E3 ubiquitin-protein ligase RING2

Overview
NameE3 ubiquitin-protein ligase RING2
Smed IDSMED30023432
Length (bp)1409
Neoblast Clusters

Zeng et. al., 2018




▻ Overview

▻ Neoblast Population

▻ Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 



 

Overview

 

Single cell RNA-seq of pluripotent neoblasts and its early progenies


We isolated X1 neoblasts cells enriched in high piwi-1 expression (Neoblast Population), and profiled ∼7,614 individual cells via scRNA-seq. Unsupervised analyses uncovered 12 distinct classes from 7,088 high-quality cells. We designated these classes Nb1 to Nb12 and ordered them based on high (Nb1) to low (Nb12) piwi-1 expression levels. We further defined groups of genes that best classified the cells parsed into 12 distinct cell clusters to generate a scaled expression heat map of discriminative gene sets for each cluster. Expression of each cluster’s gene signatures was validated using multiplex fluorescence in situ hybridization (FISH) co-stained with piwi-1 and largely confirmed the cell clusters revealed by scRNA-seq.

We also tested sub-lethal irradiation exposure. To profile rare pluripotent stem cells (PSCs) and avoid interference from immediate progenitor cells, we determined a time point after sub-lethal irradiation (7 DPI) with minimal piwi-1+ cells, followed by isolation and single-cell RNA-seq of 1,200 individual cells derived from X1 (Piwi-1 high) and X2 (Piwi-1 low) cell populations (Sub-lethal Irradiated Surviving X1 and X2 Cell Population)




Explore this single cell expression dataset with our NB Cluster Shiny App




 

Neoblast Population

 

t-SNE plot shows two-dimensional representation of global gene expression relationships among all neoblasts (n = 7,088 after filter). Cluster identity was assigned based on the top 10 marker genes of each cluster (Table S2), followed by inspection of RNA in situ hybridization patterns. Neoblast groups, Nb.


Expression of E3 ubiquitin-protein ligase RING2 (SMED30023432) t-SNE clustered cells

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase RING2 (SMED30023432) in cells (dots) of each of the 12 neoblast clusters.

 

back to top


 

Sub-lethal Irradiated Surviving X1 and X2 Cell Population

 

t-SNE plot of surviving X1 and X2 cells (n = 1,039 after QC filter) after sub-lethal irradiation. Colors indicate unbiased cell classification via graph-based clustering. SL, sub-lethal irradiated cell groups.

Expression of E3 ubiquitin-protein ligase RING2 (SMED30023432) in the t-SNE clustered sub-lethally irradiated X1 and X2 cells.

Violin plots show distribution of expression levels for E3 ubiquitin-protein ligase RING2 (SMED30023432) in cells (dots) of each of the 10 clusters of sub-leathally irradiated X1 and X2 cells.

 

back to top


 

Embryonic Expression

Davies et. al., 2017




Hover the mouse over a column in the graph to view average RPKM values per sample.
Sort Descending | Sort Ascending | Only Non-Zero Values | Tile/Chart | Reset

Embryonic Stages: Y: yolk. S2-S8: Stages 2-8. C4: asexual adult. SX: virgin, sexually mature adult.
For further information about sample preparation and analysis for the single animal RNA-Seq experiment, please refer to the Materials and Methods

 

back to top
Anatomical Expression

PAGE et. al., 2020




SMED30023432

has been reported as being expressed in these anatomical structures and/or regions. Read more about PAGE



PAGE Curations: 4

  
Expressed InReference TranscriptGene ModelsPublished TranscriptTranscriptomePublicationSpecimenLifecycleEvidence
tail stripeSMED30023432SMESG000047040.1 isotig12400be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023432SMESG000047040.1 isotig12400be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
tail stripeSMED30023432SMESG000047040.1 isotig12399be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
parenchymaSMED30023432SMESG000047040.1 isotig12399be_Smed_v2PMID:22543868
Onal et al., 2012
whole organism asexual adult colorimetric in situ hybridization evidence
Note: Hover over icons to view figure legend
Homology
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Human
Match: RNF2 (ring finger protein 2 [Source:HGNC Symbol;Acc:HGNC:10061])

HSP 1 Score: 162.925 bits (411), Expect = 1.879e-46
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EI + P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 130          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Human
Match: RNF2 (ring finger protein 2 [Source:HGNC Symbol;Acc:HGNC:10061])

HSP 1 Score: 163.31 bits (412), Expect = 1.157e-45
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EI + P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 130          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Human
Match: RING1 (ring finger protein 1 [Source:HGNC Symbol;Acc:HGNC:10018])

HSP 1 Score: 160.229 bits (404), Expect = 7.885e-44
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+ R PQ  I D +EIA+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R+EYEAHQ  V+ +
Sbjct:   11 SKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIR 127          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Human
Match: RING1 (ring finger protein 1 [Source:HGNC Symbol;Acc:HGNC:10018])

HSP 1 Score: 160.229 bits (404), Expect = 7.885e-44
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+ R PQ  I D +EIA+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R+EYEAHQ  V+ +
Sbjct:   11 SKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIR 127          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Human
Match: RING1 (ring finger protein 1 [Source:HGNC Symbol;Acc:HGNC:10018])

HSP 1 Score: 160.229 bits (404), Expect = 7.885e-44
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+ R PQ  I D +EIA+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R+EYEAHQ  V+ +
Sbjct:   11 SKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIR 127          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Celegans
Match: spat-3 (Suppressor of PAr-Two defect [Source:UniProtKB/TrEMBL;Acc:Q22463])

HSP 1 Score: 57.3806 bits (137), Expect = 2.098e-8
Identity = 31/70 (44.29%), Postives = 45/70 (64.29%), Query Frame = 2
Query:  185 LKCPICLDFLSNTMATKECLHRFCSQCIVTA-LRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYR 391
              C +C + +  ++ TK+C HRFC QCI+ A +RSGN  CP CR+ L SKR L++D  FD +I ++   R
Sbjct:  160 FSCDVCQELIQGSIMTKKCGHRFCDQCILVAFMRSGNT-CPTCRQNLGSKRELQQDPRFDQLIYQVVESR 228          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Fly
Match: Sce (gene:FBgn0003330 transcript:FBtr0085245)

HSP 1 Score: 167.548 bits (423), Expect = 1.523e-46
Identity = 86/123 (69.92%), Postives = 101/123 (82.11%), Query Frame = 2
Query:   62 AIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            +++ AP+K WEL+LYE+QRKPQ +ITD +EIA+ P  L +EL CPICLD L  TM TKECLHRFCS CIVTALRSGNKECP CRKKLVSKRSLR D NFD +I+K++P R+EYEA Q  VMAK
Sbjct:    3 SLDPAPNKTWELSLYELQRKPQEVITDSTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSREEYEAIQEKVMAK 125          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Zebrafish
Match: rnf2 (ring finger protein 2 [Source:NCBI gene;Acc:327035])

HSP 1 Score: 164.851 bits (416), Expect = 2.196e-46
Identity = 83/117 (70.94%), Postives = 95/117 (81.20%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EIA+ P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   16 SKTWELSLYELQRTPQEAITDGLEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 132          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Zebrafish
Match: rnf2 (ring finger protein 2 [Source:NCBI gene;Acc:327035])

HSP 1 Score: 164.851 bits (416), Expect = 2.522e-46
Identity = 83/117 (70.94%), Postives = 95/117 (81.20%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EIA+ P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 130          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Zebrafish
Match: rnf2 (ring finger protein 2 [Source:NCBI gene;Acc:327035])

HSP 1 Score: 110.923 bits (276), Expect = 2.884e-29
Identity = 49/70 (70.00%), Postives = 55/70 (78.57%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSG 289
            SK WEL+LYE+QR PQ  ITD  EIA+ P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSG
Sbjct:   16 SKTWELSLYELQRTPQEAITDGLEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSG 85          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Zebrafish
Match: pcgf5a (polycomb group ring finger 5a [Source:NCBI gene;Acc:562327])

HSP 1 Score: 50.447 bits (119), Expect = 1.314e-6
Identity = 37/107 (34.58%), Postives = 48/107 (44.86%), Query Frame = 2
Query:  185 LKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXX---XXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAKQIKNSTRNLKANVSDRQNDKTS 496
            + C IC  +L    A  ECLH FC  CIV      N ECP C  ++        LR D   + II KL P  +E E HQ +   ++ K     +K+N  D    K S
Sbjct:   16 ITCSICRGYLIKPTAVTECLHTFCKSCIVQHFEESN-ECPECGIQVHETNPLEMLRLDKTLEEIIFKLVPGLREKEEHQESEFWRKHK-----IKSNGEDGPRAKKS 116          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Zebrafish
Match: pcgf5a (polycomb group ring finger 5a [Source:NCBI gene;Acc:562327])

HSP 1 Score: 50.447 bits (119), Expect = 1.314e-6
Identity = 37/107 (34.58%), Postives = 48/107 (44.86%), Query Frame = 2
Query:  185 LKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXX---XXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAKQIKNSTRNLKANVSDRQNDKTS 496
            + C IC  +L    A  ECLH FC  CIV      N ECP C  ++        LR D   + II KL P  +E E HQ +   ++ K     +K+N  D    K S
Sbjct:   16 ITCSICRGYLIKPTAVTECLHTFCKSCIVQHFEESN-ECPECGIQVHETNPLEMLRLDKTLEEIIFKLVPGLREKEEHQESEFWRKHK-----IKSNGEDGPRAKKS 116          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Xenopus
Match: ring1 (ring finger protein 1 [Source:NCBI gene;Acc:100037886])

HSP 1 Score: 164.851 bits (416), Expect = 5.771e-46
Identity = 84/117 (71.79%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+ R PQ  I D +EIA+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+AK
Sbjct:   39 SKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQDRVLAK 155          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Xenopus
Match: ring1 (ring finger protein 1 [Source:NCBI gene;Acc:100037886])

HSP 1 Score: 164.851 bits (416), Expect = 7.785e-46
Identity = 84/117 (71.79%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+ R PQ  I D +EIA+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+AK
Sbjct:   39 SKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQDRVLAK 155          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Xenopus
Match: rnf2 (ring finger protein 2 [Source:NCBI gene;Acc:407872])

HSP 1 Score: 162.925 bits (411), Expect = 1.433e-45
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EI + P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 130          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Mouse
Match: Rnf2 (ring finger protein 2 [Source:MGI Symbol;Acc:MGI:1101759])

HSP 1 Score: 163.31 bits (412), Expect = 8.370e-46
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EI + P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 130          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Mouse
Match: Rnf2 (ring finger protein 2 [Source:MGI Symbol;Acc:MGI:1101759])

HSP 1 Score: 163.31 bits (412), Expect = 8.370e-46
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EI + P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 130          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Mouse
Match: Ring1 (ring finger protein 1 [Source:MGI Symbol;Acc:MGI:1101770])

HSP 1 Score: 160.614 bits (405), Expect = 4.362e-44
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+ R PQ  I D +EIA+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R+EYEAHQ  V+ +
Sbjct:   11 SKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSREEYEAHQDRVLIR 127          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Mouse
Match: Rnf2 (ring finger protein 2 [Source:MGI Symbol;Acc:MGI:1101759])

HSP 1 Score: 113.62 bits (283), Expect = 3.269e-28
Identity = 48/70 (68.57%), Postives = 54/70 (77.14%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSG 289
            SK WEL+LYE+QR PQ  ITD  EI + P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSG
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSG 83          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Mouse
Match: Rnf2 (ring finger protein 2 [Source:MGI Symbol;Acc:MGI:1101759])

HSP 1 Score: 91.2781 bits (225), Expect = 2.406e-22
Identity = 40/60 (66.67%), Postives = 45/60 (75.00%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCS 259
            SK WEL+LYE+QR PQ  ITD  EI + P  L +EL CPICLD L NTM TKECLHRFC+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCA 73          
BLAST of E3 ubiquitin-protein ligase RING2 vs. UniProt/SwissProt
Match: sp|Q9VB08|RING1_DROME (E3 ubiquitin-protein ligase RING1 OS=Drosophila melanogaster OX=7227 GN=Sce PE=1 SV=1)

HSP 1 Score: 167.548 bits (423), Expect = 1.527e-45
Identity = 86/123 (69.92%), Postives = 101/123 (82.11%), Query Frame = 2
Query:   62 AIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            +++ AP+K WEL+LYE+QRKPQ +ITD +EIA+ P  L +EL CPICLD L  TM TKECLHRFCS CIVTALRSGNKECP CRKKLVSKRSLR D NFD +I+K++P R+EYEA Q  VMAK
Sbjct:    3 SLDPAPNKTWELSLYELQRKPQEVITDSTEIAVSPRSLHSELMCPICLDMLKKTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRADPNFDLLISKIYPSREEYEAIQEKVMAK 125          
BLAST of E3 ubiquitin-protein ligase RING2 vs. UniProt/SwissProt
Match: sp|Q803I4|RING2_DANRE (E3 ubiquitin-protein ligase RING2 OS=Danio rerio OX=7955 GN=rnf2 PE=2 SV=1)

HSP 1 Score: 164.851 bits (416), Expect = 1.904e-45
Identity = 83/117 (70.94%), Postives = 95/117 (81.20%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EIA+ P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 130          
BLAST of E3 ubiquitin-protein ligase RING2 vs. UniProt/SwissProt
Match: sp|Q4KLY4|RING2_RAT (E3 ubiquitin-protein ligase RING2 OS=Rattus norvegicus OX=10116 GN=Rnf2 PE=2 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 2.664e-45
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EI + P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 130          
BLAST of E3 ubiquitin-protein ligase RING2 vs. UniProt/SwissProt
Match: sp|Q66J69|RNG2A_XENLA (E3 ubiquitin-protein ligase RING2-A OS=Xenopus laevis OX=8355 GN=rnf2-a PE=2 SV=1)

HSP 1 Score: 164.081 bits (414), Expect = 3.472e-45
Identity = 84/117 (71.79%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+ R PQ  I D +EIA+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+AK
Sbjct:   11 SKTWELSLYELHRTPQEAIMDGTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQDRVLAK 127          
BLAST of E3 ubiquitin-protein ligase RING2 vs. UniProt/SwissProt
Match: sp|Q99496|RING2_HUMAN (E3 ubiquitin-protein ligase RING2 OS=Homo sapiens OX=9606 GN=RNF2 PE=1 SV=1)

HSP 1 Score: 163.31 bits (412), Expect = 5.558e-45
Identity = 82/117 (70.09%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EI + P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIVVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 130          
BLAST of E3 ubiquitin-protein ligase RING2 vs. TrEMBL
Match: A0A448X897 (RING-type domain-containing protein (Fragment) OS=Protopolystoma xenopodis OX=117903 GN=PXEA_LOCUS23905 PE=4 SV=1)

HSP 1 Score: 177.948 bits (450), Expect = 7.651e-49
Identity = 91/124 (73.39%), Postives = 106/124 (85.48%), Query Frame = 2
Query:   59 MAIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            +++E AP+KNWELTLYE+QR+PQ  ITD +EIA+ P  L +EL CPICLD L  TM TKECLHRFCS+CIVTALRSGNKECP CRKKLVSKRSLRRD NFDA+IAK++P R+EYEAHQ  V+AK
Sbjct:   26 LSMENAPAKNWELTLYELQREPQKPITDGTEIAVSPRSLQSELMCPICLDILKVTMTTKECLHRFCSECIVTALRSGNKECPTCRKKLVSKRSLRRDPNFDALIAKIYPSREEYEAHQDKVLAK 149          
BLAST of E3 ubiquitin-protein ligase RING2 vs. TrEMBL
Match: A0A068Y0M8 (E3 ubiquitin protein ligase ring2 OS=Echinococcus multilocularis OX=6211 GN=EmuJ_001186900 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 1.080e-48
Identity = 150/399 (37.59%), Postives = 201/399 (50.38%), Query Frame = 2
Query:   59 MAIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAKQIKNSTRNLKANVSD------RQNDKTSDNIXXXXXXXXXXXXXXXXXXXXXKDQSSTASVNQKKYRNSAKYNERSSMAVQSDNNSSMQVDEELSVTASSEIALPQ-----IRVRQPSSESGGPETNCSSSITSELNSL---IGNQSRENIIPNTNTV----------NDKSSNSENHVDVILEPLDGRTGKHKLNESFT------ILIPDVATVGHLIEFLHVKRLDLQKAKRP------------NNESEGATKVFKTFHSVEDITYNIYLGM 1129
            MA+E AP KNWELTLYEMQRKPQ  ITD ++IA+ P  L +EL CPICLD L  TM TKECLHRFCS CIVTALR+GNKECP CRKKLVSKRSLRRD NFDA+IAK++P R+EYEAHQ  V+AK +     N +A++ +        ND  S       +  NN  +  ++        S T S+NQ+  R            V SD  S       +   +S +   P       R R  SS S  P +  ++++  E+  +   +  + R  IIP + +V          N   S    H      P  G T +    ES        I +P  ATV HL  FL + R +LQ+  +              NE+ G     +   ++++I+ N + G+
Sbjct:    1 MAMENAPMKNWELTLYEMQRKPQEPITDGTKIAVSPRSLQSELMCPICLDILKVTMTTKECLHRFCSDCIVTALRNGNKECPTCRKKLVSKRSLRRDPNFDALIAKIYPDREEYEAHQNRVLAK-LNKQQFNGRASLHESGQSLHSSNDIDSARYRNRRSTGNNGFATADSVISEDDAASITGSLNQRASR------------VNSDAESGTIETTSVGGASSVDFGHPHQQSHNQRTRT-SSNSATPAS--TTTVIPEVELMLRPLPPEHRRGIIPTSFSVSLDTGVECHGNQIKSEDGGHGTAASSP-HGTTSEMGSEESLLAPAVKYIKVPSNATVDHLGRFLSI-RFNLQRVHKDVMENDPYFTLFYYNEASGEFVHLQPSMTIDEISRNYWSGL 381          
BLAST of E3 ubiquitin-protein ligase RING2 vs. TrEMBL
Match: W6UAK3 (E3 ubiquitin-protein ligase RING2 OS=Echinococcus granulosus OX=6210 GN=EGR_07030 PE=4 SV=1)

HSP 1 Score: 181.415 bits (459), Expect = 1.450e-48
Identity = 146/397 (36.78%), Postives = 198/397 (49.87%), Query Frame = 2
Query:   59 MAIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAKQIKNSTRNLKANVSD------RQNDKTSDNIXXXXXXXXXXXXXXXXXXXXXKDQSSTASVNQKKYRNSAKYNERSSMAVQSDNNSSMQVDEELSVTASSEIALP--QIRVRQPSSESGGPETNCSSSITSELNSL---IGNQSRENIIPNTNTV-----------NDKSSNSENHVDVILEPLDGRTGKHKLNESF------TILIPDVATVGHLIEFLHVKRLDLQKAKRP------------NNESEGATKVFKTFHSVEDITYNIYLGM 1129
            MA+E AP KNWELTLYEMQRKPQ  +TD ++IA+ P  L +EL CPICLD L  TM TKECLHRFCS CIVTALR+GNKECP CRKKLVSKRSLRRD NFDA+IAK++P R+EYEAHQ  V+AK +     N +A++ +        ND  S       +  NN  +  ++        S T S+NQ+  R            V SD  S       +   +S +   P  Q   ++  + S       ++++  E+  +   +  Q R  IIP +  V           N   S    H      P  G T +    ES        I +P  ATV HL  FL + R +LQ+  +              NE+ G     +   ++++I+ N + G+
Sbjct:    1 MAMENAPMKNWELTLYEMQRKPQEPVTDGTKIAVSPRSLQSELMCPICLDILKVTMTTKECLHRFCSDCIVTALRNGNKECPTCRKKLVSKRSLRRDPNFDALIAKIYPDREEYEAHQNRVLAK-LNKQQFNGRASLHESGQSLHSSNDIDSARYRNRRSTGNNGFATADSVISEDDAASITGSLNQRASR------------VNSDAESGTIETTSVGGASSVDFGHPHQQSHNQRTRTSSNNATPTSTTTVIPEVELMLRPLPPQHRRGIIPTSFAVSLDGTGVECHGNQTKSEDGGHGTAASSP-HGTTSEMGSEESLLAPAVKYIKVPSNATVDHLGRFLSI-RFNLQRVHKDVMENDPYFTLFYYNEASGEYVHLQPSMTIDEISRNYWSGL 382          
BLAST of E3 ubiquitin-protein ligase RING2 vs. TrEMBL
Match: A0A0R3WCT3 (RING-type domain-containing protein OS=Taenia asiatica OX=60517 GN=TASK_LOCUS8531 PE=4 SV=1)

HSP 1 Score: 181.03 bits (458), Expect = 1.631e-48
Identity = 93/124 (75.00%), Postives = 104/124 (83.87%), Query Frame = 2
Query:   59 MAIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            MA+E AP KNWELTLYEMQRKPQ  ITD ++IA+ P  L +EL CPICLD L  TM TKECLHRFCS CIVTALR+GNKECP CRKKLVSKRSLRRD NFDA+IAK++P R+EYEAHQ  V+AK
Sbjct:    1 MAMENAPMKNWELTLYEMQRKPQEPITDGTKIAVSPRSLQSELMCPICLDILKVTMTTKECLHRFCSDCIVTALRNGNKECPTCRKKLVSKRSLRRDPNFDALIAKIYPDREEYEAHQNRVLAK 124          
BLAST of E3 ubiquitin-protein ligase RING2 vs. TrEMBL
Match: A0A0V0J5R3 (E3 ubiquitin-protein ligase RING2-A OS=Schistocephalus solidus OX=70667 GN=RNG2A PE=4 SV=1)

HSP 1 Score: 178.718 bits (452), Expect = 3.454e-48
Identity = 93/124 (75.00%), Postives = 104/124 (83.87%), Query Frame = 2
Query:   59 MAIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            MA+E AP KNWELTLYE+QRKPQ  ITD +EIA+ P  L +EL CPICLD L  TM TKECLHRFCS+CIVTALRSGNKECP CRKKLVSKRSLRRD NFDA+IAK++P R+EYEA Q  V+AK
Sbjct:    1 MAMENAPMKNWELTLYELQRKPQEPITDGTEIAVSPRSLQSELMCPICLDILKVTMTTKECLHRFCSECIVTALRSGNKECPTCRKKLVSKRSLRRDPNFDALIAKIYPSREEYEAQQDKVLAK 124          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Cavefish
Match: rnf2 (ring finger protein 2 [Source:NCBI gene;Acc:103033289])

HSP 1 Score: 164.851 bits (416), Expect = 1.926e-46
Identity = 83/117 (70.94%), Postives = 95/117 (81.20%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EIA+ P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   14 SKTWELSLYELQRTPQEAITDGLEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 130          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Cavefish
Match: RING1 (E3 ubiquitin-protein ligase RING2-A [Source:NCBI gene;Acc:103031263])

HSP 1 Score: 164.466 bits (415), Expect = 5.999e-46
Identity = 84/118 (71.19%), Postives = 96/118 (81.36%), Query Frame = 2
Query:   71 KAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVM 424
            + PSK+WEL+LYE+ R PQ  I D +EIA+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSGNKECP CRKKLVSKRSLRRD NFDA+I+K++P R EYEAHQ  V+
Sbjct:    8 QMPSKSWELSLYELHRTPQEAIVDSTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSKRSLRRDPNFDALISKIYPSRDEYEAHQDRVL 125          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Cavefish
Match: RING1 (E3 ubiquitin-protein ligase RING2-A [Source:NCBI gene;Acc:103031263])

HSP 1 Score: 117.087 bits (292), Expect = 3.985e-29
Identity = 50/73 (68.49%), Postives = 57/73 (78.08%), Query Frame = 2
Query:   71 KAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSG 289
            + PSK+WEL+LYE+ R PQ  I D +EIA+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSG
Sbjct:    8 QMPSKSWELSLYELHRTPQEAIVDSTEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSG 80          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Cavefish
Match: toporsb (E3 ubiquitin-protein ligase Topors-like [Source:NCBI gene;Acc:103043679])

HSP 1 Score: 49.6766 bits (117), Expect = 7.116e-6
Identity = 23/42 (54.76%), Postives = 26/42 (61.90%), Query Frame = 2
Query:  188 KCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNK-ECPAC 310
            KCPICLD  +N  +   CLHRFC +CI     S NK ECP C
Sbjct:   32 KCPICLDRFNNAASLDRCLHRFCFRCIHEW--SKNKAECPLC 71          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Cavefish
Match: toporsb (E3 ubiquitin-protein ligase Topors-like [Source:NCBI gene;Acc:103043679])

HSP 1 Score: 49.6766 bits (117), Expect = 7.116e-6
Identity = 23/42 (54.76%), Postives = 26/42 (61.90%), Query Frame = 2
Query:  188 KCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNK-ECPAC 310
            KCPICLD  +N  +   CLHRFC +CI     S NK ECP C
Sbjct:   32 KCPICLDRFNNAASLDRCLHRFCFRCIHEW--SKNKAECPLC 71          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Nematostella
Match: EDO49955 (Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7REQ4])

HSP 1 Score: 155.221 bits (391), Expect = 2.546e-43
Identity = 80/117 (68.38%), Postives = 94/117 (80.34%), Query Frame = 2
Query:   92 ELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAKQIKN 442
            EL+LYE+ R PQ  ITD +EI+I P  L +EL CPICLD L NTM TKECLHRFC +CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+IAK++P R+EYEAHQ  V+ +  K+
Sbjct:   17 ELSLYELHRTPQEAITDGTEISISPRSLHSELMCPICLDMLKNTMTTKECLHRFCQECIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALIAKIYPDREEYEAHQEKVLQRLSKH 133          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Medaka
Match: RING1 (ring finger protein 1 [Source:NCBI gene;Acc:101165819])

HSP 1 Score: 165.622 bits (418), Expect = 2.624e-46
Identity = 82/120 (68.33%), Postives = 98/120 (81.67%), Query Frame = 2
Query:   71 KAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            + PSK WEL+LYE+ R PQ +I D +E+A+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSGNKECP CRKKLVS+RSLRRD NFDA+I+K++P R EYEAHQ +V+ +
Sbjct:    8 QTPSKTWELSLYELHRTPQEVIVDGTEVAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSRRSLRRDSNFDALISKIYPSRDEYEAHQRSVLER 127          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Medaka
Match: RING1 (ring finger protein 1 [Source:NCBI gene;Acc:101165819])

HSP 1 Score: 165.622 bits (418), Expect = 2.769e-46
Identity = 82/120 (68.33%), Postives = 98/120 (81.67%), Query Frame = 2
Query:   71 KAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            + PSK WEL+LYE+ R PQ +I D +E+A+ P  L +EL CPICLD L NTM TKECLHRFCS CIVTALRSGNKECP CRKKLVS+RSLRRD NFDA+I+K++P R EYEAHQ +V+ +
Sbjct:    8 QTPSKTWELSLYELHRTPQEVIVDGTEVAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCSDCIVTALRSGNKECPTCRKKLVSRRSLRRDSNFDALISKIYPSRDEYEAHQRSVLER 127          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Medaka
Match: rnf2 (ring finger protein 2 [Source:NCBI gene;Acc:101163519])

HSP 1 Score: 164.081 bits (414), Expect = 1.222e-45
Identity = 83/117 (70.94%), Postives = 95/117 (81.20%), Query Frame = 2
Query:   80 SKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAK 430
            SK WEL+LYE+QR PQ  ITD  EIA+ P  L +EL CPICLD L NTM TKECLHRFC+ CI+TALRSGNKECP CRKKLVSKRSLR D NFDA+I+K++P R EYEAHQ  V+A+
Sbjct:   57 SKTWELSLYELQRTPQEAITDGLEIAVSPRSLHSELMCPICLDMLKNTMTTKECLHRFCADCIITALRSGNKECPTCRKKLVSKRSLRPDPNFDALISKIYPSRDEYEAHQERVLAR 173          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Medaka
Match: ENSORLT00000040811.1 (polycomb group ring finger 2 [Source:NCBI gene;Acc:101173438])

HSP 1 Score: 51.9878 bits (123), Expect = 5.702e-7
Identity = 22/46 (47.83%), Postives = 28/46 (60.87%), Query Frame = 2
Query:  173 LSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPAC 310
            L+  L CP+C  +L +     ECLH FC  CIVT L++ NK CP C
Sbjct:   14 LNPHLTCPLCAGYLIDATTIVECLHSFCKTCIVTFLKT-NKFCPRC 58          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Planmine SMEST
Match: SMESG000047040.1 (SMESG000047040.1)

HSP 1 Score: 791.186 bits (2042), Expect = 0.000e+0
Identity = 446/447 (99.78%), Postives = 447/447 (100.00%), Query Frame = 2
Query:   59 MAIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKEYEAHQANVMAKQIKNSTRNLKANVSDRQNDKTSDNIXXXXXXXXXXXXXXXXXXXXXKDQSSTASVNQKKYRNSAKYNERSSMAVQSDNNSSMQVDEELSVTASSEIALPQIRVRQPSSESGGPETNCSSSITSELNSLIGNQSRENIIPNTNTVNDKSSNSENHVDVILEPLDGRTGKHKLNESFTILIPDVATVGHLIEFLHVKRLDLQKAKRPNNESEGATKVFKTFHSVEDITYNIYLGMTTNEKKTLNVSQDPNRQSSSSIVRTARKSMNRKMETTDKLSQXXXXXXXXXXXXXXXXXXXXXVDSSEFLVFYYQEILLKNCGNLLDIMN 1399
            MAIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACRKKLVSKRSLRRDVNFDAIIAKLFPYRKEYEAHQANVMAKQIKNSTRNLKANVSDRQNDKTSDNIEPPENVTNNSSSNNETESGSSKDQSSTASVNQKKYRNSAKYNERSSMAVQSDNNSSMQVDEELSVTASSEIALPQIRVRQPSSESGGPETNCSSSITSELNSLIGNQSRENIIPNTNTVNDKSSNSENHVDVILEPLDGRTGKHKLNESFTILIPDVATVGHLIEFLHVKRLDLQKAKRPNNESEGATKVFKTFHSVED+TYNIYLGMTTNEKKTLNVSQDPNRQSSSSIVRTARKSMNRKMETTDKLSQIINEYNLNKKKLKKDKIKQKLVDSSEFLVFYYQEILLKNCGNLLDIMN
Sbjct:    1 MAIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLDFLSNTMATKECLHRFCSQCIVTALRSGNKECPACRKKLVSKRSLRRDVNFDAIIAKLFPYRKEYEAHQANVMAKQIKNSTRNLKANVSDRQNDKTSDNIEPPENVTNNSSSNNETESGSSKDQSSTASVNQKKYRNSAKYNERSSMAVQSDNNSSMQVDEELSVTASSEIALPQIRVRQPSSESGGPETNCSSSITSELNSLIGNQSRENIIPNTNTVNDKSSNSENHVDVILEPLDGRTGKHKLNESFTILIPDVATVGHLIEFLHVKRLDLQKAKRPNNESEGATKVFKTFHSVEDVTYNIYLGMTTNEKKTLNVSQDPNRQSSSSIVRTARKSMNRKMETTDKLSQIINEYNLNKKKLKKDKIKQKLVDSSEFLVFYYQEILLKNCGNLLDIMN 447          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Planmine SMEST
Match: SMESG000018809.1 (SMESG000018809.1)

HSP 1 Score: 48.1358 bits (113), Expect = 2.625e-6
Identity = 28/45 (62.22%), Postives = 39/45 (86.67%), Query Frame = 2
Query:  263 CIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKE 397
            CI  A+++G KECP C++KLVS+RSLR+D NFDA+IAK++P RK+
Sbjct:    2 CISNAIKNGKKECPVCQQKLVSRRSLRKDSNFDALIAKIYPDRKQ 46          
BLAST of E3 ubiquitin-protein ligase RING2 vs. Planmine SMEST
Match: SMESG000018809.1 (SMESG000018809.1)

HSP 1 Score: 48.1358 bits (113), Expect = 5.734e-6
Identity = 28/45 (62.22%), Postives = 39/45 (86.67%), Query Frame = 2
Query:  263 CIVTALRSGNKECPACXXXXXXXXXXXXDVNFDAIIAKLFPYRKE 397
            CI  A+++G KECP C++KLVS+RSLR+D NFDA+IAK++P RK+
Sbjct:    2 CISNAIKNGKKECPVCQQKLVSRRSLRKDSNFDALIAKIYPDRKQ 46          
The following BLAST results are available for this feature:
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Human
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Human e!99)
Total hits: 5
Match NameE-valueIdentityDescription
RNF21.879e-4670.09ring finger protein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
RNF21.157e-4570.09ring finger protein 2 [Source:HGNC Symbol;Acc:HGNC... [more]
RING17.885e-4470.09ring finger protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
RING17.885e-4470.09ring finger protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
RING17.885e-4470.09ring finger protein 1 [Source:HGNC Symbol;Acc:HGNC... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Celegans
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Celegan e!99)
Total hits: 1
Match NameE-valueIdentityDescription
spat-32.098e-844.29Suppressor of PAr-Two defect [Source:UniProtKB/Tr... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Fly
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Drosophila e!99)
Total hits: 1
Match NameE-valueIdentityDescription
Sce1.523e-4669.92gene:FBgn0003330 transcript:FBtr0085245[more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Zebrafish
Analysis Date: 2016-08-08 (Schmidtea mediterranea smed_20140614 BLASTX Zebrafish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf22.196e-4670.94ring finger protein 2 [Source:NCBI gene;Acc:327035... [more]
rnf22.522e-4670.94ring finger protein 2 [Source:NCBI gene;Acc:327035... [more]
rnf22.884e-2970.00ring finger protein 2 [Source:NCBI gene;Acc:327035... [more]
pcgf5a1.314e-634.58polycomb group ring finger 5a [Source:NCBI gene;Ac... [more]
pcgf5a1.314e-634.58polycomb group ring finger 5a [Source:NCBI gene;Ac... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Xenopus
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Xenopus e!99)
Total hits: 3
Match NameE-valueIdentityDescription
ring15.771e-4671.79ring finger protein 1 [Source:NCBI gene;Acc:100037... [more]
ring17.785e-4671.79ring finger protein 1 [Source:NCBI gene;Acc:100037... [more]
rnf21.433e-4570.09ring finger protein 2 [Source:NCBI gene;Acc:407872... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Mouse
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX Mouse e!99)
Total hits: 5
Match NameE-valueIdentityDescription
Rnf28.370e-4670.09ring finger protein 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Rnf28.370e-4670.09ring finger protein 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Ring14.362e-4470.09ring finger protein 1 [Source:MGI Symbol;Acc:MGI:1... [more]
Rnf23.269e-2868.57ring finger protein 2 [Source:MGI Symbol;Acc:MGI:1... [more]
Rnf22.406e-2266.67ring finger protein 2 [Source:MGI Symbol;Acc:MGI:1... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. UniProt/SwissProt
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI UniProt)
Total hits: 5
Match NameE-valueIdentityDescription
sp|Q9VB08|RING1_DROME1.527e-4569.92E3 ubiquitin-protein ligase RING1 OS=Drosophila me... [more]
sp|Q803I4|RING2_DANRE1.904e-4570.94E3 ubiquitin-protein ligase RING2 OS=Danio rerio O... [more]
sp|Q4KLY4|RING2_RAT2.664e-4570.09E3 ubiquitin-protein ligase RING2 OS=Rattus norveg... [more]
sp|Q66J69|RNG2A_XENLA3.472e-4571.79E3 ubiquitin-protein ligase RING2-A OS=Xenopus lae... [more]
sp|Q99496|RING2_HUMAN5.558e-4570.09E3 ubiquitin-protein ligase RING2 OS=Homo sapiens ... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. TrEMBL
Analysis Date: 2020-05-01 (Schmidtea mediterranea smed_20140614 BLASTX EMBL-EBI TrEMBL)
Total hits: 5
Match NameE-valueIdentityDescription
A0A448X8977.651e-4973.39RING-type domain-containing protein (Fragment) OS=... [more]
A0A068Y0M81.080e-4837.59E3 ubiquitin protein ligase ring2 OS=Echinococcus ... [more]
W6UAK31.450e-4836.78E3 ubiquitin-protein ligase RING2 OS=Echinococcus ... [more]
A0A0R3WCT31.631e-4875.00RING-type domain-containing protein OS=Taenia asia... [more]
A0A0V0J5R33.454e-4875.00E3 ubiquitin-protein ligase RING2-A OS=Schistoceph... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Cavefish
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Cavefish e!99)
Total hits: 5
Match NameE-valueIdentityDescription
rnf21.926e-4670.94ring finger protein 2 [Source:NCBI gene;Acc:103033... [more]
RING15.999e-4671.19E3 ubiquitin-protein ligase RING2-A [Source:NCBI g... [more]
RING13.985e-2968.49E3 ubiquitin-protein ligase RING2-A [Source:NCBI g... [more]
toporsb7.116e-654.76E3 ubiquitin-protein ligase Topors-like [Source:NC... [more]
toporsb7.116e-654.76E3 ubiquitin-protein ligase Topors-like [Source:NC... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Sea Lamprey
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Sea Lamprey e!99)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Yeast
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Yeast e!Fungi46)
Total hits: 0
Match NameE-valueIdentityDescription
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Nematostella
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Nematostella e!Metazoa46)
Total hits: 1
Match NameE-valueIdentityDescription
EDO499552.546e-4368.38Predicted protein [Source:UniProtKB/TrEMBL;Acc:A7... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Ensembl Medaka
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Medaka e!99)
Total hits: 4
Match NameE-valueIdentityDescription
RING12.624e-4668.33ring finger protein 1 [Source:NCBI gene;Acc:101165... [more]
RING12.769e-4668.33ring finger protein 1 [Source:NCBI gene;Acc:101165... [more]
rnf21.222e-4570.94ring finger protein 2 [Source:NCBI gene;Acc:101163... [more]
ENSORLT00000040811.15.702e-747.83polycomb group ring finger 2 [Source:NCBI gene;Acc... [more]
back to top
BLAST of E3 ubiquitin-protein ligase RING2 vs. Planmine SMEST
Analysis Date: 2020-05-08 (Schmidtea mediterranea smed_20140614 BLASTX Planmine SMEST)
Total hits: 3
Match NameE-valueIdentityDescription
SMESG000047040.10.000e+099.78SMESG000047040.1[more]
SMESG000018809.12.625e-662.22SMESG000018809.1[more]
SMESG000018809.15.734e-662.22SMESG000018809.1[more]
back to top
Sequences
The following sequences are available for this feature:

transcript sequence

>SMED30023432 ID=SMED30023432|Name=E3 ubiquitin-protein ligase RING2|organism=Schmidtea mediterranea sexual|type=transcript|length=1409bp
ATTATTTATGCTTTTTTTGGATGAAATAATTTGTAAATTTTGAAATATAT
TTAACTAAATGGCCATTGAAAAAGCTCCTTCAAAAAACTGGGAATTAACT
CTATATGAAATGCAAAGAAAACCTCAACCATTAATAACGGATGATTCCGA
AATAGCAATTTGTCCATTACGTTTAAGTAATGAATTAAAGTGTCCAATTT
GTCTGGATTTTTTAAGCAATACTATGGCCACAAAGGAATGTCTACATAGA
TTTTGTTCTCAGTGTATTGTAACAGCACTTCGGTCGGGAAATAAAGAATG
TCCTGCTTGTCGTAAAAAATTAGTATCTAAACGATCACTCAGGCGCGATG
TAAATTTTGATGCAATTATAGCGAAACTTTTTCCATATCGAAAAGAATAT
GAAGCTCACCAAGCCAATGTCATGGCAAAACAAATCAAAAACTCCACCAG
AAATTTAAAAGCTAATGTTTCCGATAGACAAAATGATAAAACATCAGATA
ACATTGAACCGCCAGAAAATGTAACTAACAATTCATCGAGTAACAATGAA
ACTGAATCCGGCTCGTCAAAAGATCAAAGCAGCACGGCTTCAGTTAATCA
AAAAAAATATCGAAATAGTGCTAAATATAATGAGCGCTCATCGATGGCTG
TTCAATCGGATAATAATTCCAGTATGCAGGTTGATGAAGAGCTCAGTGTT
ACCGCATCCTCGGAAATTGCTCTGCCACAAATACGAGTAAGGCAGCCGTC
CAGTGAAAGCGGTGGCCCTGAAACCAATTGTAGTAGCTCTATCACGTCAG
AACTAAACTCTCTGATTGGAAATCAGAGTCGCGAGAATATTATTCCGAAT
ACCAACACGGTGAACGATAAATCTTCAAACTCAGAAAATCACGTCGACGT
AATATTAGAACCTCTCGACGGGCGAACTGGAAAACATAAACTAAACGAAT
CATTCACTATTTTAATTCCCGATGTAGCAACCGTTGGACATTTAATTGAG
TTCCTTCACGTTAAGCGCTTGGATTTACAGAAAGCTAAACGACCAAACAA
TGAATCTGAAGGCGCTACGAAGGTGTTCAAAACCTTTCACTCCGTCGAGG
ATATCACCTATAATATCTATCTTGGCATGACAACTAATGAAAAGAAAACC
TTAAATGTTTCACAAGATCCAAATCGCCAGAGTTCGAGTTCAATAGTTCG
AACTGCTCGAAAAAGTATGAATCGAAAAATGGAAACTACAGATAAACTAA
GTCAAATAATAAATGAATACAATCTAAACAAAAAGAAATTAAAAAAGGAT
AAGATAAAACAAAAGCTAGTCGATAGTTCAGAATTCTTGGTGTTCTATTA
TCAAGAAATTCTGTTAAAAAATTGCGGCAATCTATTGGACATAATGAATT
AATTTCTTT
back to top

protein sequence of SMED30023432-orf-1

>SMED30023432-orf-1 ID=SMED30023432-orf-1|Name=SMED30023432-orf-1|organism=Schmidtea mediterranea sexual|type=polypeptide|length=448bp
MAIEKAPSKNWELTLYEMQRKPQPLITDDSEIAICPLRLSNELKCPICLD
FLSNTMATKECLHRFCSQCIVTALRSGNKECPACRKKLVSKRSLRRDVNF
DAIIAKLFPYRKEYEAHQANVMAKQIKNSTRNLKANVSDRQNDKTSDNIE
PPENVTNNSSSNNETESGSSKDQSSTASVNQKKYRNSAKYNERSSMAVQS
DNNSSMQVDEELSVTASSEIALPQIRVRQPSSESGGPETNCSSSITSELN
SLIGNQSRENIIPNTNTVNDKSSNSENHVDVILEPLDGRTGKHKLNESFT
ILIPDVATVGHLIEFLHVKRLDLQKAKRPNNESEGATKVFKTFHSVEDIT
YNIYLGMTTNEKKTLNVSQDPNRQSSSSIVRTARKSMNRKMETTDKLSQI
INEYNLNKKKLKKDKIKQKLVDSSEFLVFYYQEILLKNCGNLLDIMN*
back to top
Annotated Terms
The following terms have been associated with this transcript:
Vocabulary: Planarian Anatomy
TermDefinition
PLANA:0000422tail stripe
PLANA:0002142parenchyma
Vocabulary: INTERPRO
TermDefinition
IPR001841Znf_RING
IPR013083Znf_RING/FYVE/PHD
IPR017907Znf_RING_CS
Vocabulary: molecular function
TermDefinition
GO:0008270zinc ion binding
GO:0005515protein binding
GO:0016874ligase activity
InterPro
Analysis Name: Schmidtea mediteranean smed_20140614 Interproscan
Date Performed: 2020-05-01
IPR TermIPR DescriptionSourceSource TermSource DescriptionAlignment
NoneNo IPR availableCOILSCoilCoilcoord: 394..414
NoneNo IPR availablePFAMPF13923zf-C3HC4_2coord: 44..84
e-value: 1.0E-13
score: 50.9
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 365..388
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 130..243
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 148..243
NoneNo IPR availableMOBIDB_LITEmobidb-litedisorder_predictioncoord: 365..384
NoneNo IPR availablePANTHERPTHR46076:SF2E3 UBIQUITIN-PROTEIN LIGASE RING1coord: 5..188
NoneNo IPR availablePANTHERPTHR46076FAMILY NOT NAMEDcoord: 5..188
NoneNo IPR availableCDDcd16531RING-HC_RING1_likecoord: 45..85
e-value: 3.41026E-23
score: 89.7987
NoneNo IPR availableSUPERFAMILYSSF57850RING/U-boxcoord: 39..114
IPR001841Zinc finger, RING-typeSMARTSM00184ring_2coord: 45..84
e-value: 7.8E-7
score: 38.7
IPR001841Zinc finger, RING-typePROSITEPS50089ZF_RING_2coord: 45..85
score: 12.342
IPR013083Zinc finger, RING/FYVE/PHD-typeGENE3DG3DSA:3.30.40.10coord: 37..110
e-value: 4.6E-20
score: 72.9
IPR017907Zinc finger, RING-type, conserved sitePROSITEPS00518ZF_RING_1coord: 61..70