13.746e-5549.21synaptosomal-associated protein 25-A [Source:NCBI ... [more]
ENSORLT00000014272.21.303e-5448.77synaptosome associated protein 23 [Source:NCBI gen... [more]
back to top
BLAST of Synaptosomal-associated protein 25 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 4
Match NameE-valueIdentityDescription
SMESG000034721.13.146e-110100.00SMESG000034721.1[more]
SMESG000034282.11.750e-9368.00SMESG000034282.1[more]
SMESG000005619.12.215e-7660.20SMESG000005619.1[more]
SMESG000001576.11.986e-725.57SMESG000001576.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023454 ID=SMED30023454|Name=Synaptosomal-associated protein 25|organism=Schmidtea mediterranea sexual|type=transcript|length=985bp
AAAAAATAACAATTTTTTTTCAATCGATAAAAATTAAATTTTTGCTTTTT
TTCCAAAAATCAATGGATTATAAAAATCAATTTTTCAAATCTTTTTTGAA
TATTTAAACAGTTCTCAGAATTTTCTCTAGTGAAATTTTCAAGAAATCGA
TTTCAGTTTTAGAAAATGCCGAAAAAAGAAACCGAAAGATCTTTGTTGCC
AAATGAAATACGACTGGAAAATGGAGACATTCGACCGATGACCGAGTCCG
AAATCATTCAAGATCAGATCAAGATCGGCACAACGCAAACATTGGATAGC
ACAAGAAGAATGCTTACACTCTGTGAAGAGGCAAAAGAATCAGGATTGCA
AACACTCGTAATGCTGGATGATCAAGGAGAGCAATTAGACAGAATCAACG
AGGGATTAGATAAGATCAACGAAGACATGAAAGATGCGGAGAAAAATCTG
GACGACTTGAATAAATGTTGCGGTCTTTGTATAATGCCCTGGGCCAAAGT
GACTAATTTTCAAAAATCAGATTATGAAAAAACTTGGAAAGGAGACGAAG
ATGGCAAAGACAATGGAGCCAGTCCGAGAATAGTTGTAGATCAAAACGGA
AGTGGACCGACCGGTGGTTATATTACCAGAATAACAAATGACGAGTTCGA
AAACGAGATAGATCAGAATCTGCAAGAAGTGACCGGCATGATTGGAAATC
TAAGAAACATGGCTATTGACATGGGCAGCGAGATAACTCAGCAAAACAAA
CAAATTGACAAAATAATGTTCAAGGCTCAACTAAATGAAGAGAGAATCAA
GAAAGCTAACGACCAAGCAACGAAGCTTCTGAAATAAACCAACCTTTACT
CTGAGAGACCTCAATCCCGTTGTTAATGGTGTACCGAGAATTATTATCAT
TTTGACCAAATAATCATTTTCCTATTAGATTCTTAGTTTTTGTGAATTTG
AGCGATTATTTTCTGTAAATTGATATTTTTAGTGA
back to top

protein sequence of SMED30023454-orf-1

>SMED30023454-orf-1 ID=SMED30023454-orf-1|Name=SMED30023454-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=224bp
MPKKETERSLLPNEIRLENGDIRPMTESEIIQDQIKIGTTQTLDSTRRML
TLCEEAKESGLQTLVMLDDQGEQLDRINEGLDKINEDMKDAEKNLDDLNK
CCGLCIMPWAKVTNFQKSDYEKTWKGDEDGKDNGASPRIVVDQNGSGPTG
GYITRITNDEFENEIDQNLQEVTGMIGNLRNMAIDMGSEITQQNKQIDKI
MFKAQLNEERIKKANDQATKLLK*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000099neuron
PLANA:0000418head
Vocabulary: INTERPRO
TermDefinition
IPR000727T_SNARE_dom
IPR000928SNAP-25_dom
Vocabulary: molecular function
TermDefinition
GO:0005515protein binding
GO:0005484SNAP receptor activity
GO:0019905syntaxin binding
Vocabulary: cellular component
TermDefinition
GO:0005886plasma membrane
GO:0031201SNARE complex
GO:0098793presynapse
Vocabulary: biological process
TermDefinition
GO:0016082synaptic vesicle priming
GO:0031629synaptic vesicle fusion to presynaptic active zone membrane
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 67..101
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 18..99
e-value: 4.9E-28
score: 98.9
NoneNo IPR availableGENE3DG3DSA:1.20.5.110coord: 139..223
e-value: 9.4E-29
score: 101.3
NoneNo IPR availablePANTHERPTHR19305:SF14SYNAPTOSOMAL-ASSOCIATED PROTEIN-RELATEDcoord: 19..223
NoneNo IPR availablePANTHERPTHR19305SYNAPTOSOMAL ASSOCIATED PROTEINcoord: 19..223
NoneNo IPR availableCDDcd15889SNARE_SNAP25N_23Ncoord: 39..97
e-value: 1.09711E-25
score: 93.0835
NoneNo IPR availableCDDcd15885SNARE_SNAP25Ccoord: 162..220
e-value: 7.75273E-25
score: 90.8721
NoneNo IPR availableSUPERFAMILYSSF58038SNARE fusion complexcoord: 28..96
NoneNo IPR availableSUPERFAMILYSSF58038SNARE fusion complexcoord: 149..222
IPR000727Target SNARE coiled-coil homology domainSMARTSM00397tSNARE_6coord: 154..221
e-value: 5.2E-13
score: 59.2
coord: 31..98
e-value: 5.3E-6
score: 36.0
IPR000727Target SNARE coiled-coil homology domainPROSITEPS50192T_SNAREcoord: 159..221
score: 16.587
IPR000727Target SNARE coiled-coil homology domainPROSITEPS50192T_SNAREcoord: 36..98
score: 12.193
IPR000928SNAP-25 domainPFAMPF00835SNAP-25coord: 108..159
e-value: 1.3E-15
score: 57.4